Roseiflexus castenholzii DSM 13941 uid58287

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|156740228|ref|YP_001430357.1| OsmC family protein [Roseiflexus castenholzii DSM 13941]
    MTTLPEYLDFKAQRVAALREKLSAPDAAPSLLHVLARVAGGSGVRPVSIREFTIVTDSAPALAGYNLGPTSPELLLASLA
    S
    CLAHTYLIVAVNRGVRFDTLEVEVTGQIDFRGILEVDADAPIPPSGLAYVARVSGEVSDDELCQIQADVERLCPVFRAL
    VEPVPVNGRVERVA

    >gi|156740316|ref|YP_001430445.1| copper ion binding protein [Roseiflexus castenholzii DSM 13941]
    MISDQFRVPGISCQHCVNAITKAVSALPGVRQVVVNLGDKSVRVDHDRQVTADDLIRAINDAGYDDVAVLV

    >gi|156740334|ref|YP_001430463.1| rhodanese domain-containing protein [Roseiflexus castenholzii DSM 13941]
    MSGYAHPEALVDTAWVADHLNDPKVRIVECDEDILLYDQGHIPGAVKIDWVGELNDPIIRDYLDRERFERLMVSKGISND
    TTVVFYGDKHNWWATYALWVFKLFGHADARIMNGGRAKWIAEGRPLTREVPSYPPGEYHAPERNDAAIRAFRDQVLAHIR
    QPGTALVDVRSPQEYTGERLHMPEYPQEGALRGGHIPTAVNIPWASAVREDSTFKSADELRELYAGKGITPDKDVIAY
    CR
    IGERSSHTWFVLTYLLGYPNVRNYDGSWTEWGNAVGLPIEK

    >gi|156740340|ref|YP_001430469.1| UBA/THIF-type NAD/FAD binding protein [Roseiflexus castenholzii DSM 13941]
    MILSSLSNEEIRRYSRHLILPEFGMEGQRKLKQGSVLLIGTGGLGSPLALYLAAAGVGHIGLVDFDIVDESNLQRQIIHG
    TSTLGIRKTESAKMRLRDLNPHIDIATYETQITSENAFDLMRPYDVIVDGTDNFPTRYLTNDACVMLGKPNVYGSIFRFE
    GQATVFSPKHGGPCYRCLYPEPPPPGLVPS
    CAEGGVLGVLPGVIGTIQATEAIKLLTGIGEPLIGRLLLYDALAMRFREL
    KLRRNPDCPVCGDHPTVTELIDYQQFCGISPEEAHRDATIEITPAEVAEWLQSDHPPFLLDVREANEWEICHLPGAVRIS
    VNELAERMNELDSAVEMVVY
    CRSGVRSARAVDLLRQAGFRKVKNLAGGILRWADEVDPGVPKY

    >gi|156740343|ref|YP_001430472.1| rhodanese domain-containing protein [Roseiflexus castenholzii DSM 13941]
    MTTDHLVSLDWLAERLNDPDIRIADLRWYLLEPGRGRTEYLEAHIPGAVYLDIDTDLSAPPFQGPGRHPIPAPEAFAAVA
    SRTGIGSKTHVIAYDSVGGAYAARLWWLLRYFGHERVSLLDGGWPAWVAAGLPVESGEVTPPPTMFIPHPNRAMVVDADT
    VDVLRRDPRVLILDARAAERYQGIAEPLDPRAGHIPGAVSAPYADNVDADGRMRSVEELRARYAALGADRAETIVCY
    CGS
    GVTAAHTILALARAGWKNTLLYEGSWSDWSRDPARPAATGSEPWGGEG

    >gi|156740693|ref|YP_001430822.1| thioredoxin reductase [Roseiflexus castenholzii DSM 13941]
    MHSKVVIIGSGPAGLTAALYAARANLEPLVIRGLQPGGLIATTSEVENYPGFVEGIGGFELADNMEKQAARFGARYMDAI
    VERVDLSQRPFHIFPDNGEEVTADALIISTGASPRKLGVPGEERLANRGVSY
    CATCDGFFFRGKKVVVVGGGNSALDEGL
    FLTRYVSDLKIVHRRDALRADPILQERAFSNPKVSFVWNSVVEEILGDDKVTGVRVRNLKTGEVSIIETDGVFPYIGHIP
    NTSLFKGQLELDENGYIIADHRTRTGIPGVFAAGDVVDHIYRQAITAAGEGCKAAMEATWFLSEQEHAAKKSAELAATPA


