Bacillus cereus ATCC 14579 uid57975

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|30018521|ref|NP_830152.1| FrnE protein [Bacillus cereus ATCC 14579]
    MKIEVWSDFVCPFCYIGKRRLEMALEQFPYKKDVEVEFKSFELDQNAPIYSGTSINEVLASKYGISIEEAKRNNVQLGNH
    AASMGLSFNFDEMKPTNTFDAHRLAKFAKNQGKEKEITENLLFAYFTESKNLSDVDTLATIAEASGLDKQEALNVINDKN
    AYANDVRIDEAIAQQYQISGVPYFIINQKYAISGAQPLETFVGALQQVWEEENPAPKLQELSSEGGSDLSCTDGSCSVPS
    KEQ

    >gi|30018584|ref|NP_830215.1| Alkyl hydroperoxide reductase subunit F [Bacillus cereus ATCC 14579]
    MILDADIKTQLSQYLQLMENDILLKVSAGDDNVSKDMLALVDELATMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGI
    PLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHFESYISLS
    CHNCPDVVQALNVMSVLNPGITHTMIDGAAFKE
    EVESKDIMAVPTVYLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVMDTMGIENFISVKKTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRN
    VGVPGEAEFKNKGVAY
    CPHCDGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTV
    LKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
    NNPYKQIIISMGSGANAALGAFDYLIRN

    >gi|30018585|ref|NP_830216.1| Alkyl hydroperoxide reductase C22 [Bacillus cereus ATCC 14579]
    MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTFVCPTELEDLQNQYATLKDLGVEVYSVSTDTHFTHK
    AWHDSSETIGKIEYIMIGDPTRTITTNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRN
    NPGEVCPAKWQEGSATLKPSLDLVGKI

    >gi|30018639|ref|NP_830270.1| thioredoxin [Bacillus cereus ATCC 14579]
    MTTFKTIEELATYIEEQQLVLLFIKTENCGVCDVMLRKVNCVLENYDYVEKIEILLQDMQEIAGRYGVFTGPTILLFHNG
    KEILRESRFISLENLERIIQLFEE

    >gi|30018723|ref|NP_830354.1| thioredoxin-dependent thiol peroxidase [Bacillus cereus ATCC 14579]
    MITMITVGEMAPEFTLEGSNGEEVRLADFRGKNVVLYFYPKDMTPGCTTEACDFRDAYGVFQEKDTVILGVSPDSANRHL
    KFIEKHELPFTLLVDEDHKVAELYDVWKLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEDVLSYIK

    >gi|30018731|ref|NP_830362.1| Thiol-disulfide oxidoreductase BdbD [Bacillus cereus ATCC 14579]
    MKSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLK
    EEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVDVEQ
    FKKDLHSKDIKEKVSKDSDRAQKLKVQGAPSVYVNGNLANPDFDSMKKAIDKELKK

    >gi|30018782|ref|NP_830413.1| Zinc-transporting ATPase [Bacillus cereus ATCC 14579]
    MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKTMILETAQNKENEVVTEAKQLVTKLEPHIKVQEEQK
    NKIAKEVFILEGLD
    CANCAMKIENKVKEMPAVSEATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVVREEKN
    GHDHGHSHDHGEANVKKMVGRLVVGGILTAIAALAGLPQMVTIPLFVLAYLLIGGDIVWRAVRNITRGQVFDENFLMAIA
    TVGAFAIQQYSEAVAVMLFYQVGELFQSIAVNRSRKSITSLMDIRPDYANVKLGNETKQVSPEDVQIGDYIIVKPGEKVP
    LDGKVIEGTSMVDTSALTGESVPREVEVGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITKF
    ARYYTPVVVITAAIMAFIPPLILEGATFSEWIYRALVFLVISCPCALVVSIPLGFFGGIGGASKSGVLVKGSNYLEALND
    VKYIVFDKTGTLTKGVFKVTKMEPSEGTTSEELLEYAAFAEVYSNHPIAQSIRKAYGKSIDEKIIDDYNEISGHGTVVKV
    QGKEIFAGNAKLMRKENIEFKQPETVGTLVHVAVDGRYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAKPVGEA
    VGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKIAFVGDGINDTPVLARADVGIAMGGLGSDAAIEAADIVIMTDEPS
    KIATAVKIAKRTRSIVWQNIIFALGVKGIVLLLGAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL

    >gi|30018829|ref|NP_830460.1| OsmC-like protein [Bacillus cereus ATCC 14579]
    MKLTIKHDDIEADLSYGQLAIGKENGYSPLQLLISSIAGCSAIVFRTILEKKRITYDTFTIETEIGRSEALSKPVESVHL
    HYKIKAENITEEQLDKALQLAVKN
    CTIVQSVKDSIKVTETIELIK

