Robiginitalea biformata HTCC2501 uid58285

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|260060628|ref|YP_003193708.1| hypothetical protein RB2501_03495 [Robiginitalea biformata HTCC2501]
    MEKTPNDLIHETSPYLQQHAYNPVHWVPWTEANLQRAAEENKPLLISIGYAACHWCHVMEHECFEDPEVAEVMNTLFIPI
    KVDREERPDVDQVYMDALQLMTGSGGWPLNVAALPDGKPFWGATYLPRDRWLQALVQLGRLYREDPDRIREYADDLTSAV
    ARINLPESDPNAALPGHGEISGWIDSMKPRFDGEYGGMQGAPKFMMPAALNLFLHQESLHPDPTLEMHVNQTLTAMAFGG
    LFDQVGGGFSRYSVDARWHVPHFEKMAYDNAQLLSLYARAFARYGDPLYREVVSRTTEFLLRDLAHPDGCFYSSLDADSR
    NRDGNLEEGAYYTWREPELREALGGDYELFAAAYSIDTFGYWEDGKYVLIRREADADLAGRLGLPEPELRERLQSCRDRL
    LRLRDKRDAPRLDDKVLTSWNGLLLSGLADAWRYCGLEKARDAAGKLANYLDGEVTRKDGSVPHSTKGGSGGGHGFLEDY
    ACLAAGYISWAEATGENTWMDRARNLCTYALQYFGLPGEPLLYFNSSLDPALIRRSLETADNVIPASNSIMAKNLFVLGS
    YFGDAQWITRSREMLTAMVPSIGKYPGQYTNWMQLALWMSVPFYEVAVCGPDAMEQSATLRRNYLPQCLLALSGEASDLP
    LFRGRFNPPKTRIFICREGSCKQPLEDSGKALELLRTYASD

    >gi|260060843|ref|YP_003193923.1| carboxymuconolactone decarboxylase [Robiginitalea biformata HTCC2501]
    MSTTSDNLFPGSTRGLFNKQAALTPETSDAWRTFSQTVFKPGALDVRTKQLIALAVGHATRCPYCIRAHTAQALKAGASA
    KEISEAIWIAAEMSAGAASAHAAIAFDEMERQGYGENR

    >gi|260060903|ref|YP_003193983.1| thioredoxin [Robiginitalea biformata HTCC2501]
    MKSQVEVFTANCPVCDPVVKMIEELTCDGCEVTTYDLVKKCDDKTCLTKMNEYGVQKIPAIAVNGKLLDCCKDSAITKEK
    LIEAGIGQN

    >gi|260060905|ref|YP_003193985.1| regulatory protein [Robiginitalea biformata HTCC2501]
    MKKYDVFIIGSGMSGMTIAYKCASKGLSVGITDELPYGGTCALRGCDPKKVIIGATEVRDFAKRLQGKGIDTIPDINWKD
    IMAFKQTFVDEMPRKIEKGYKKNGIDTFHSSAAFINENTLSVGNQTIQADNVVIASGSKPKVLDFEGGQLAQTSTDFLNL
    KELPESLLFIGGGYIAFEFAHIAARSGAEVTIVHRGKRPLENFDKDIVKHLVDATINLGVRLVLETEVSKIESEDGHFVT
    TGISEGMETTYKSKAVFNSAGRPPAIFDLELEKAGISFSKKGIAVNEYLQSISNANIYAAGDAADSRGLPLTPVAVLEGH
    VVASNIIKGNKKKVSYPPMPSVVFTLPTMATVGLLEDKAKEKGFDINVNFEKVGNWFNARRLNVDEYAFKTIIDKNSNTI
    LGAHLIGPHCEETINLFAMAIKTKMTISDLRTMIFSYPTMVSDLTYML

    >gi|260060906|ref|YP_003193986.1| putative copper-transporting ATPase [Robiginitalea biformata HTCC2501]
    MIAGTSGIASTFSWVEPFRPYLIGLTIIVLVFAWYQKLRPKTQEEIDCVCEDDAKPTFWQSKQFLFIVTVFAGLMLAFPY
    YTNLFYAQPTKDIVYVSQSNIEQHTFDVVGMT
    CAGCEAHVESEVNKLDGIISVKASYENANTIVEFDKTKTDLPAIRKAI
    ESTGYKVVEKTTKENK

    >gi|260061109|ref|YP_003194189.1| Scaffold protein for iron-sulfur cluster assembly [Robiginitalea biformata HTCC2501]
    MIKVSETARQKVVSLMQEEGFNAGTDYVRVGVKSGGCSGLSYELRFDREADEADKVFEDNSVRIIVDKKSFLYLVGTTLE
    YSGGLNGKGFVFNNPNAQRTCGCGESFSL