    >gi|156740842|ref|YP_001430971.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Roseiflexus castenholzii DSM 13941]
    MRQREMCAFPRTQAIRRLAAVALLTLVAALAGCAGQRAGSSSGGSAVVEIPRGVAIESRLVERGGGIPSQGDVAPDFAFT
    FANGETRRLSDLRGAKVVVNFWATW
    CAPCEEEMPDLQRLDERSDVVVLGVNRLELPEVIIPFARERNLTFTLIANPDGDI
    VERYGAKNIPISYFINSDGTIGYRQLGIMTFDRMQEQVDRLR

    >gi|156740866|ref|YP_001430995.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Roseiflexus castenholzii DSM 13941]
    MPFSRNLWDLFLVATLLIGSVFIWTTRMTSGIAAPSLTPAPGAMQPAPRIGHPAPEFTLTAIDGTEITLSDLRGQVVLIN
    LWASW
    CPPCRAEMPAIQHAYERFRDQGFIVLAVNQQEDVATVVQYMHDQQLTFPALLDSDARVGAAYQVRMLPSSFFVDR
    RGMIRAVYRGPMSRGMIEGTIEQLIAETP

    >gi|156740898|ref|YP_001431027.1| sulphate transporter [Roseiflexus castenholzii DSM 13941]
    MLAALQKFPATIARPVEVMRGYSLETLRADLVAGVTVGLVLLPQALAFSLLAGLPPEMGLYSAIVASIIGALWGSSSHLH
    TGPTNTASLLTLSVILPLAAPGTPEFMALAGMLAVLAGALRLIFGLARLGLLVNFVSDSVAVGFTAGAGILIISNQIAPI
    LRLDLPMGVGLIETFVLSAAQIQRTHLPSLLLGVATIALIATLQRLRRRLPTLLIALVVVSAIAWVLRLEESGVRTLGVL
    PQSLPPLAKLPLLDLNLIGALANGALAVAIIGLVEASAIARAIATHSQQRLDSNQEFIGQGLANICAGFFSGYPCSGSFN
    RSALSFQSGARTSLGNAFSGVFVLIAMFPLAPLIAHLPRPVLAGALAITAWSMVDHLAIRRIWRADRVDGTISLITLAAT
    LFVPLQFAIISGVLMSLGAYLWRTSAPRVQSVLPDAAFRHWEYQPHLPVCPQLAVVDVLGDLYFGAVNHVEEQMNVLLTR
    NPTQRFLLLRMHSVQRCDVSGIKMLQTIVRQYRDRGGGVYFVRVRQPVRQMMDVTGFTQYVGADHFLDEDHAIDHLFHRV
    LDPAVCIYECEVRAFRECQNLPKRPLPPEAIPLLPERGAPLQVPMIEPRELWQQIRSPYPPRVIDVREPREYRQGHIPQA
    ELLPLYELLTHSDNVRRDRPIVLA
    CRSGRRSERAAAALMRRGFDRITILRGGMLAWEASDLLMAIGQENGG

    >gi|156741029|ref|YP_001431158.1| redoxin domain-containing protein [Roseiflexus castenholzii DSM 13941]
    MERPNAFDFWGPKTLIGPELKPGDPAPAFTLTTGKDTISSQQFAGKPLVISVIPSIDTGVCSKQTRRFNQEAAALGDAVN
    ILTVSADLPFAQGRWCGAEGVDKVVMASDHLDMSFGAAYGTYVKELRIESRAVFVVDKDGIIRHVEYVPVAGHEPNYDAA
    LAALKELL

    >gi|156741098|ref|YP_001431227.1| heavy metal translocating P-type ATPase [Roseiflexus castenholzii DSM 13941]
    MLYLIFATIGKVTMPEQTIHLAVTGMTCASCSARVAKALKKAPGVTDATVNLASEQAEVHFDSSLVTPDRLITAVEEAGY
    GVITEHVDIPITGMT
    CASCAARIEKALRRVPGVIDAAVNLASERATVTFTPADVTWSDLVAAIEDAGYGVIDQRTAADAG
    EDGEAAARARELANRRRTLTVAVVLTAPLFLLSMGRDLGLIMPWLIGAGAEMARSMSGPLHEMMNHIAARDDLLNWLFMI
    LATPVQFYAGRDFYVHAWKALKNHRTATMDTLIAVGSSAAYFYSAALMVTGMAGHVYFETAAVIITLILVGKYLEARAKS
    QTGAAIRALIGLQPKMARVVRGGREVDIPAADVRRGDIVVVRPGEKIPVDGVIISGSSAVDESMITGESMPVEKREGDTV
    IGATLNRSGGFQMRATRVGRETALAQIIALVQQAQGSRAPVQRLVDQVSAVFVPIVLLVALLTFLGWFFIGGTGFTQAMI
    FAVAVLVIACPCALGLATPTAIMVGVGTGAAHGILIKNAESLERAGKVQTVVLDKTGTVTVGKPAVTDIVVHATDALASV
    VQSAPLIQTQADDSVHPNGSQDVVRQTSDATAMATIHGISVAAADLGDRRADLEQFLKSVGDGDLPDAHPLSAAVTRVAQ
    QRTELLRLAASAESRSEHPLGEAIVRAAQDAGISVVQPERFEAIAGHGVIALVEGRTIVIGNPALMLDRGIDTSALDAHV
    ARLQSEGKTAMIVAVDRMAMGVIAVADTVRHTSRAAVETLHRRGIDVLLITGDNRRTAEAIARQAGIDRHKVYAEVRPED
    KARIVREVQEGAGMRRIVAMVGDGINDAPALAQADVGVAMGSGADVALETADIALMRGDLHGVAQAIDLSRRTLQTIRWN
    LFWAFIYNVLLIPVAAGALYPFTGWQLNPMLAAGAMAFSSVFVVTNSLRLRRALSVER