    >gi|30018909|ref|NP_830540.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Bacillus cereus ATCC 14579]
    MNNRYSRQELFSPIGEEGQQKIREKHVLIIGAGALGSANAEMFVRAGVGKITIVDRDYVDWSNLQRQQLYAESDVKNNLP
    KAIAAKKRLEEINSDVTIEALVQDVTAEELEELVINVDVIIDATDNFETRFIVNDISQKYSIPWIYGACVGSYGLSYTIL
    PSKTPCLSCLLQSIPLGGAT
    CDTAGIISPAVSLVVSHQVTEALKLLVEDYESLRDGLVSFDMWKNEYSCMNVQKLRQHNC
    PSCGENALYPYLNKENTSKTAVLCGRNTVQIRPPHKDEMNFEQYKELLEGRVNDLNINPYLLSFSVEDKRLVAFKDGRVL
    VHGTKDISEAKTIYHRYFG

    >gi|30018937|ref|NP_830568.1| thioredoxin [Bacillus cereus ATCC 14579]
    MKKMLIFGGIIIALFVAIFAVTQMEEKNATSQKIDNPTESKTNGPDYYTNKISLSDLQKNLKEKKEETVYFYQTSCVHCQ
    KLSPVLVPMAKDLNVDMKVMDIEKLDAPWDEYKIQGTPTIIHFKDGKEVSRISGEQPKDKLKEWLEQTKK

    >gi|30018950|ref|NP_830581.1| NADH dehydrogenase [Bacillus cereus ATCC 14579]
    MSRKIVVVGGVAGGASVAARLRRLSEEDEIIMVERGEYISFANCGLPYYIGGVITERQKLLVQTVERMSKRFNLDIRVLS
    EVVKINKEEKTITIKNVTTDETYNEEYDVLILSPGAKPIVPPIPGIEEAKALFTLRNVPDTDRIKAYIDEKKPRHATVIG
    GGFIGVEMVENLRERGIEVTLVEMANQVMPPIDYEMAAYVHEHMKVHNVELVFEDGVDALEENGTVVRLKSGSVIKTDMI
    ILAIGVQPESSLAKDAGLALGVRGTIKVNEKFQTSDPYVYAIGDAIEVKDFVTETETMIPLAWPANRQGRMLADIIHGHT
    DSLYKGTMGTSVAKVFDLTVASTGVNEKILKRLNIPYEVVHVQANSHAGYYPNATPVLIKLIFNKDSGKIYGAQALGRDG
    VDKRIDVIATAMKANLTVIDLPDLELSYAPPYSSAKDPVNMVGYAASNIVDGFVDTVQWHEIDHIVENGGYLIDVREPNE
    LKQGMIKGSINIPLDELRDRLDEVPMDKEIYIT
    CQLGMRGYVAARMLMEKGYKVKNVDGGFKLYGTVLPERVVY

    >gi|30018952|ref|NP_830583.1| molybdopterin biosynthesis MoeB protein [Bacillus cereus ATCC 14579]
    MEESIMSIKVDMSLDCKGLACPMPIVKTKKAIEGLAPGQVIEVKATDKGSTIDIKSWASKVGHQYIGTKHEGDVLVHYVR
    KANEHEVNEVVKYPHTITNAELQSILSHGEESIVLDVREAAEFAFGHIPSAISVPLGELDSAVLDETKRIYVI
    CRTGNRS
    DVACHMLKEKGYANVKNVIPGMLEWKGNVEK

    >gi|30018953|ref|NP_830584.1| hydroxyacylglutathione hydrolase [Bacillus cereus ATCC 14579]
    MNVKPLQAKDVAEKVLFGELFILDVRNEADYEDWKIEGKQVSSINKPYFDLLDGVDHIVSELPKDKDVLVVCAKEGSSIF
    VAEQLTEAGLQNIYYLAGGMKAWSEYVKPIKVGNLKDGGSMYQFNRLGKGCLSYMVISNGEAAVIDAVRTAEAYEEFAKE
    HGVTIKNVMDTHLHADHISGGRKLAEKVGGTYWLPPKDAEEVVFSYEPLVEGSVITVGGTKIEIDALYSPGHTIGSTSFI
    VDDSYLLSGDILFVDSIGRPDLAGKAEDWVSDLRNTLYSRYKELSQNLVVLPAHYSKVSEMNESGIVSAKLKDLFANNAG
    LNIEDEGEFRKVVTENLPPQPNAYEEIRQTNMGKIHPSVDKEREMEIGPNRCAVHE