    >gi|260061122|ref|YP_003194202.1| methylated DNA-protein cysteinemethyltransferase [Robiginitalea biformata HTCC2501]
    MGEAVIHTPLGTVHIEGGPAGVRSIRIGDRRDVPETVPPSLEPVCRQLREYFDGERKRFELPMDPAGTDFQKTVWKALGD
    IPYGKTISYMDLAKKLGDPKAIRAVAAANGKNPLWVVVP
    CHRVVGSDGSMTGYAGGIHRKKWLLNHESQNPQQSLF

    >gi|260061216|ref|YP_003194296.1| hypothetical protein RB2501_06445 [Robiginitalea biformata HTCC2501]
    MQLYNTLSAKEREALIDEAGQDRLTISFYKYAHIGNPGLFRDYLFIHWDALEVLGRIYVAREGINAQLSVPAVNFGAFKE
    HLDSITFLEGVRLNIAIEQDNKSFLKLKIKVRPKIVADGLDDGSFDVTNKGVHVDARRFNELIEDPEAIVVDMRNHYESE
    IGHFENAITPDVDTFRDSLDLIEEQLRDHKEDKKLVMY
    CTGGIRCEKASAYYKHKGFKQVYQLEGGIIEYTRQVQKESLE
    NKFHGKNFVFDNRRGERITDEVIARCHQCGEPADTHTNCANEGCHLLFIQCDACAAEMDGCCSDACKDIVALPPEERKKL
    RKGKFNSNRIFKKGRSEVLTYKRQVPDPFSPVAGDKDPAGAS

    >gi|260061250|ref|YP_003194330.1| carboxymuconolactone decarboxylase [Robiginitalea biformata HTCC2501]
    MATNYYDPADLRKFGNITEWSEELGTKFFDYYNSVFKDGALTAREKSLIALAVSHVVKCPYCIDAYTKDGLQRGITREEM
    MEAVHAGAAIESGASLVHGVQMMNKYDKLSM

    >gi|260061251|ref|YP_003194331.1| hypothetical protein RB2501_06620 [Robiginitalea biformata HTCC2501]
    MATKSLKAQEKDLANTQYQLKILDGGPFASGELPRFREKLRETGQNTLRPKPLEILQINLGYMCNQVCAHCHVDAGPDRK
    EIMTRETMEQCLEVIRRTGAHTLDLTGGAPEMNPDFRWFVAEASKAGIADFIVRSNLTIIRANKKYYDLPEFFARYNVHV
    VSSLPHYTRGKTDRQRGSGVFDQSIEALRSLNEAGYGKAGSGLKLDLVYNPSGAFLPADQQAMEKDFKKALASDFGIVFN
    NLFAITNLPIARFLDYLIASENYEDYMTALVDAYNPAAVENVMCRNTLSVSWDGWLYDCDFNQMLGLKVASKVKHIADYN
    EAVLQDREILISQHCYGCTAGAGSS
    CQGSVA

    >gi|260061376|ref|YP_003194456.1| metallo-beta-lactamase superfamily protein [Robiginitalea biformata HTCC2501]
    MKVEQIYTGCLAHAAYYIESNGEAAVFDPLREVQPYIDRANKDGAQIKYVFETHFHADFVSGHLDLQKKTGAQIVFGPNA
    KPGYEALIAGDGQVFEVGDYQVKVIHTPGHTMESTTYLLIDEAGRQHGIITGDTLFIGDVGRPDLAQHVVSELTEEKLAS
    HLFDSLRNKIMPLPDHLIVYPNHGAGSACGKKMSEETTDTLGHQKEVNYALRADMTREEFIGELLTGLTAPPGYFPQNVL
    MNIKGYESLDTVMKRGNQPLSPAAFEAAANETGALVLDTRDAETFAKGFVPNSVNIGLGGDFAPWVGELIPDVQHPILLV
    TEPGREEEAVTRLSRVGYDQTLGYLEGGFDAWKQTGREVESTGRMTVAELEALASKGEAPVIIDVRKRSEYDSEHLLDAI
    NIPLKEINEHLAEFPKDKKFVLH
    CAGGYRSMIASSILKQRGWDDFADIVGGFDALKKSHLPKSEYICPTTLL

    >gi|260061377|ref|YP_003194457.1| rhodanese-like domain-containing protein [Robiginitalea biformata HTCC2501]
    MAHIDSEWGLRKKRYGKGVKGNRPGRFLFAFWLAILPVLGSLTAIEGRAQQPVADPEYAERLESLLSHSVPEIAVSDAAG
    RDSLVFLDSRSLEEFVVSRIPGAYWVGFDDFSLDRVSAVPRDQAVVVY
    CSVGYRSEKITEELRAAGFEDVSNLYGGIFEW
    VNQGQPVEDRSGPTEKIHAYNRAWGRWLRRGHKVY