    >gi|156741163|ref|YP_001431292.1| alkylhydroperoxidase [Roseiflexus castenholzii DSM 13941]
    MRRTSPFPRRYYASLSQFLADAAWLFRHRTRLRQARTMLSPAFRERLMLAVTAVNRCRYCSFAHTRIALAVGVTNAEIAR
    ILDQTFSDCPPDEAPALAYAQHWAETDAAPDPTARERLSCEYGVLRADAIEAVLRMIRVGNLLGNTFDYILFRLSGGRLG
    LTDDDRRLV

    >gi|156741310|ref|YP_001431439.1| methylated-DNA--protein-cysteine methyltransferase [Roseiflexus castenholzii DSM 13941]
    MERKRIIRYSVSPSAFGYLLIAATERGICTVALGDNPAALINDLARRFGDTILDQAGGLPGGWMNILLGYLNGERKNLDL
    PLDVAATPFQQEVWNALRAIPYGTTQTYQQVAQRIGRPDATRAVAQACANNPVALIVP
    CHRVVRTDGTSGGYRWGIERKR
    ALIAHEAAHIELCAS

    >gi|156741319|ref|YP_001431448.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Roseiflexus castenholzii DSM 13941]
    MADQRLNVGDPAPDFTAMTDSGDTIRLSDFRGKRVILYFYPKDDTSGCTTQACGFRDAYPQIEEKNAVVLGVSPDGVKSH
    QKFKTRHNLPFTLLVDEDHTIAEAYGVWAEKSMYGKKYWGIERSHFVIDENGMIVEAAVKVKPEESVKRAVAALG

    >gi|156741356|ref|YP_001431485.1| protein-disulfide isomerase-like protein [Roseiflexus castenholzii DSM 13941]
    MYQNTDKAGMTPHRQRAAAALLFLFMVIAALMTDHAQAQNDADPRGLGDPNAPIVIIEYSDYECPACASFVRDAKPQLIA
    EYIETGKVYYLYRDNPLPQHPAGRIAAIYAHCAVRQGQFWPMHRRLFQGYIDGEWGGDPSASERVFRRYGDELGLDSGAL
    QECVRDPTTEQAIAADIEEARNRGLRGTPAYILRWPGGPERGDVLTGAQSFGTWRALLDERLSAQPDPATASPGFGAQAS
    LFIYLALGAAGGLAVLVVGGSILWWLARRDHSSPM

    >gi|156741430|ref|YP_001431559.1| peroxidase-like protein [Roseiflexus castenholzii DSM 13941]
    MSRRSVFLTPLCAVRQAYNERATHRYDAPMPVWFHSALPREVCMDAPEHPISRFPLPVRIDELPPDIRKRIEQVAVKSGF
    VPNIFLALAHRPDEFRAFFAYHDALMNRPSNLSQAEKEMIVVATSAVNDCLY
    CVIAHGAILRIRSKNPRLAEQIAANYRR
    AEITPRQRAMLDYAQKVAVDSARISDDDWQPLYQHGFTQEDIWEIGAIAAFFAMSNRLANMSALRPNDEFYGMGR

    >gi|156741485|ref|YP_001431614.1| rhodanese domain-containing protein [Roseiflexus castenholzii DSM 13941]
    MFNFFRPQPRHDEITPTEVQQRLARGDRLYLLDVREREEYVEAHIPDSVLIPLGQLSRKLSSIPKDATIIAICRSGNRSG
    VAADMLRRAGYGDVLNLRGGIIAWVRAGLPVVA