    >gi|30018955|ref|NP_830586.1| rhodanese-related sulfurtransferase [Bacillus cereus ATCC 14579]
    MVCISRFLPVKGVQNINGKELKSIVGKKGKYFIDVRTVGEYRGNHMKGFQNIPLNDLASKANQLDKNKEVIVICQSGMRS
    KQAAKVLKKLGFQQVINVSGGMNSL

    >gi|30018956|ref|NP_830587.1| molybdopterin biosynthesis MoeB protein [Bacillus cereus ATCC 14579]
    MKEMTTKELEEKLLRKEVVNIVDVREVEEVAEGKIPEACNIPLGLLEFRMHELNKNQEYIIVCRSGGRSARAVQFLESYG
    FQVINVVGGMLAWEGKVE

    >gi|30019342|ref|NP_830973.1| transcriptional regulator Spx [Bacillus cereus ATCC 14579]
    MVTLYSSPSCTSCRKAKLWLEENHIPYTERNIFSDPLTIEEIKEILRMTESGTDEIISTRSKVFQELNVNLESLPLQDLY
    KMIRDYPGILRRPIMIDEKRLQVGYNEDEIRRFLPRTVRTFQLREAQRLVN

    >gi|30019399|ref|NP_831030.1| NADH dehydrogenase [Bacillus cereus ATCC 14579]
    MNYVIIGGDAAGMSATMQIVTNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIAHNVKTFRDKYGIDAKVRHEV
    TKVDTEKKMVYAEHTKTKDVFEFPYDRLLIATGVRPVMPEWEGRELQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGA
    IGLEMAETFVELGKKVRMIERNDHIGTIYDADMAEYIHKEADKHHIEILTNENVKAFKGNERVEAIETDKGTYKADLVLV
    SVGVKPNTDFLEGTNIRKNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPLGTTANKQGRLAGLNMLDKRRA
    FKGTLGTGIIKFMDLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDK
    RIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE

    >gi|30019621|ref|NP_831252.1| thiol-disulfide oxidoreductase [Bacillus cereus ATCC 14579]
    MKKNRLLFRVIILLILCGAVGFTLYQGFFANKEKMQIGKEAPNFIVTDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEM
    PYMNELYPKYKEKGVEIIALDADETDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVVEQIIGEQT
    KEQLEGYLKKITP

    >gi|30019723|ref|NP_831354.1| thiosulfate sulfurtransferase [Bacillus cereus ATCC 14579]
    MIVTVEWLREHIEDENVRIIDCRFDLANPNWGREKYEEGHIPHALYFDLNLDLSSPIAEHGGRHPLPNIEEFADKLSEAG
    IDEHTTVIAYDSQAGANAARLWWLCNYVGHEKVYILDGGFPAWKENGLPTTTEIPVVIRKTFKTNIQDHMLVTMETVREN
    IRAGADVTLIDSREPKRYAGVEELVDHKAGHIPTAVNHFWKDGMLQSGQFKNGAGQQERFQNLSKDKETIVY
    CGSGVTAC
    PNIVALKLAGFQNVKLYAGSWSDWISYPENQIAKEED

    >gi|30019866|ref|NP_831497.1| Thiol:disulfide interchange protein tlpA [Bacillus cereus ATCC 14579]
    MKKIIAIILVGALVWAGVNFYNSKKEEKERKAKQAELQEKEVLPQVGFKAPSITLKGLDGKLQSLNDAKGKPYIINFWAS
    W
    CGPCEMEAPDLVHMYDKYKKDVEIFAVNATVSDPVQEASAFANRYGFEFPVLLDMDGVAGLDYKVFSLPTTFFVNKDGI
    IVDHVRGVLPPDQLEKKFKKLIEN

    >gi|30019918|ref|NP_831549.1| peptide methionine sulfoxide reductase [Bacillus cereus ATCC 14579]
    MSEKTYELATFAGGCFWCMVKPFDELPGIHKVLSGYAGGHVENPTYEQVKAGTSGHLEVVQITFDPSIFPYQKLLDLYWP
    QIDPTDDGGQFFDRGPSYRTAIFYHNETQKGLAEKSKQALAESGMFKDPIVTEIRPAAPFYEAEEYHQHFYKKNPEKYAT
    EQKESGREDFIKENWQKK

