Rickettsia rickettsii Iowa uid58961

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|165932551|ref|YP_001649340.1| thioredoxin [Rickettsia rickettsii str. Iowa]
    MANNVKDNSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDENPNTPSEYGIRSIPTIMLFK
    NGEQKDTKIGLQQKNSLLDWINKSI

    >gi|165932587|ref|YP_001649376.1| thiol:disulfide interchange protein [Rickettsia rickettsii str. Iowa]
    MRSIFTILIFLLFLSSCSEEKAQDKKHEEKQIIEHETQNNETYKETNQEAVNSENTAESIVPANDNNQTDEVSTPASHKQ
    KNPAIKPVKVTFKVDDNDMVLGNKKSNVIVVEYFSPT
    CPHCAYYHKTIFPELKKKYIDTNKIAYVVREFIATKQDLDAAI
    LARCKGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITAILIANTNFVAKAPQFIGTPS
    FFVNGVQTGSYSIDTISTAIDKALEEQKEKAKNEMSL

    >gi|165932658|ref|YP_001649447.1| HesB protein family protein [Rickettsia rickettsii str. Iowa]
    MTITITDRAFERVCELVKLEKDKNLVLRVSVDSGGCSGLMYNYELVSKDNIEQDDYVITKHNATIIIDPISQKFMLDCTL
    DFIEELGSSYFNVSNPQAKAKCGCGNSFSV

    >gi|165932844|ref|YP_001649633.1| glutaredoxin [Rickettsia rickettsii str. Iowa]
    MNKAILHTIIVYTLASCPYCIKAKALLDEKNVAYEEIELSNFTQEEKEKFIKKSGGKKTVPQIFIDNMHVGGCDALFDLE
    KEGRLDKLLENQPKTTAPAAGA

    >gi|165933031|ref|YP_001649820.1| thioredoxin peroxidase [Rickettsia rickettsii str. Iowa]
    MNMSVFVGKTAPDFTAKAIMPNNNIDDKFKLSNYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVD
    SHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI
    DALTHHQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL

    >gi|165933132|ref|YP_001649921.1| thiol:disulfide interchange protein [Rickettsia rickettsii str. Iowa]
    MTLRNYNKYLIYIIVFLLYIIIFIPKIHARLYEQPKDKLAFLRGSSVPDNIIFFDEEKNQYSLDQFEGKTILLVFWATWS
    AP
    CVKEMPDLDMLQKDFRKLPFSVIPISEDYQDIKVVKEYFKSYQIRYLPIYHDYRNELFKALGVVSLPTSILIDPNGKI
    VTSFVGNTNWYDEKVRGTILSAISGNYPEPKNSYNAQSLNKPAKPLLPIKKDAL

    >gi|165933186|ref|YP_001649975.1| outer membrane protein [Rickettsia rickettsii str. Iowa]
    MQHIIGKILVIFIVIIGVLFVFKTMKTYSTNPVSVEVKQSEDARKCEEARVQEIIKDYLLKTPEIIIESIEGLQKRKVQE
    NETKVNNYIKDNKLSIEDSTSFPVIGNKDGDVTIIAFYDYN
    CSYCKKGDVSINELLQNDPKVKVVLRPLPILGDVSEYLA
    RIVLAIYKVNPSKFKAVHDELIKIRDVSKESIKELLTENGLNATEIEEIADSNEIKDLITQNMKIARSLRMQGVPAYIID
    SKLIPGLIDLPQLLNIVKEIRDN

    >gi|165933212|ref|YP_001650001.1| thioredoxin reductase [Rickettsia rickettsii str. Iowa]
    MKITTKVLIIGSGPAGLSAAIYTARAALKPILINGMQPGGQLTITTGVENYPGFAETVQGPWLMEQMYMQAKNVGTEIVS
    DYVEKVDLSKRPFKVFTGAGNEYDAESIIICTGAEAKWLGIASEQKFRGFGVSA
    CATCDGVFFKNQEIVVVGGGNSAVEE
    ALYLTNHANKVTIVHRRDSFRAEKILQDRLFKNSKISVIWDHVVDEIVGSNKPKSVTGVKIQNVHTKEISLLNCSGVFIA
    IGHAPNTGLFTGQIAMDDDNYIITKSGTTRTSVEGVFAAGDVQDKIYRQAVTAAGTGCMAALEAEKFLNK

    >gi|165933231|ref|YP_001650020.1| ferredoxin--NAD(P)(+) reductase [Rickettsia rickettsii str. Iowa]
    MHNTDVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIVAEELIKQLALQAAPFNPIY
    HLNQQAIELNKQDDFFEIKTSKNTLIKSKVIIIAAGAGSFGPNKPPLANIEDFESKSVFYFINDKSKFAGKNIVIAGGGD
    SAVDWAISLSDIANKIYLVHRRDKFTAAPESVRQLRHIAETNKIELITGYQLNALDGNNSELQSVIVKDLQNNTRKLDAN
    ILLPFFGLKQDLGSLANWGLNVKLHHIEVDSSYYQTNIEGIYAIGDIAHYVGKLKLILTGFAEAASSLHHAYSRVFDGKA
    LHFEYSTTKNTGKRSKSVTK