    >gi|260061382|ref|YP_003194462.1| hypothetical protein RB2501_07275 [Robiginitalea biformata HTCC2501]
    MDWIYEPWPWYVSGAAIALVMLLLLLTGKNFGMSSNLRTLCTMCGADRSTEFFRFDWATQKWNLLVVIGAVIGGFIAANF
    MTPDDAVQINPDTVARLQTLGFDSAGAAYLPDELFSMEQFTNPKSMLLLALGGLLVGFGARYAGG
    CTSGHAISGLSNLQW
    PSLLAVVGFFAGGMIMIYFLFPLIF

    >gi|260061412|ref|YP_003194492.1| putative fusion protein [Robiginitalea biformata HTCC2501]
    MPLVTPLDPNADPETRKLAKFFDETLGFCPNSVLTMQRRPAISKAFIQLNMAVMENHGKVTSALKRMIAWVSSNATGCRY
    CQAHAIRAAERYGAEQRQLENIWEYRTHSAFSDAERAALDFALAASQVPNTVDADLAARLHEHWDEGEIVEILGVISLFG
    FLNRWNDSMGTPIESGAVESGEKYLSRYGWEQGKHGC

    >gi|260061480|ref|YP_003194560.1| hypothetical protein RB2501_07765 [Robiginitalea biformata HTCC2501]
    MIKIYYLSTCDTCKKILRQLDPPETAVLQDIKTEPITASQLEELRRAAGSYEALFSKRARLYRERNLKEAALGETDFRDL
    ILEHYTFLKRPVILAGGRVFIGNAAKTTVAAAQALHP

    >gi|260061678|ref|YP_003194758.1| hypothetical protein RB2501_08755 [Robiginitalea biformata HTCC2501]
    MSYLKATNELYREAALTPDVGLCCTTNPIWQLPGLTVPKIMQEMNYGCGSTVNAKDLAGNPKILYVGVGGGMELLQFAYF
    ARQPGGVIGVDVVDEMLEASRANFQVAAAENSWFDPRFVELVKGDALNLPVADESVDVAAQNCLFNIFKEEDLRLAVAEM
    YRVLKPRGRLVMSDPVCDTPLSQTLRNDDRLRAL
    CLSGSIPVYDYIRVLTNAGFGTIEVRARRLYRVLSPNHYPVDRLIP
    IESIEVAAIKDPMPEDGPCVFTGKTAIYYGNQKVYDDGKGHVLVQNQPLAV
    CDKTAAALALENAEIHVSDSTWHYTGGGC
    C

    >gi|260061708|ref|YP_003194788.1| Peptide methionine sulfoxide reductase [Robiginitalea biformata HTCC2501]
    MPTKSLQEATLGAGCFWCIEAVFQELRGVESVVSGYSGGTVPGKPTYREVCSGLTGHAEVVRVRFNPEEISFRDLLVVFL
    STHDPTTLNRQGADRGTQYRSVVFFHDAEQEQVAREVIAEMQQYFDDPIVTEVSPLSNFYEADPEHQDFYRRNPELGYCR
    VVIDPKMRKLRDLFASRLKNPA

    >gi|260061709|ref|YP_003194789.1| PilB-related protein [Robiginitalea biformata HTCC2501]
    MALTWKDIIHFATKGNPEPDRSVVKSDAEWKAQLTPEQYRITRAHGTEAPHSGELCTAHDPGMYRCVCCGTPLFDSTIKF
    DSGTGWPSFTQPVQEHAVRYIRDTSFGMVRVEARCNTCEAHLGHVFPDGPPPSGLRY
    CINSLALELDKSAGDAD

    >gi|260061871|ref|YP_003194951.1| phage shock protein E (rhodanese-like domain-containing protein) [Robiginitalea biformata HTCC2501]
    MCSLQVAAQAEQLPMEAFNPSSLSEGAVLLDVRTPAEFNEGHLPGAVNIDWFADDFNSRLEDIPKDAEIYLYCKKGGRSA
    RASERLLTLGYTRVVDLTGGYDAYQPGQ

    >gi|260061963|ref|YP_003195043.1| metallo-beta-lactamase superfamily protein [Robiginitalea biformata HTCC2501]
    MKIEQIYTGCLAQGAYYIESEGEAAIIDPLREVGPYLRRAKSDKAEIKYIFETHFHADFVSGHLTLSRETGAPIIYGPLA
    NPSFDAVIAKDGQVFRLGKVAFEVLHTPGHTMESTTYLLRDPEGKPHAIFSGDTLFLGDVGRPDLAQKAADLTQEELAGT
    LYDSLRNKIMPLPDEVIVYPAHGAGSACGKNMMKETVDTLGNQKKVNYALRADMTREEFIAEVTEGLAPPPDYFPLNVKM
    NREGYEDFDQVLARGTRALEPDAFEAAAEETGAIVLDVRHQEDFARGHIPRSIFIGLNGDFAPWVGALVADVEQPILLVT
    PEGKEEEAVTRLSRVGFDKTVGYLKGGFTAWESAGKEIDQVRTRPASRMESEMAEQPGRVFDVRKESEYEAEHLEGAQNT
    PLARINDFLQEFPQEEAFYVH
    CAGGYRSMIAASILKSRGYHNLTDIGGGFKAMKESGLPVTAFRCPSQTGE