    >gi|30019946|ref|NP_831577.1| hypothetical protein BC1804 [Bacillus cereus ATCC 14579]
    MATTKPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRFDGIVFKID
    EADGHAFKKMHVRPRPELVTLRLEDDINPHEITGKYLEPKDFYEAMKQEDTVIIDARNDYEFDLGHFKGAIKPDIESFRE
    LPDWIRENKEVLEGKKILTY
    CTGGIRCEKFSGWLVREGYEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQ
    KEHVIVGKDHFTGEPCERYVNCSNPECNKKILCSEENEAKYLRACSHECRVSPRNRYVIQHELTEEQVAAALEQIEAGK

    >gi|30019985|ref|NP_831616.1| 2-hydroxychromene-2-carboxylate isomerase family protein [Bacillus cereus ATCC 14579]
    MTVKMKVYSDFICPFCFLAKGPLDEVAKEKDVEIEWMPFELRPSPYSKIDPWNEPEKLGSWDAFILPTAKKLGIDMRLPR
    VSPHPYTHLAFEGCQFAKERGLGNEYHHRVFTAFFQEEQNIEDIDVLTKLAVEVGLPEAEFKDALVTRKYKEKHQEAIQH
    AYDEANIMAVPTVMIGDEVIQGLASKETLERVIDKEIEKDKTNSFEGMQCNTDGYC

    >gi|30020161|ref|NP_831792.1| O6-methylguanine-DNA methyltransferase [Bacillus cereus ATCC 14579]
    MYQAYYESEVGLLEITANQEGITSVIFVDERQEENKNEMIEQCINELDEYFKGKRKEFTVPLSAEGTAFQKNVWDALYTI
    PYGVSASYLDIAEKVGNIKAVRAIGGANSRNPISIIVP
    CHRVIG

    >gi|30020250|ref|NP_831881.1| glutathione peroxidase [Bacillus cereus ATCC 14579]
    MTVYDFSAKTITGEEKSLKDYKGKALLIVNVASKCGFTPQYKGLQEVYDKYKDQGLEILGFPCNQFGGQEPGTEADITSF
    CELNYGVNFPMFAKVDVKGDKAHPLYTYMTEQAPGLLGMKAVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE


    >gi|30020259|ref|NP_831890.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus ATCC 14579]
    MKGGFLMQERYSRQVLFSGIGEMGQRKIREKHVLLIGAGAIGAANAEALARMGIGKLTIADRDYVEWSNLQRQQLYTEED
    AKQCKPKAIAAAEHVRKINSEVEIVPVVMDVTMQEIEELTKEVDLIIDATDNFDTRLLINDISQKENIPWIYGGCVGGYG
    VTYTSLPGKTPCFRCLMDHPMGGAT
    CDTAGIIQPAVQMVVAHQVTEAMKILVDDFETLRGTMLSFDIWNNQFLSLKVNKQ
    KKSTCPSCGNTRTYPSLTFESQVKTEVLCGRNTVQIRSGIKRVLNLNEIQKRLQKIVHVQKTPYLLSFLIDEYRFVLFTD
    GRAFIHGTSDVKIAKRLYAKYIG

    >gi|30020394|ref|NP_832025.1| thioredoxin [Bacillus cereus ATCC 14579]
    MKGVLLMKEIKTEQEFKDIIASEEPVVVKFFTTWCPDCVRMDNFIGDVMEEFNKFEWYSINKDEFPSIAEEYQVMGIPSL
    LVYQNGEKLGHLHSANAKTEEQVTEFLEAY

    >gi|30020516|ref|NP_832147.1| dehydrogenase [Bacillus cereus ATCC 14579]
    MKKFDVAIVGGGLAGLTASIYLAKVGRKVIVLEKSSQFGGRGMTTNKNGICMNLGAHALYRGGAAFITFNELGMTLPGGI
    PSTKAHGIWKGDIFTIPTDFRSILSTPLLSWSAKVQFSRLMIRLGNLDVGEVPKMSLTTWAENEIKDPMVRNIFYALCRT
    TTYTFAPTIQLASSVLKQIQLSIKEGVLYVDGGWETIITKLRAIANDIGVQFLAKKHVVEIEHSEGKQRIHCVDDEVFEV
    GTVIVTTPPKEACKIIKGAEGTSLHKWSEQSVPVTVGALDIGLRQLPNPTHQFVLGLDQPIFFTNQSRAAKLSEDGSIAV
    SLIKYHNPVLEMNHIHEDKEQLESTMELLHSNWKREVVAQQYLPKITVVHDFPHIDRVEKPGPNIPEMPGVYVAGDWAGH
    DEILADAAVASGKRAALHILKQYESEAVHHGNGAVI