    >gi|156741642|ref|YP_001431771.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
    MLSTKGIHRVIKQHQVLPLAIILPIIIAACGGTPSAAPTPPQSAPIVSTAPSATQVSAVATPASDTPAATTEAAGLERGR
    TPEGYHYLGNADAPVTILEFSDFL
    CTACAFHVEETEPAIIDAYVATGKARIVYRHLLQLGEESLRAAEAAECAGDQGKFW
    EMRDAIYRNQAALYTTGDVGAALTYLAQTIDLDMNEYNVCVQSRKHRARIEADFRAAQDAGIRSRPVFDIGGTRLVGARP
    FEDFQAILDQQ

    >gi|156741738|ref|YP_001431867.1| rhodanese domain-containing protein [Roseiflexus castenholzii DSM 13941]
    MQRNVSLCCTVLALLNMGEYMHPFFRAPYLDLTTDQVKAKLDRGDPFRFIDVREPEEYAIARIEGAELLPLSRAAEWIGT
    LDPGQEYVFF
    CHHGQRSAYVAAYVASNLGFTRVANMTGGIEEWSLRIDPSVPRY

    >gi|156741739|ref|YP_001431868.1| iron-sulfur cluster assembly accessory protein [Roseiflexus castenholzii DSM 13941]
    MATIEQDVINQHQESEFPPVLEITEGASLRLQSMMKERNLEGYGLRVFVSGGGCSGLQYGMTFDNEERFGDTVWNAHGLR
    IMVDPISARYLTGATISYQQDNMLAGAFKIDNPNAVSSCGCGHSFRTKEQQGTDDDYDGYGNGGGCCSSH

    >gi|156741915|ref|YP_001432044.1| rhodanese domain-containing protein [Roseiflexus castenholzii DSM 13941]
    MRLRVRNLNLEKLYKLSFVRSNETLSDSTQEQHVRGCNDERCDAPWRRRALAVIRCLAVVRCDAAILKGHAQKGRAVFCA
    GRGCAMEHGSPRIGTDGRGWGAPLFPVSWFSVPGSQYLNGANVMKRLFFLTLTTALFVLASCAGAPAASMPVAPNIVQSS
    TIDVANLPLNVDVATVRAIMERDDVVLLDVREPEEYAAGHIPGVRLMPMGTVPVRLNEIPTDKTVIVT
    CRSGNRSGQITD
    FLRRNGFTNVHNMQGGILAWQRAGYPVEK

    >gi|156742054|ref|YP_001432183.1| rhodanese domain-containing protein [Roseiflexus castenholzii DSM 13941]
    MDRTLLRTAGAAVAGALVTLIIVAITFSTRPQPEATPTVAPTAPAAPVVAPSPREPRKFEDVVVSTEWLAQNLDNPKVRV
    IEVSVAPGVYERGHIPGAVNFVWTTDFVDTVSRNIIAPERFQELARAAGIDNDTTIVLYGDNNNWFAAWGAWVFRQYGAE
    DVRLLDGSRSKWEAENRELSTRAPTYPPGNFTVRQRSDLRVFLPDVLKVVRGEDNRVLVDIRSPDEFSGKIFAPEGFQEL
    AVRAGHIPGAVNVPWKQALRDDGTFKSVEELRKLYADAGVDGSKPVITY
    CRIGERASHTWFVLSEILGYQAALYDGSWTE
    YGNSVGVPIANPAGTIWGVK

    >gi|156742055|ref|YP_001432184.1| hypothetical protein Rcas_2080 [Roseiflexus castenholzii DSM 13941]
    MSNALPGSSPTDRAAPSKTELTAADVLRYGGALLMVAALLGGAYLLQAMPGRGSAAALSLLIGAALGVAFERGRFCFFCI
    FRDFIEYRNAGPLSAILMALAVSGIGYAIVFGAFLPNPAGGRLAPDAHIGPVSPALVAAGLMFGLGMALSGA
    CISGHLYR
    LGEGSGYAPPALIGALIGFGLGFRTWNWLYAMVIADAPVVWLPHWVGYGGSLLLHLTVLGILALMLLRFVPPLPPRPARQ
    LDITYLREALFRDRWNPLVTGAMVGIISVVAYLRVEPLGVTAQLGSATRTVMNWAGWLPDRLNGLDSFAGCATQVVQTIT
    DNGWLIGGLVLGAFSAALLAGRFQPALPRAWGSVTALLGGVLMGWGAMTALG
    CTVGTLLSGIAAFALSGWVFGAAVFVGV
    WLGITLRLHRWV