    >gi|260062164|ref|YP_003195244.1| putative antioxidant protein [Robiginitalea biformata HTCC2501]
    MGTLNFYDYLGDGWGILFSHPADFTPVCTTELGTAAKFKEEFDKRNVKMIALSVDGTESHHEWIKDINETQQTTVNFPIV
    ADETERCPTSTT

    >gi|260062167|ref|YP_003195247.1| hypothetical protein RB2501_11257 [Robiginitalea biformata HTCC2501]
    MLPLGTRAPEFELPDTVSGQVRDLQSLQGEKGTLVMFICNHCPFVKHVNRELVRLANQYMPKGISFIAISSNDVENYPDD
    SPEKMKENARLQGYPFPYLYDASQEVARSYQAACTPDFYLFDDKLDLVYRGQLDDSRPGNGIPVTGKDLEGAITALLNGE
    SIPADQKPSIGCNIKWKPAS

    >gi|260062176|ref|YP_003195256.1| hypothetical protein RB2501_11302 [Robiginitalea biformata HTCC2501]
    MRKATVFLSVLAVAALSSCKEKASEKINAENVEVAAQRDAASKNMAAITFDNKEHDFGTIEQGTPQETTFSFTNTGTAPL
    IITNTSAS
    CGCTTPDAPINQPIAPGEKGEIKVRFNGSGSGQVTKTVTVMANTAGGQEMLRIKAFVNPKAAGGTAAVGPVK
    N

    >gi|260062188|ref|YP_003195268.1| SoxW [Robiginitalea biformata HTCC2501]
    MSPVAVAAQQVNWISWDQAVATVQGGSNDKKIFIDVYTDWCGWCKRMDKDTFQNPEVAAYMNENFLMVKLDGEQKEPIEY
    NGKTYKFVPSGRKGYHELAAALLQGRLSYPTVVFLDEELNMLSPVPGYQKPDAFLQIARYFGDNIYKEKDWQTYSGTR

    >gi|260062235|ref|YP_003195315.1| peptide methionine sulfoxide reductase [Robiginitalea biformata HTCC2501]
    MKNIKRSLLLTAGLILAISCQTKAKKGETAESGRQATAPQMEKEVPQDLSAYETAYFASGCFWCVEAIFESVKGVAEAES
    GYAGGTEENPTYEQVSYGRTTHAEAVKVYYDPEVVSFFELVQVFFGSHDPTTPNRQGPDRGPQYRSIAFYENDSERQIIT
    AYMEALEEQRVYDRPIVTEVSPLTQFYKAEEYHQDYERKHPDNPYIQNVSVPRLNRFKANFQDFLKEDIH

    >gi|260062258|ref|YP_003195338.1| carboxymuconolactone decarboxylase [Robiginitalea biformata HTCC2501]
    MPDQVDEFNAYRERMNEKLLNSDSRLMKRMFNLDTNAYAPGALDVKTKELLGLVASTVLRCDDCVRYHLQTLYKHQATKQ
    EVMETLGIATLVGGTITIPHLRRAVEFWEVLENKG

    >gi|260062282|ref|YP_003195362.1| hypothetical protein RB2501_11832 [Robiginitalea biformata HTCC2501]
    MKIRRKTFFNILLIGFVLSFFVTPLGTYSKVWLMQLFSFAPDPIEIGERQRIPTYDWKLKDAEWDFFNFEQAKGHVVLVE
    FWASWRLP
    CLPELQGIQALYEAYGDRVQFYIITDEEREPVEAFMEEHGFTFPVTYRIVGEPAPLDVSKQPSSYLIDREGF
    IVVAEDKLVDWDSGKSRELLDRLLSGD

    >gi|260062294|ref|YP_003195374.1| putative thioredoxin [Robiginitalea biformata HTCC2501]
    MKASFSDLIRSENPVLVDFYADWCGPCKTLAPILKEVKGELGDRLRVVKVDVDRNQEVAGRYQVRGVPTMILFKNGKVLW
    RQSGVLSKPDLLRALEPLLAS

    >gi|260062368|ref|YP_003195448.1| copper-transporting ATPase [Robiginitalea biformata HTCC2501]
    MLSFPTYANVFFPQTENTTVVTDRSKIQTAEFKINGMTCSGCEEHVNQEVNKLTGIIQTTASYENGNAIIEFDQAQTGIE
    EIEEAIEKTGYSVTDKKEIK