    >gi|30020897|ref|NP_832528.1| dihydrolipoamide dehydrogenase [Bacillus cereus ATCC 14579]
    MSKLVVIGGGPAGYVAAITAAQNGKGVTLIDEAELGGTCLNVGCMPTKSLLESAEIHDIVRKANDYGVTLNTGSISIDWN
    QIQARKSQIVMQLVQGIQYLMKKNKIKVVKGKAKFETDHRVRVVQGNKEEVVDGESFIIASGSEPTELPFAPFDGKWILN
    SSHAMSLESVPSSLLIVGGGVIGCEFASIYSRLGTKVSIVEMAPQLLPGEDEDIANILREKLEKDGVKIFTGAVLKGLNN
    YKKQASFEYEGITHEVTPEFVLVSVGRKPRVQQLGLEKAGVQFSNKGISVNEHMQTNVSHIYAAGDVIGGIQLAHVAFHE
    GTTAALHASGEDVKVNYHAVPRCIYTAPEIASVGLSEKGAREQYGDILIGEFPFTANGKALILGEQVGKVKVIVEPKYQE
    IVGISIIGPYATELIGQGTVMIHTEVTADIMRDYIAAHPTLSEAIHEALMQAVGHAVHA

    >gi|30020949|ref|NP_832580.1| DNA-binding protein [Bacillus cereus ATCC 14579]
    MEHEQHSSINDILHHYKEGIGSFTNQIPEIAETYNAFTQACFQEGALTKREKQLIALGISLATQDEYCTIYHTKGCLDQG
    CSDKEILEACGVSAAFAGGAAMSQAVTLVQECLTELKNQKH

    >gi|30021506|ref|NP_833137.1| transcriptional regulator Spx [Bacillus cereus ATCC 14579]
    MVILYTTASCASCRKAKAWLEEHQIDYIEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIDELSLNEFY
    TLIIEHPLMLRRPIMLDEKRLQIGFNEEEIRKFLPRSVRTFLNIELQKLAN

    >gi|30021601|ref|NP_833232.1| hypothetical protein BC3499 [Bacillus cereus ATCC 14579]
    MTKNNETGWNLDNSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGLTPEELKKEAEIAIFAGNGLPEGAHPLAQAYA
    GHQFGHFNMLGDGRALLIGEQITPSGERFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTT
    GEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLKSLADYTIKRHYPEIESHENRYTALLQEVIKRQASLIAKW
    QLAGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEAL
    KIAQDEISKFSVQYEKQWFLGMKKKLGLFSNEEQDHSLIEQLLKMMEKYKADYTNTFRSLTLDAIENTALFESPEFKEWY
    KLWQSRLDRQEQSKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNDDYSVMEKLLEALSNPYAYSTDQEEYCAPPAPTNR
    PYRTF
    CGT

    >gi|30021613|ref|NP_833244.1| hydroxyacylglutathione hydrolase [Bacillus cereus ATCC 14579]
    MLLKYFYDEKLAHASYLVGCQKEGVAIVIDPSRYIEQYIEFAKKEGMEVIAAAETHIHADFLSGSRELSNLYHVNLYVSD
    EGDCDWKYQYLNEGRYKLVREGTEFKVGHIKFNVIHTPGHTPESISFLVTDTSQNNYTNDKPIGIFTGDFIFVGDIGRPD
    LLETAVGIKDTAKIGAKQLFDSIQKIKILPDYLQIWPSHGAGSACGKALGAIPTSTLGYEKMFNWAFRCNEESDFISPLL
    TGQPEPPKYFSLMKNLNKYGPPIRKKRKSTAINTVEELQEILKSVYQIVDIRDVESFAAGHIEKSINIPYNNSFTTWCGW
    LLDYKKETLIILDEEKVKVEAVIREFESIGLDNIIAFAPLKVIQRLDRFESYKEKTSIELYPHIKGGSVKVIDVRSKKEW
    EEGHLHDAIHITLGNLFEQLDYIPKDFPIVLQ
    CRTGLRSAIAASILQRAGIKEVVNLKGGFLAWKEEGLPYTTCNLNV

    >gi|30021713|ref|NP_833344.1| Thiol:disulfide interchange protein tlpA [Bacillus cereus ATCC 14579]
    MWRKLTIIVVLLCLAGYAAYEQFGNKEQAVKVKQEKSEAAMKEIIARNGIEIGKSAPDFELTKLDGTNVKLSDLKGKKVI
    LNFWATW
    CGPCQQEMPDMEAFYKEHKENVEILAVNYTPSEKGGGEEKVSNFIKEKGITFPVLLDKNIDVTTAYKVITIPT
    SYFIDTKGVIQDKFIGPMTQKEMEKRVAKLK