    >gi|156742078|ref|YP_001432207.1| dihydrolipoamide dehydrogenase [Roseiflexus castenholzii DSM 13941]
    MTDTLYDVVVVGGGPGGYVAAIRAAQLGLKTAVVERQAMGGVCLNVGCIPTKALLHTADLLEELREAKRFGVVVEGVSLD
    WEATLRQKDTVVKTMTSGVSFLMKKNKVDVINGFARLAGRGQVAISTPEGQHRTVTAKNIIVAVGARPREIPAIGAVFDN
    DRILSSTGGLSIPSVPKSLLVVGAGAIGVEFASMYRSFGAEVTLVEMLPRVVPLEDEEVSAELARALNRRGIKVFAGSKL
    NHLEKIDGGVIARLVDAQGAEHALTFERALVGVGIVPNTGDIGLEEVGVALDQRGFIKVDDYMRTNVEGIYAIGDCAVTT
    PWLAHKASAEGIIAAETIAGHHTQPLDYGKIPSCTYCNPEIASVGLTEAKAREQGYDVKIGKFAFTGNGKATILGQRQGF
    VKIVADKQYDEVLGVHMIGPRVTELIAEGGLALSHEATAESIMRTVHAHPTLYEAIVEAAHAAAEGAAIHM

    >gi|156742214|ref|YP_001432343.1| heavy metal translocating P-type ATPase [Roseiflexus castenholzii DSM 13941]
    MRTENREPMQTQTRDHIFTVHGIDCAHCANTIEVSLVRLDGVEVCELNATTGRLRVRGAVEPDTVIAYVRSLGYEATPTD
    ETGATSPSSDAPVSFVRFMWQRVETRLALVGAVLIVPGVVLHELLGWRTLWIDALAWAALVAAGLPIARSAWRSLVVSRT
    ISINALMTIAAVGAVIIGAHVEAGLVMVLFAIGEAIEGFTAARARDAIRSLMTLAPETALRLRDGYETRVPVAELEVGDV
    IIVRPGERVPMDGVVRSGATHVDQAPITGESVPVVKTPGAHVYAGSINGEGVMEVVVTHPASENTISRMIRLVQEAQDRR
    APVQRMIDRFAGWYTPAVVGIAALMATVPPLLFGQPFWNPSPDETGWFYRSLALLVVACPCALVISTPVSVVSALSAAAR
    AGVLIKGGAALEALGGIRAVAFDKTGTLTTGKPTLVMVRSVDCREPEQNNDARCDACDTLLELACAVERRSEHPLAHAIV
    DAARRRGLSQTVPPAASVAALPGHGIIGEVEGRTVVIGSHRYFDETSPHPRSFCNRAEQDASVGRTPLMISVDGVFAGML
    SVADTVRPESREAVALLREAGIEHIIMLTGDRRETAYAVAADVGVDDVRAEVLPAHKAETVENLRAAYGAVAMVGDGIND
    TPALASATVGIAIGAAHGGANQAMETADVTLMSNDLRRLPFVFALARAARRTIMLNVAFSIAVKVVFLAIVAAGWSTMWM
    AVFADMGTSLLVTLNGLRLLGFRPKTEAFS

    >gi|156742284|ref|YP_001432413.1| type 11 methyltransferase [Roseiflexus castenholzii DSM 13941]
    MTHHFSSSETIKDQVRDHYAQRIQSGTCCGPSSGWCDNSTPTEIALYGAETVAALPQGLTSFGCGNPVALASLRMGEVVL
    DLGSGGGLDVLLAAQRVGATGYVYGLDMTDEMLSVARRNAERAEATNVEFLKGDIERIPLPSNTVDVIISNCVINLTPDK
    ALALGEAFRVLKPGGRLAISDIVIDGDLSRFPVTEGQIRAALSWTG
    CIAGALTIEEYRTLLSDAGFTDSAVTVQHRYTID
    DLPSDAPLDLATIPADVLNGLAGCFTSSAITARKPE

    >gi|156742333|ref|YP_001432462.1| dehydrogenase-like protein [Roseiflexus castenholzii DSM 13941]
    MKRVLIIHPGEGDMVSPVTFLNQDVEVRRIGCGGDIARARALIAEYDGAVDAIGLDGMPAILRLGAAQVQHVIGADLPAV
    ARVTPVVDGSGVRPELERWGIILAERAHPLIFNQKRVLFVPGVNHEGLAQALGRRTPALRFADPQIFFGLPDAPGVGSAQ
    TLDQAAAPTLEALKEASFETLAGLVGAPHHPGSFVWADILAGNIAAIRRFAPERLDRKMVIVEAASDEDIADLRARGVET
    LITLMPSLSGKGEVARHSATTIEALLAALRPDPRAPLTEDTYLDLLANLDWAPAVVTLQPEAAGVNKFAFVIHPLSVRFI
    HDYPPFYWTRYIPDTIVEAAAAYVPPIYVGKITGGRSPTTGQRIEGYLISLGATPRQMMKHSPRFTYNLLNQAAHLAERL
    GARIMGLGAFTSVVGDAGITVANEADIAITSGNSLTVAATLETAKIAARMMGYKDLSRGRIMVIGATGSIGSACARLAAQ
    ATKDVVLVSIEPEKLIDLKRLIERETPGSRVVISTHANSLAGECDLIITATSAFGQRVLDVTECKPGAIICDVARPPDIN
    PAEAALRPDVLVIESGEVLIPGDVEIGYDIGLPPRTVYA
    CLAETSLLAMEGRFEDYTLGRNISPERVKEIYRLFRKHGYR
    LAPLRSFEEYITEEQIMHKRRLAEELRADPDLFARRKAEAKERLKSIPEMAKGVRAARRGKHSAAWGWAGVGAVALSLIA
    LRRQARMP