    >gi|260062443|ref|YP_003195523.1| dihydrolipoamide dehydrogenase [Robiginitalea biformata HTCC2501]
    MSSFDVLVLGSGPGGYVTAIRASQLGFKTAIVEKESLGGVCLNWGCIPTKALLKSAQVFEYLQHAGDYGLSVEGADKDFG
    AVVKRSRSVADGMSKGVQFLMKKNKIEVLQGYGTLKPGKKVSVKDADGKETTYEASHIIIATGARSRELPSLPQDGKKII
    GYREAMTLEKQPKKMIVVGSGAIGIEFAYFYNAMGTEVTVVEFLPNIVPVEDEEVSKQLERSFKKAGVKVMTSSEVTKVD
    TSGDGVKATVKTSKGEQTLEADIVLSAVGIKTNIENIGLEDVGIATDRDKIMVNDYYQTNIPGYYAIGDVTPGPALAHVA
    SAEGILCVEKIAGMHVEPLDYGNIPGCTYCMPEVASVGMTEAQAREAGYDVKVGKFPFSASGKAKASGNPDGFVKVIFDA
    KYGEWLGCHMIGAGVTDMIAEAVVGRKLETTGHEILKAVHPHPTMSEAVMEAVADAYDEVIHL

    >gi|260062444|ref|YP_003195524.1| methionine sulfoxide reductase B [Robiginitalea biformata HTCC2501]
    MKLKYICFLIAALLLASCRGQSGEKDAATTQDGPAVAENFKVQKPEAEWRAELTELEFYILRKAGTENPGSSDLLNNKQA
    GTYVCAGCQTPVFRSEHKFDSGTGWPSFDREIEGNVAYSVDTAFGMTRTEEHCAVCGGHLGHVFDDGPRQTTGKRH
    CING
    AALDFIPAQ

    >gi|260062520|ref|YP_003195600.1| Thiol-disulfide isomerase and thioredoxins-like protein [Robiginitalea biformata HTCC2501]
    MGVKNTIPAGNAAPQAEVREIIGRPVEIAIGAPGNSMYFCEAKCVIGKSMKLSKRTGIRIGLLLAIAAILIATGTHKRLV
    QGINYRLLEWGLRTPRSVHPDVFTPQPFTPDMARELQLVDETGRVVSLPEAMGNQTAFINKWATW
    CAPCIAEMPGIESLY
    EASGGDIAFVMISTDADFETAKAFKARKGYAFPVYTLASAEPGYLYSRSIPVTFLVPPQMDTIYRFEGMRDYDTPEFKAF
    LNGLGNER

    >gi|260062771|ref|YP_003195851.1| pyruvate/2-oxoglutarate dehydrogenase complex [Robiginitalea biformata HTCC2501]
    MKSYDVAIIGSGPGGYVAAIRCAQLGMKTALIEKYDTLGGTCLNVGCIPSKALLDSSHHYHDAITHFEKHGIDIPGDVKV
    NLKQMIARKQSVVEENTKGIEFLMDKNKVDVYHGLGSFKDATHIEIAGKEKTEIEAKHSIIATGSKPASLPFIELDKERI
    ITSTEALKLQEVPKHLIIIGGGVIGLELGQVYNRLGAQVSVVEYMDRIIPGMDGALSRELTKVLKKQKVKFYLSHKVTGV
    SRKGEKITVEAEDKKGKSVSLEGDYCLVSVGRKPYTDGLNAEAAGVKLNDRGQVEVDEHLRTSAGNIYAIGDVVRGAMLA
    HKAEEEGVMVAEILAGQKPHIDYNLIPGVVYTWPEVAAVGKTEEELKEAGVAYKSGQFPMRALGRSRASMDTDGFVKILA
    DKETDEVLGVHMIGARVADLIAEAVVAMEYRASAEDIARMSHAHPTYAEAVKEAALAATDNRPLHS