    >gi|30021824|ref|NP_833455.1| copper-importing ATPase [Bacillus cereus ATCC 14579]
    MNEKKEANLQISGMTCAACANRIEKGLKKVEGVHEANVNFALEKTKIMYDPTKTNPQQFKEKVESLGYGIVSDKAEFTVS
    GMT
    CAACANRVEKRLNKVDGGNKATVNFALESATVDFNPDEVNVNEMKSAITKLGYKLEVKPDDQDASTDHRLQEIERQK
    KKFIISFILSFPLLWAMVSHFSFTSFIYLPDMLMNPWVQLALATPVQFIIGGQFYVGAYKALRNKSANMDVLVALGTSAA
    YFYSVYLSIQSIGSSEHMTDLYFETSAVLITLIILGKLFEAKAKGRSSEAIKKLMGLQAKTATVVRDGTEIKILIEEVVT
    GDIVYVKPGEKIPVDGEIVEGKSAIDESMLTGESIPVDKSIGDVVIGSTINKNGFLKVKATKVGRDTALAQIIKVVEEAQ
    GSKAPIQRVADQISGIFVPVVVVIAIITFAVWMIFVTPGDFGGALEKMIAVLVIACPCALGLATPTSIMAGSGRSAEYGI
    LFKGGEHLEATHRLDTVILDKTGTVTNGKPVLTDVIVADGFNENELLRLVGAAERNSEHPLAEAIVEGIKEKKIDIPSSE
    TFEAIPGFGIESVVEGKHLLIGTRRLMKKFNIDIEEVSKSMEALEREGKTAMLIAIDKEYAGIVAVADTVKDTSKAAIAR
    LKKMGLDVVMITGDNTQTAQAIAKQVGIDHVIAEVLPEGKAEEVKKLQANGKKVAMVGDGINDAPALATANIGMAIGTGT
    DVAMEAADITLIRGDLNSIADAIFMSKMTIRNIKQNLFWALAYNALGIPIAALGFLAPWVAGAAMAFSSVSVVLNALRLQ
    RVKLKP

    >gi|30021825|ref|NP_833456.1| COP associated protein [Bacillus cereus ATCC 14579]
    MEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSAVTLKDIVAVIEDQGYDVQ

    >gi|30021835|ref|NP_833466.1| O6-methylguanine-DNA methyltransferase [Bacillus cereus ATCC 14579]
    MNSYKNNYIYWTLLTHKNWRFHIAATENGLCFIGSQDENFEELNIWARKKLPQHILTHSPGYLQIYTQEVIEYLENKRET
    FTFPIDAYGTNFQLSVWNTVREIPYGKTYSYTEIAERIQKPKAVRAVASAIAANPLLITIP
    CHRVIGKNGKLTGFRGGLE
    MKKKLLTLEKLQVEFI

    >gi|30022058|ref|NP_833689.1| dihydrolipoamide dehydrogenase [Bacillus cereus ATCC 14579]
    MVVGDFPIELDTVVVGAGPGGYVAAIRAAQLGQKVAIIEKANLGGVCLNVGCIPSKALINAGHRYENAMHSDDMGITAEN
    VKVDFTKVQEWKNGVVKKLTGGVEGLLKGNKVEIIRGEAYFVDANTLRVMTEDAAQTYTFKNAVLATGSTPIEIPGFKYS
    KRVINSTGALSLPEIPKKLVVIGGGYIGMELGTAYANFGTEVTVVEAGDEILAGFEKAMSSVVKRALQKKGNVNIHTKAM
    AKGVEETETGVKVSFEVKGEIQTVEADYVLVTVGRRPNTQEIGLEQVGVKMTDRGIIEIDEQCRTNVPNIYAIGDIVPGP
    PLAHKASYEGKVAVEAISGHASAIDYIGIPAVCFTDPELASVGYTKKQAEEAGMTVTVSKFPFAANGRALSLNSTDGFLQ
    LVTRKEDGLLVGAQVAGAGASDIISEIGLAIEAGMTAEDIAQTIHAHPTLGEITMEAAEVALGMPIHIVK

    >gi|30022075|ref|NP_833706.1| NRDH-redoxin [Bacillus cereus ATCC 14579]
    MKKIEVYTQPDCPPCVIVKEFLKHNNVAYEEFDVKKDAAARNRLLYDYDSYSTPTVVIDGEVVAGFQIEKLQQLLNIE