    >gi|156742496|ref|YP_001432625.1| thioredoxin [Roseiflexus castenholzii DSM 13941]
    MSLANKSASGAVIDVNERTFRAEVLERSRTVPVVVDFWAPWCGPCRVLGPILEKLAIEAKGAWILAKLNVDENPRLAQMF
    QVQGIPAVKAFRDGRVVDEFTGALPESQVRAWLKRLGPLAPVSPADRLADEAAALEERDPLSAKARYESALNIEPNHSAS
    LFGLGRLMVRAGDPAGAELLKKIPSDAPQWKQAQAWLTLADLITEAEDTNPSALLERIDQNPADLEARWLLAAHQVRGQR
    YADAIETLLGIVMRNRAFRDDGARKVLLALFTALGDQHPLTVKGRRDLANVMF

    >gi|156742889|ref|YP_001433018.1| periplasmic binding protein [Roseiflexus castenholzii DSM 13941]
    MRIVSLLPSATEIVCELGLADMLVGVSHECDYPPDVVADLPRVTYSAIPHGLSSAEIDQVVSARLARGESLYLLDEALLA
    DVQPDLVITQELCDV
    CAVSFADVCVVAAQLPGNPRVVSLAPPNLDGIFSDVLTIAEAVGVPERGRRLNERLSQRLDGVRR
    AVAGQPRPGVVALEWLDPPFIGGHWVPEMIHLAGGRDLLGRAGERSFRVRWEDVLCAQPDVVLLIPCGYSAEAAQREWDA
    LPRPPGWFDIPAARKGQVYALDANSYCSRPAPRVVDGVEHLARLLHPACFPQEGTAQ

    >gi|156742897|ref|YP_001433026.1| glutathione peroxidase [Roseiflexus castenholzii DSM 13941]
    MGIYDITANRIDGTPQPLSDYRNRVLLIVNVASKCGFAPQYAGLETLYRRYRDEGFVVLGFPCDQFAGQEYDDPNAIQQF
    CTRNYGVSFPIFEKVDVNGPNTHPLFALLKAEKPGLLGIQTIPWNFTKFLVDRQGKVRRRYAPTDTPEKIERDIAALLRQ
    PTAITAQ

    >gi|156742928|ref|YP_001433057.1| electron transport protein SCO1/SenC [Roseiflexus castenholzii DSM 13941]
    MRRSLRMALLIAFAIIVSACGRYEFRGVTLDPPKEAPDFTLTDFDGKPFHLSDHRGKVVILFFGFTNCPDMCPAALSDMA
    AARRKLGADAEKVQGVFVSLDPDRDTPERLKRYVTAFDPTFIGVRGSETELAPAVKDYGVTYMRRELPGSALGYTIDHST
    FIYVIDAAGRWRLLFTHGMPVDDIVSDLRYLVRRGGA

    >gi|156742936|ref|YP_001433065.1| hypothetical protein Rcas_2990 [Roseiflexus castenholzii DSM 13941]
    MPNAEPTRRPNRLINETSPYLLQHAYNPVDWYPWGEEAFARAQAEDKPILLSVGYAACHWCHVMEHESFEDEETAALMNR
    YFVNVKVDREERPDVDSIYMTAVQAMTGSGGWPMTVFLTPDGTPFFAGTYFPPEDRWQMPSFQRVLRSVAEAYATRRNDL
    LARGRELVERMREASMMQIPGSTLTPAALDSAFMGLQQAFDPEYGGFGRAPKFPQPMTLEFLLRYAARTGRGMEMLERTL
    RAMAEGGMYDQIGGGFHRYSVDAQWLVPHFEKMLYDNALLARVYLETFQATGNAFYRRIAEETLTYMLREMQHPDGGFFS
    TQDADSLPTADATHKHEGAFFVWTPAEIREALGADATVFSALYGVTDRGNFEGKNILHVQRSPAEVARVMGMSVERVESI
    AERGRRVLFAVRQHRPKPELDDKVLTAWNGMALRAFALGAIVLDREEYRTAAVRCAEFVLRELRRADGELLRSWRQGVAN
    PTPAFLEDYALLADGLLALYEATFDPRWLLEARALADALLERFWDDGIGGFYDTGSHHEQLVIRPRDTGDNATPSGSSAA
    ADVLLRLALIFDEPRYRERALTVLSAMAPLMERYPTGFGRYLAAAEFALSQPREIALIGDPEAADTRALAAIALKPFLPN
    RVVVLARPGEDPPRIPSPLLAGRTPIDGRAAAYVCQNYACRLPVTKPADLAAQLQP