    >gi|260062777|ref|YP_003195857.1| thiol:disulfide interchange protein dsbD [Robiginitalea biformata HTCC2501]
    MAKKIILNSIAFLLALTTWSQLPVSGGGEDPVSWSHSVEQVTDSTYVLHFRADIETDWHLYSQHTAEGGALPIEFEFEGV
    GKTYELVGPVTESETHTAYNEIFEVVETFFKESAHFTQEIVVSDADLSAVRVNAYYQVCKEVCIPGEHQFVFSLDGSQTQ
    VETGAGEPSHPELSGSLKLDLKNVATLQAAGSQGAAGGENPLWALFGLGFLGGLIALLTPCVFPMIPLTVSFFTKQSANR
    SRGVANAVFYGSCIVLIYFLLSLPFHLFDSVDSQILNSIATNIWLNLVFFLVFVVFAFSFFGYYELTLPASWANRADAAS
    GRIGGAVGIFLMALTLAIVSFSCTGPILGGLLGSTALAEGDVATNLTLGMLGFGLALALPFALFALFPSWLSRLPQSGGW
    METVKVVLGFLELGLALKFLSNADLVGHWGILKREVFLALWILLAIGLGGYLLGWFRFGKSRPRTRVGLGRGLGAFLSLV
    FAAYLGYGLVSGSPLKLLSGFPPPDFYTLKESPTDCPLGLDCYKEFDAGLEQARQTGKPILLDFTGWA
    CVNCRKMEEQVW
    SNPEVFRLLDEEYILISLYVDDREELPESEQFVFRFDSGRTKRIRTVGDRWSAFQTANFGAVSQPYYVQLSPDLHILNPA
    IQNTDTRTYRDWLVSGLRAQEQVAGAP

    >gi|260062830|ref|YP_003195910.1| putative lipoprotein/thioderoxin [Robiginitalea biformata HTCC2501]
    MKKTLLIIACGLAIAACNDGGSEGFRIEGSLEGDLADGTQVILRKSDENMQPVDVDTATLDAGRFSFAGTADQPELYYLF
    VKGVRGGIPLILENGTIDVRAHKDSLQAAELSGTPQNDAYAAYIQGAREKSRQRLSMNEDMRKAVMEKDTVMIESLRDEY
    FELLDRMTQYEKDFVRENPDALISALVLNRMLQSNAVPVAEVEELYGTLSEEIRETTHGSGISEKLESAKRTAIGAKAPA
    FSAPTPDGDPLALSEALGKVTLVDFWAAW
    CRPCRAENPNIVRVYNKYKDKGFKVLGVSLDRNAEDWKQAIADDNLDWQHV
    SNVRYFDEIAELYNVSAIPASFILDENGVIVAKNLRGDALEEKIAELLP

    >gi|260062882|ref|YP_003195962.1| osmotically inducible protein OsmC [Robiginitalea biformata HTCC2501]
    MKFTRKASALWKGGGKEGSGTLSSASGVLEQTPYSFNTRFADTKGTNPEELVGAAHAGCFAMQLSFLIGEEGYTPDSLDV
    SAEVHFEDGKVTDIHLNLRGKVPGMQAEAFEKTAQKAKEV
    CPISNLLNAKIHLEAQLV

    >gi|260062895|ref|YP_003195975.1| molybdopterin biosynthesis protein MoeB [Robiginitalea biformata HTCC2501]
    MSADRYDRQTRLEDFGPEGQRALSEAAVLIIGAGGLGVPAATYLNAMGIGRLGLVDGDVVETSNLHRQPAYGPASVGMAK
    VRELEKVLRAQNPDTQLDIRDTFLNPTNALELIGNYDLVVDATDNLPTRFLVDDACLMLGIPWVYGALHGFEGQVSVFNY
    RGGPTYRCLFPVPPPAGEIPD
    CDTLGTLGVLPGLIGTMQALEAVKAICGQEGVCAGKLLLYDARKQQTLHIAIQKDANRT
    VPDDLSATYQLSCEGKPDAVSGSEYLRLRKEGAAHLLVDVREPGEFESHHLDGARNIPMKRIASDAPDFSSGNPVYLI
    CE
    TGPRSRRACRELQSRWPSTPFFWISGGMRQLKVESQ

    >gi|260063002|ref|YP_003196082.1| bacterioferritin comigratory protein [Robiginitalea biformata HTCC2501]
    MKTLQAGDKVPEFTAPDQDGNPISTSDFKGQKWVVFFYPKADTPGCTAEACNLRDHYAELKDAGYALVGVSADAPKKQAK
    FRDKYSFPFPLIADEDRTVIDAFGVWGPKKFMGREYEGIHRKTFIIGEDGLVERVIDKVKTKDHAAQILE

    >gi|260063028|ref|YP_003196108.1| arsenate reductase [Robiginitalea biformata HTCC2501]
    MYTIYHNPRCRKSREGLAILEASGKPFEIVRYLDDPPTGATLRELLDKLGMPARSLIRTGEAVWKASYKGKELSEEELIA
    AMSEHPKLIERPIVASESKAVLGRPPEAIKDFLTN