    >gi|30022244|ref|NP_833875.1| dihydrolipoamide dehydrogenase [Bacillus cereus ATCC 14579]
    MAKEYDLVIVGGGTGGYVAAIRASQLGLKTALVEKENLGGTCLHKGCIPSKALLRSAEVYATAKKSEEFGVIASNVELNF
    AKVQERKEKIVTQLHKGVQHLMKQGKIDVFEGIGRILGPSIFSPMPGTISVELASGEENEMLIPKNVLIATGSRPNSLPG
    LELDGEYVMSSDHALKMETLPSSIIIVGGGVIGIEWASMLADFGVEVTVLEYAKTILPLEDQDVSKEMQRLFKKKGIKVV
    TGAKVLPETLVKDNGVTIQAEHNGENKEFKAEKMLVSVGRQANTQNIGLENTDIVVEKGYIQTNEFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIAAVEHIAGKEVTPIDYSMVSKCVYSSPEVASVGLTEQEAKEKGYKLKVGKFSFRAIGKALVYGES
    DGFVKLVVDEETNDILGVHMIGPHVTDMISEAGLARVLDATPWEVAHTIHPHPSLSEAIGEAALAVDGRALHA

    >gi|30022293|ref|NP_833924.1| rhodanese-related sulfurtransferase [Bacillus cereus ATCC 14579]
    MSTTWIILLAVIVAFIGYTVWMYFYQKKLIKTLTEEEFRAGYRKAQLIDIREADEYNAGHILGARNIPLSQIRLRHKELR
    QDQPVYLY
    CQSGFRTGRAAQYLKKQGYKDFYQLQGGFKSWTGKIKKK

    >gi|30022556|ref|NP_834187.1| osmotically inducible protein C [Bacillus cereus ATCC 14579]
    MDKLYTASVTATGGRNGKVVSDDGILNLDVKMPKALGGAGGEATNPEQLFAAGYAACFDSALQLVIRTKRVKVESTEVTA
    HVSIGKDTDGGFGLSAVLDVHVAGVSHSEAQELVEAAHGV
    CPYSKATRGNIEVTLNVR

    >gi|30022599|ref|NP_834230.1| thioredoxin [Bacillus cereus ATCC 14579]
    MAIVNANDQSFAAETSEGVVLLDFWAPWCGPCKMIAPVLEEIDAELGEKVKVVKVDVDENQETARQFEVMSIPALFVLKD
    GKVVDQALGYKPKEALVELVSKHF

    >gi|30022714|ref|NP_834345.1| Thiol peroxidase [Bacillus cereus ATCC 14579]
    MANVTFKGNPMTLVGTEVKVGDQAPNFQVLANDLSPVSLETYKGEVKLISVVPSIDTGVCDAQTRRFNQDAAGIENAKVL
    TISADLPFAQKRWCAANGLENVVTLSDHRDLSFGEAYGLVMKELRLLARAVFVVDSNDKVVYVEYVSEGTSHPNYEAALE
    AAKSAK

    >gi|30022766|ref|NP_834397.1| thioredoxin [Bacillus cereus ATCC 14579]
    MKSLESMEQFQQLKNEENVVFMFSAEWCPDCRFVDPFMPEVEEKYSDFSFYYVDRDEFIDLCVKLDVFGIPSFVAYNKGE
    ETGRYVNKDRKTQEQIEEFIEGLK

    >gi|30022779|ref|NP_834410.1| NAD(FAD)-utilizing dehydrogenase [Bacillus cereus ATCC 14579]
    MHYDVIVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNN
    EDIITFFENLGVKLKEEDPGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVILQTGEVLETNHVV
    IAVGGKSVPQTGSTGDGYAWAEKAGHTITELFPTEVPILSNEPFIRDRSLQGLALRDINLSVLNPKGKAIISHKMDMLFT
    HFGLSGPAALRCSQFVVKALKKFKTNTIQMSIDALPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLEKNE
    IDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYN
    ITSALVTGRIAGTTAGENAKMQY

    >gi|30022796|ref|NP_834427.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus ATCC 14579]
    MQERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKVTIADRDYVEWSNLQRQQLYTEEDAKQYKP
    KAIAAAEHLKAINSEVEINPVVTDVTVQEMEELVNDVDLILDATDNFETRLLINDISQKYNIPWIYGGCVGSYGVTYTIL
    PGKTPCFRCLMEHPASGAT
    CDTAGIIQPAVQLVVAHQITEALKILVEDFGALRETMLSFDLWNNQQMAFKVNRQKKDTCL
    SCGRLRTYPSLTFEGQTKTEVLCGRNTVQIRPGVRKNFNLEEIKKRLQRSVEIKATPYLLSFPVEEYRFVLFTDGRAFIH
    GTNDMNVAKSLYARYIG