    >gi|165933267|ref|YP_001650056.1| glutathione S-transferase family protein [Rickettsia rickettsii str. Iowa]
    MKKLYHNPICPLSRQARVFLKALDIEFTTIKEDYWQFNKDFLKINPAGTLPILAESYGLFVVGIYPFVEYLNSKYPNFNF
    LDEDIDICCEIRRLFFWFNDKFYREVTKIIIDEKVIRSIAKMSSPRTEFLRVAKNNLNYHLEYITSLLEKRSYLVSDSLT
    IADIAASCHLSVLDYFGEIYWDKWTLIKHWYSLIKSRPAFRLLLQDRIPGFTPPNYYTDLDF

    >gi|165933317|ref|YP_001650106.1| HesB protein family protein [Rickettsia rickettsii str. Iowa]
    MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYADSKNQFDEVVEEKGVRILIDPKALMYILGSEM
    DYVETKFKSQFTFTNPNEKANCGCGKSFSV

    >gi|165933355|ref|YP_001650144.1| dihydrolipoamide dehydrogenase [Rickettsia rickettsii str. Iowa]
    MQEFDLVVIGSGPAGYTGSIRAAQLGMKVACIEKSDTLGGTCLNIGCIPSKALLNSSEKYEAALKHFENIGITADVKLDL
    QKMLANKDKVVLDLTKGIESLFAKNKVTRIKGEAKISSSNIVEVNKEQIKAKNILITTGSSVIEIPNIKIDEEFIVSSTG
    ALKLSKVPENLIVVGGGYIGLELGSVWRRLGAKVTVIEYAPSIVPMLDKEIATQFMKLQQKQGIEFKLNTKVLSAEVKSG
    KVNLTIEEDGKSSVVTSDVVLMAVGRKAYTQNLGLESVGIITDKQGSIEINDQFQTAVSNIYAVGDVVKGAMLAHKAEEE
    AVAAVEIMAGQAGHVNYNLIPSVIYTYPEVASVGETEEQLKEKGINYKVGKFPFLANSRARAIGSTEGMVKILADSKTDR
    VLGAHIIGADAGTLIAALTAYMEFGAASEDIARTCHAHPTLSEAIKEAALSVDKRTINI

    >gi|165933452|ref|YP_001650241.1| ADA regulatory protein [Rickettsia rickettsii str. Iowa]
    MSLKSAWLDTPLGSMLAISDTERLYLLDFVESKGLEYKIKRLKINTKSAITEDRTRPIISIEEELKSYFSGTLQKFNTQI
    YLLGSEFQKLVWQELMNVPYGETRSYFTQAKLIGMERSYRAVANANGANNFVIIIP
    CHRIINNNGKLGGYGSGLDRKKWL
    IEHERQKY

    >gi|165933662|ref|YP_001650451.1| thioredoxin peroxidase [Rickettsia rickettsii str. Iowa]
    MTLELGKKLPDLSLHIGQDNVIKLSDLKGKFVILYFYPKDDTPGCTIEAQDFNKLKPEFDKLNTVIIGVSKDKLDSHDKF
    KEKYSLGFDLASDANSNLCEQLGVWIEKSMFGKKYMGIDRATFLLDKEGIVKHIWRSVNAKNHAQEVLEKLRTMLS

    >gi|165933706|ref|YP_001650495.1| glutaredoxin [Rickettsia rickettsii str. Iowa]
    MSLKMLENKNFKFIENEIKNNKVVLFMKGIKKSPACGFSGTVVAILNKLGVEFRDINVLFDAELREDLKKFSDWPTFPQL
    YINGELVGGCDIARELYQSGELEKMLKAYTR

    >gi|165933797|ref|YP_001650586.1| dihydrolipoamide dehydrogenase [Rickettsia rickettsii str. Iowa]
    MEQYDVAVIGGGPGGYVAAIRAAQLKKKVVLIEKEHLGGVCLNWGCIPTKSLLKSAEVFEYIKHAKDYGIDAKGAEINIK
    KIVERSREISNKLAGGVKLLLKKNKVTVIDGVASLAGNKVININDKPTVKAGNIIIATGARSRVLKGFKPDGKQIWTSKE
    AMIPQHVPKSMIIVGSGAIGIEFASFYNSIGVDVTVIEAHNRILPAEDMEISGIAHKNFEKKGIKIITNAKLIKQTKSKD
    KIEVELELADKTQKLQAEILLMAVGITANTENLGLEKTKIKVENGYITTNGLMQTAVSGIYAIGDVAGVPCLAHKASHEG
    IIAAESIAGLKPHTINKHNIPGCTYSSPQIASVGLTEEAATTLGYKLKIGRFPFIANGKALVSGDSDGLIKTIFDAKTGE
    LLGAHMIGSEVTELIQGYVVSKNLEGTELDLINTIFPHPTLSEMMHESVFSAYDRAIHI