    >gi|260063261|ref|YP_003196341.1| putative hydrolase [Robiginitalea biformata HTCC2501]
    MKSESIRFTGAGNLQLAGKLELPADRKPAAFALFAHCFTCSKDLRAVREVARSLTMSGFGVLRFDFTGLGGSDGEFASTD
    FSRNIGDLVAASDFLKSHFEAPQLLVGHSLGGTACLAAAFELPDVRAVATIGSPANPKHVTGLLGESLETIETTGSAEVR
    IGGRPFRIRKEFLDDLEDHPLEERLGSLGKALLLLHSPQDTIVGIDQAERLYRAARHPKSFITLDGADHLLSLPSDARYA
    GSVIASWAARYTVQPDQPPLKTEQQVVASLEADAGFTTKMLVGNHRMLADEPESFGGRDLGPSPYELVAAGLSA
    CTAMTL
    QMYAKRKKWDLQHVEVHTSHGKEHALDCDQCESGEARIDTFRREIRITGDLDEKQVQKLLEIADKCPVHRTLHGPVQILT
    RLSP

    >gi|260063300|ref|YP_003196380.1| thioredoxin reductase [Robiginitalea biformata HTCC2501]
    MSESIERIKTLILGSGPAGYTAAIYAARADLKPVVYTGMEPGGQLTTTTEVENFPGYPDGVDGPTMMVQLQQQAERFGTD
    VRIGIATAVEFSDEPGGIHRVTIDDDKVVEAETVIISTGASAKYLNIPSEQRLRGGGVSA
    CAVCDGFFYKGQDVAIVGGG
    DTAAEEASYLAKICNKVTMLVRKDHFRASKAMQNRVMSLENIDIRFNTEVDEVLGDQVVEGLRMVNNQTGEKEEVAITGL
    FIAIGHKPNTDIFKGQLDMDATGYIVTHGKSTRTNKPGVFASGDVQDKEYRQAVTAAGTGCMAALDAERYLSEVEAGEGE
    EVEQQ

    >gi|260063303|ref|YP_003196383.1| copper-translocating P-type ATPase [Robiginitalea biformata HTCC2501]
    MKHTYHIHGMSCTGCQNHVREALESVAGVRGVTVDLDAGVAEVEMDSHIDIGEFREALAGSRYSIHLPGEKPGTAGREAS
    TGTGSNRDSGNGTYYCPMQCEGDKTYDAPGDCPVCGMDLVEQPGSASRQASGYTCPMHPEIRQDTPGSCPICGMELVPVE
    PEASAEEKVYQRLLRKFWVALGFTLPIFLIAMSEMVPGNPIYNWMDRKYWNWLQMVLSIPVVFYATWMFFTRAYRSVRYW
    NLNMFTLIGIGAGIAWLFSVFGLLFPGFFPEQFKTDSGEVHVYFEAATVILTLVLLGQVLEARAHRKTNSAVRELLKLAP
    GKAVRVRDGKEEEIPVEEIEIGDILRVKPGEKIPVDGTLTKGETTVDESMITGEPIPVDKSAGDSLRSGTLNGNRSFLME
    AEKIGSDTLLSQIIRLVNEASRSRAPIQNVADRVSAYFVPAVVVIAVITFVVWAIWGPEPAYVYGLVNGIAVLIIACPCA
    LGLATPMSVMVGVGKGAQNGVLIREAAALETLARVDTLIVDKTGTLTEGRPSVEGVEGVPDGVPGEKVLELVASLNQQSE
    HPLARAMVAHAEQKGVPIQEPEQFESVTGKGVTGMVGKQSLALGNASLMEERGAGIPAVLEEKAREYQDQGKTVSFLSAD
    GEVIGLVALGDRIKDETRTALDQLRQGGMAVHMLTGDNERTARAVAAELGIAEFRAGMLPEDKLSEVERLKRDGKVVAMA
    GDGINDAPALAKADVGIAMGTGTDVAIESAGVTLVDGDLSGIVKARKLSKKVMRNIRENLFFALVYNTIGVPVAAGVLFP
    FFGILLSPMIAAAAMSFSSVSVIANALRLRAARIN

    >gi|260063573|ref|YP_003196653.1| rhodanese-like domain-containing protein [Robiginitalea biformata HTCC2501]
    MRDSKNRKHRMADLTQEDWREQLESDPDAVILDVRTDEEMEEGYIPGAIQIDIYRGQGFLDEVEKLDKSKSYYVYCRSGN
    RSGQA
    CSLMQSKGFERTYNLVGGMLEWDGEVTE

    >gi|260063574|ref|YP_003196654.1| thiol-disulfide isomerase/thioredoxin [Robiginitalea biformata HTCC2501]
    MKTLQHLLVLFGLLLFPLQEVLSQGYSVGDKATDFELPAVGGDRVSLSDYPEAKGFIVVFTCNTCPYAQAYEDRIEALNA
    KYANRGFPVIAINPNNPEIQPGDSFEKMALRAKEKGFSFPYLLDEEQEIYPLYGATRTPHVFLLERSGSDHIVRYIGAVD
    DNYRDASAVETPYVEAAVDALLNGQPVPTETTRAIGCSIKA