    >gi|156742997|ref|YP_001433126.1| methionine-R-sulfoxide reductase [Roseiflexus castenholzii DSM 13941]
    MKQYTKPSDDELRRRLTPEQYEVTQHEGTEPPFQNAYWNNKAHGIYVDVVSGEPLFSSLDKYDSGTGWPSFTKPLEPGNI
    VTREDRKLWMVRTEVRSKHGDSHLGHVFDDGPAPTGLRY
    CMNSAALRFIPVEKLEEEGYGEYLPLFEGVSNKSST

    >gi|156743132|ref|YP_001433261.1| MCP methyltransferase, CheR-type [Roseiflexus castenholzii DSM 13941]
    MGRDMWSEWLLHRRFGGDAQRMQSVLDFLRPVRDKVLDNARLAEGDTVLDVGCGDGLIAFGALERSASGTIIFSDISQDL
    LNHARSLAREMGLLDRCQFLLAPAEDLSVLEDASVDVVTTRSVLIYVSAKQQAFREFYRVLKPGGRLSIFEPINRFGMDI
    SEQPH
    CFAGYDVTPVIDIAQKVKALYHKLQPRDSDPMLNFDERDLIAYAEQAGFREIRLELQIEVTSPGNAAMSVKDGDW
    EAYVRTAWNPKIPTLEEAMRQVLTPEESETFTAHLRPLVEAHQRVHRSAVAYLWAVR

    >gi|156743266|ref|YP_001433395.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
    MEQTMSTRSQRGRAVQTKKSGGVSRALYIAMGAAVLLVIAIAATVALQNRQTAATPGREPARPATNVPMGRDENGFFFKG
    SAGAPVVVTEYSDFQ
    CPGCAYYATALSSQFEQEYIATGKVKFVYHEYPLSGHVNGAPAAQAARCAGEQGADKYWAMHDYL
    FTNQRQWSGQADPRAQFVAYARQIGLDTAAFEQCYAGNRFRDAINQAKAAGDALRIPGTPSFAVNGRLVDTTGATSVEEI
    YTRMRQAVDAALGAR

    >gi|156743275|ref|YP_001433404.1| thioredoxin [Roseiflexus castenholzii DSM 13941]
    MTFSTPVRTSEQSIDRVLRAGLPVLLIFDRKECPTCQRLDPTLERLASIFAGRALLARVDADDNPALAQQYGITALPGLI
    FVKNGAPIARTSGVVAEEALRAWLTHLTDGGAPPPLPQGPSVPLTRQASRPMPEPSATRQEVAERATRSKPITLTDATFD
    QVVGASHQPVLVDFWAPW
    CGPCRAVAPVVERLAQEFAGRAVVAKLNVDENPRTAQRFGIRSIPSLHIFKDGRVVERLIGA
    QPYPVLRQALERHAGGVTA

    >gi|156743426|ref|YP_001433555.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Roseiflexus castenholzii DSM 13941]
    MPATSETSLTLTLGAIAPDFTLTDTVSGKTMSLSDLKSPKATVILFICNHCPYVKHVDRALVRLAQDYMPQGVSFIAISS
    NDPIQYPEDSPERMREEALRVGYPFPYLFDETQDVARAYGAACTPDTFIFDGDLRLVYRGQLDDTRPSSGREATAADVRA
    ALDAILSGQPVNAVQKPSVGCSIKWKR

    >gi|156743453|ref|YP_001433582.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Roseiflexus castenholzii DSM 13941]
    MPAIGEKAPDFIATTQSGEPFQLSSLRGQKVVLFFYPKADTPTCTTEACSFRDSYAEIRARSAIVVGVSPDTVTAQAAFH
    DKHHLPYLLVADADHRVSDLYGVWGTHQVRREDGTEVTYTGVLRTTFIIDEQGVVQRVFPNVDVREHTAEVLSALEQ

    >gi|156743512|ref|YP_001433641.1| putative selenoprotein [Roseiflexus castenholzii DSM 13941]
    MDIDSGRHLPRIKIVYCAACGYEPQTLELVSALMNAFHYDIAGIEIIPWQDGAFDVAVDGELVHSMYRDGGFPAPETIIK
    AVRERLAR