    >gi|30022801|ref|NP_834432.1| molybdopterin biosynthesis MoeB protein [Bacillus cereus ATCC 14579]
    MTEVKTITTEEVQERLENGETLFLVDVREDEEVAAGEIPEAVHIKMGDIPHKVDFFNKENEYIFICRSGMRSENVCHYLN
    EQGFKTVNMVGGMLQYEGETK

    >gi|30022839|ref|NP_834470.1| putative cytoplasmic protein [Bacillus cereus ATCC 14579]
    MYVTVTEAAYKKIMDTIPSEAKYIKLFYDNEGCGCVMSGIIDLVAVAEKDERDVDIESSTMNFIADRTKLVFMDDKLTVD
    WHEGGGTFQLKSPSQFYNPNMKLHVRV

    >gi|30022976|ref|NP_834607.1| HESB protein [Bacillus cereus ATCC 14579]
    MIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEVEPKEDDTVLEFFGVEFVIDKESAPIVKGVKIDYK
    QSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC

    >gi|30022979|ref|NP_834610.1| NADH dehydrogenase [Bacillus cereus ATCC 14579]
    MKHLVILGGGYGGMRILQRLLPSNQLPDDVQVTLIDKVPYHCFKTEYYALVAGTISETHIRIPFPEHPRLNIQYGTITNI
    DLEEKAVHLDGGEAIQYDDLIIGLGCEDKYHNVPGAREYTHSLQSIEQTRKTYEQLNSLEPNATVAVVGAGLSGVEVASE
    LRESRSDLKIYLFDRKDRILFPYPEKLSRYVEEWFVKHKVNIIRNSNITKVEPNIVYNHDEPLECDAIVWTAGIQANEVV
    RNLPVEQDGSGRVVLTKYHNIPNNEHVYVVGDCAALPHAPSAQLAEGQGEQIVQILLKRWNNEPLPDELPVIKLKGVLGS
    LGKKHGFGLLANQPLMGRVPRLLKSGLLWMYKYHKG

    >gi|30023029|ref|NP_834660.1| thioredoxin [Bacillus cereus ATCC 14579]
    MIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEDLKIGMLDLNYAPHLAKEYGIESVPCLLVFENGT
    LMKKIYAFHSVEYLYTELK

    >gi|30023032|ref|NP_834663.1| arsenate reductase family protein [Bacillus cereus ATCC 14579]
    MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASED
    EMYELLASDGMLIKRPIVTDGTNVTLGFNEEQFESVWKKYQ

    >gi|30023176|ref|NP_834807.1| glutaredoxin [Bacillus cereus ATCC 14579]
    MKVVLYTKKDCGLCVKAKQVLQEVQCEYSFQIEEIDIYEDNDLLEKYHLMIPVVEMDGKQVEYGNIHKGVIINYIKNAVK
    S

    >gi|30023192|ref|NP_834823.1| thioredoxin reductase [Bacillus cereus ATCC 14579]
    MNSVSEEKIYDVVIIGAGPAGMTAAVYTSRANLSTLMLERGIPGGQMANTEDVENYPGYESILGPDLSNKMFEHAKKFGA
    EYAYGDVKEVIDGKEYKTIIAGKKEYKARAIIVASGAEYKKIGVPGETELGGRGVSY
    CAVCDGAFFKGKELIVIGGGDSA
    VEEGVFLTRFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEASGKVGSVTLVDVNSGEEKEVKTDGVFV
    YIGMLPLSKPFVELGITNENGYLETNERMETKIPGIFAAGDVREKMLRQIVTATGDGSIAAQSAQHYVEELLEELKTVSE
    K

    >gi|30023466|ref|NP_835097.1| bifunctional methionine sulfoxide reductase A/B protein [Bacillus cereus ATCC 14579]
    MAVNEKVELATFAGGCFWCMVSPFEEMEGIIKVVSGYTGGHKENPTYKEVCSETTGHYEAVQITFDANKMPYEELLNIYW
    RQIDPTDIGGQFHDRGQSYETVIFYHNEEQHKKAEASKEELEQSGRFSKPIATKILPAATFYPAEEYHQGYHKKNTFRYE
    LYRKGSGRDAFIKQHWPKDNAHLKEKLNEMQYYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSLDKFDSGCGWP
    SFTKPVMSASVKEKMDVSHNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRY
    CINSAALRFIPKEELEKEGYSDFLILFGNK
    K