    >gi|260063575|ref|YP_003196655.1| thioredoxin family protein [Robiginitalea biformata HTCC2501]
    MLLTGKLYAQQGDFSWLTGSPKTTVETVSGPIPVLAFEELEPLFHQEGTQVRIINFWATWCAPCIAELPFFEKIRREYAD
    RGVEVTLVSLDMPSMWEKRLPAFIEKRGIESPVVVLDDPRQNDWIPRVSQEWSGAIPATLIYSANRREFYEQTFDGPQLE
    SVVQSFLND

    >gi|260063617|ref|YP_003196697.1| hypothetical protein RB2501_02385 [Robiginitalea biformata HTCC2501]
    MKKVVILLFVGLLTWSVSAQEKTAKIEFKTETVDYGEIDKGSDGLRVFEFTNTGNAPLVISKVSSSCGCTIPKKPEAPIM
    PGKTGEIQVKYDTNRVGPIRKAITVISNADTPTKILKIKGTVKGVEGK

    >gi|260063662|ref|YP_003196742.1| NADH:ubiquinone oxidoreductase, Na translocating, E subunit [Robiginitalea biformata HTCC2501]
    MLEHVELFFKSIFIDNMVFAVFLGMCSYLAVSKKVSTAVGLGAAVIFVLAVTVPLNWLLDQYLLQPGALTWLGPEYADYD
    LSFLSFILFIATIATMVQLVEIVVEKFSPSLYNSLGIFLPLIAVN
    CAILGGSLFMQAREIATLGLAFNYGVSSGIGWFLA
    ILAIAAIREKIRYSNVPPPLRGLGITFIITGLMGIGFQSFGGMLTGGDETADAAEEMAVETIREPENTETPGTEAAADNL
    EQPSREEEQVLSYNDVVNNE

    >gi|260063663|ref|YP_003196743.1| Na(+)-translocating NADH-quinone reductase subunit D [Robiginitalea biformata HTCC2501]
    MALLSKKDTNLILDPLADNNPITIQVLGICSALAITAELKPSVVMALSVIFVLGVGNVVISLMRNIIPSKIRIIVQLIVV
    ATLVIIVDQVLKAFAYELSKTLAVFVGLIITN
    CIIMGRFEAFALGNGPWKSFLDGIGNALGYGVILVIVGFFRELLGSGT
    LFGFKVLGDPIAKTGVYSIGYENNGFMIIPPAALIVVGIIIWVQRSRNRSLIEEN

    >gi|260063763|ref|YP_003196843.1| thioredoxin reductase [Robiginitalea biformata HTCC2501]
    MIQTDILIIGAGPTGLFTVFEAGLLQLKCHLIDALPQPGGQCAEIYPKKPIYDIPAYPEILAGDLVDRLMEQIRPFNPGF
    TLGERAETLEKQEDGQFVVTTNRGTRHKAPVVVIAGGLGSFEPRKPQIDNLADFEDRGVSYMVRDPEVFRDKKVVIAGGG
    DSALDWSIFLADVAAEVSLVHRRNEFRGALDSVEKASALAAAGKIRLYTEAQVTRLYGDAHLEAVVVSYNDQERGESYVE
    ADHFIPLFGLSPKLGPIGDWGLEIERNAIKVNNAYDYQTNIPGVYAIGDVNTYPGKLKLILSGFHEAAVMCQSAYQVVNP
    GKRYVMKYTTVGGVTGFDGSKKEAKKEVIQAIA

    >gi|260061029|ref|YP_003194109.1| hypothetical protein RB2501_05510 [Robiginitalea biformata HTCC2501]
    MTGMRPLRTFAKKHAMRSLLFRYKYFWITLVVVSGVIIYLMYNALEPRQVLPVYQPADFNPELVDAEISHIKKYHRVADF
    SLVNQNGDTITRSDYDGHIYIADFFFTTCPTI
    CPIMTENMAYLQDELRDQPEVLLLSHSVTPEIDSVPRLKEYALEKGVM
    DEKWNLVTGDKKQIYELARKSYMAVKTDGDGGPFDMIHTENFILVDKEGRIRGTYDGTRREEMARLLEELQILQASYAAP
    D

    >gi|260063656|ref|YP_003196736.1| hypothetical protein RB2501_02580 [Robiginitalea biformata HTCC2501]
    MKHLTLPRMVTRNSLARALTPLLTPTYLLLAACTVLLAGCKAQPAHTAVRMPDQGTEILVGTAAIDSLHAQPFAGWYEPN
    LAAYEPDPEKIAELEDLLEGIDITLFMGTW
    CEDSQREVPRFVKILEKAGYPADEVELITMTREKDTPQGYEEGFGIINVP
    TFIFYRDGEELGRIVEYPIEGLETDMVKILSGAPYRHAYDWD