    >gi|156743557|ref|YP_001433686.1| redox-active disulfide protein 2 [Roseiflexus castenholzii DSM 13941]
    MLNIKVLGSGCANCRKLEERVRNVIRQRNLTAEIEKVTDYAQMMRWNVMRTPGLVINDVLVASGRIPTEEEIGSWLKVG

    >gi|156743561|ref|YP_001433690.1| glutaredoxin-like domain-containing protein [Roseiflexus castenholzii DSM 13941]
    MALLHDKDRKIVREQLEEGLKRPVTMAFFSSKENCELCDVTGELVEEVAGLHPLLRVETYDLQADAARAAELGVDKAPAI
    VILGGEAAQDYGVRFYGIPSGYEFVTLLEALRMVGSDTVELQPATRSFLNELKQPMHLQVFVTPG
    CPYCPRAGVLAHRLA
    YASPLITADVVEVTEFPDLGERYEVMGVPRTVIDDVVHIEGAAPESMVVGKLREALMAA

    >gi|156743570|ref|YP_001433699.1| beta-lactamase domain-containing protein [Roseiflexus castenholzii DSM 13941]
    MIFRQFLNEAISAASYLIGCVQSGESAVVDPGLPPEEYLMAAADKGLRITAIIETHFHADYFSTGRALAALTGAPIYAPS
    RDDIENEITGASVHYPHIRVRDGDEIRIGNIILRAIHTPGHTPEHMAYAVIDTPRAGEPWMVLTGDSLFVNDVARTDLVN
    LPLAGPEVIYQSMQRLLELPDYCEIYPAHYGGSACGGKQMSGKPVSTIGFERRFNWLLQARDAQEFVALGGVVPREAVES
    VLIHRNTNRGVLPLPAEATRAAIHHRHHHAEAPALSLQQAYEAIQRGAVLVDLRPALAFAGGYPAGAVNITFNKSNMVER
    ARLLLGTGTPLAFIGDIPLLAQETANLFIEEGFNIVGYVQEPVSAWLSSGLPVERIAVGDLDALHHHVQNGDAVILDVRE
    PFEWEKGVIPNGSVDVRLISLGEIRQRWRELPTDRTIVTV
    CESGTRASAVASFLKRMGFSDLVNIAPQGMSDYVKRYETV
    RPELAMTT

    >gi|156743646|ref|YP_001433775.1| DSBA oxidoreductase [Roseiflexus castenholzii DSM 13941]
    MLPDDHRRLRTGALYAALLLIALALLVACGPEAPQAIDPPSVTRQAVVALPTATRQTVVVRPTDSERPRPSGVTPVPAPT
    DVPERAPSFDGDPRTMGDPDAPIVVVEFSDFQ
    CPFCASFSREVRPLIEERYVSTGKVRFVYRDFPLMSIHPGALLAAHVA
    NCAGDQGAFWEMHNRIFAGMEQREWASGDAGDFRTFLKYADELNLDTAQVQQCVESNRHGPRIQEDIQAAQRAGVRSTPS
    FLINGQLLVGAQPFEVWERMFETILNSQ

    >gi|156744026|ref|YP_001434155.1| thioredoxin [Roseiflexus castenholzii DSM 13941]
    MAKPVTVTDDDFEQQVLQSDIPVVVDFWAPWCGPCRVIAPILEELAKEYDGKVKVAKVNTDDHQRWMSKFGIMAIPTMIF
    FKNGKEINRIVGAGPKRMLKEAFDAAVAE

    >gi|156744062|ref|YP_001434191.1| methionine sulfoxide reductase A [Roseiflexus castenholzii DSM 13941]
    MTTQPISNHEVATLGGGCFWCLEAVYDEIEGVISVESGYAGGHKPNPTYEEVCTGKTGHAEVVQITFDPQVITFRDLLDI
    FFSIHDPTTPNRQGADVGPQYRSIILYHNDEQRRIAEATIAELNAANIWNAPIVTEVQPFTVFWIAEEYHQEYFAKNPYQ
    GYCMAVVAPKVLKARKKFADRIKTKR

    >gi|156744349|ref|YP_001434478.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Roseiflexus castenholzii DSM 13941]
    MNEQTTLPKRASPQRRGVSRREVITSAVGALLGVVVILLVWFAVGRGNNATLPAIGEVNRPAPNLTLPTLDGGSLSLADL
    RGNVVLVNFWGTW
    CEPCKEETPALQAAYQRLQSEGLVIVGINLRRQETGDDAVRAFVQQYGVTYPIALDVDGEAARLFQI
    SPIPVSYFIDPEGTIRYVRIGTLTTDDVAALFAQLR