Rickettsia rickettsii Sheila Smith uid58027

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|157827864|ref|YP_001494106.1| thioredoxin [Rickettsia rickettsii str. 'Sheila Smith']
    MANNVKDNSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDENPNTPSEYGIRSIPTIMLFK
    NGEQKDTKIGLQQKNSLLDWINKSI

    >gi|157827899|ref|YP_001494141.1| hypothetical protein A1G_00185 [Rickettsia rickettsii str. 'Sheila Smith']
    MRSIFTILIFLLFLSSCSEEKAQDKKHEEKQIIEHETQNNETYKETNQEAVNSENTAESIVPANDNNQTDEVSTPASHKQ
    KNPAIKPVKVTFKVDDNDMVLGNKKSNVIVVEYFSPT
    CPHCAYYHKTIFPELKKKYIDTNKIAYVVREFIATKQDLDAAI
    LARCKGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITAILIANTNFVAKAPQFIGTPS
    FFVNGVQTGSYSIDTISTAIDKALEEQKEKAKNEMSL

    >gi|157827967|ref|YP_001494209.1| Iron-sulfur cluster assembly accessory protein [Rickettsia rickettsii str. 'Sheila Smith']
    MTITITDRAFERVCELVKLEKDKNLVLRVSVDSGGCSGLMYNYELVSKDNIEQDDYVITKHNATIIIDPISQKFMLDCTL
    DFIEELGSSYFNVSNPQAKAKCGCGNSFSV

    >gi|157828145|ref|YP_001494387.1| glutaredoxin 3 [Rickettsia rickettsii str. 'Sheila Smith']
    MNKAILHTIIVYTLASCPYCIKAKALLDEKNVAYEEIELSNFTQEEKEKFIKKSGGKKTVPQIFIDNMHVGGCDALFDLE
    KEGRLDKLLENQPKTTAPAAGA

    >gi|157828322|ref|YP_001494564.1| thioredoxin peroxidase 1 [Rickettsia rickettsii str. 'Sheila Smith']
    MSVFVGKTAPDFTAKAIMPNNNIDDKFKLSNYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVDSH
    FSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVIDA
    LTHHQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL

    >gi|157828420|ref|YP_001494662.1| thiol:disulfide interchange protein tlpA [Rickettsia rickettsii str. 'Sheila Smith']
    MTLRNYNKYLIYIIVFLLYIIIFIPKIHARLYEQPKDKLAFLRGSSVPDNIIFFDEEKNQYSLDQFEGKTILLVFWATWS
    AP
    CVKEMPDLDMLQKDFRKLPFSVIPISEDYQDIKVVKEYFKSYQIRYLPIYHDYRNELFKALGVVSLPTSILIDPNGKI
    VTSFVGNTNWYDEKVRGTILSAISGNYPEPKNSYNAQSLNKPAKPLLPIKKDAL

    >gi|157828468|ref|YP_001494710.1| hypothetical protein A1G_03355 [Rickettsia rickettsii str. 'Sheila Smith']
    MQHIIGKILVIFIVIIGVLFVFKTMKTYSTNPVSVEVKQSEDARKCEEARVQEIIKDYLLKTPEIIIESIEGLQKRKVQE
    NETKVNNYIKDNKLSIEDSTSFPVIGNKDGDVTIIAFYDYN
    CSYCKKGDVSINELLQNDPKVKVVLRPLPILGDVSEYLA
    RIVLAIYKVNPSKFKAVHDELIKIRDVSKESIKELLTENGLNATEIEEIADSNEIKDLITQNMKIARSLRMQGVPAYIID
    SKLIPGLIDLPQLLNIVKEIRDN

    >gi|157828494|ref|YP_001494736.1| thioredoxin reductase [Rickettsia rickettsii str. 'Sheila Smith']
    MKITTKVLIIGSGPAGLSAAIYTARAALKPILINGMQPGGQLTITTGVENYPGFAETVQGPWLMEQMYMQAKNVGTEIVS
    DYVEKVDLSKRPFKVFTGAGNEYDAESIIICTGAEAKWLGIASEQKFRGFGVSA
    CATCDGVFFKNQEIVVVGGGNSAVEE
    ALYLTNHANKVTIVHRRDSFRAEKILQDRLFKNSKISVIWDHVVDEIVGSNKPKSVTGVKIQNVHTKEISLLNCSGVFIA
    IGHAPNTGLFTGQIAMDDDNYIITKSGTTRTSVEGVFAAGDVQDKIYRQAVTAAGTGCMAALEAEKFLNK

    >gi|157828513|ref|YP_001494755.1| thioredoxin reductase [Rickettsia rickettsii str. 'Sheila Smith']
    MHNTDVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIVAEELIKQLALQAAPFNPIY
    HLNQQAIELNKQDDFFEIKTSKNTLIKSKVIIIAAGAGSFGPNKPPLANIEDFESKSVFYFINDKSKFAGKNIVIAGGGD
    SAVDWAISLSDIANKIYLVHRRDKFTAAPESVRQLRHIAETDKIELITGYQLNALDGNNSELQSVIVKDLQNNTRKLDAN
    ILLPFFGLKQDLGSLANWGLNVKLHHIEVDSSYYQTNIEGIYAIGDIAHYVGKLKLILTGFAEAASSLHHAYSRVFDGKA
    LHFEYSTTKNTGKRSKSVTK

    >gi|157828552|ref|YP_001494794.1| hypothetical protein A1G_03845 [Rickettsia rickettsii str. 'Sheila Smith']
    MKKLYHNPICPLSRQARVFLKALDIEFTTIKEDYWQFNKDFLKINPAGTLPILAESYGLFVVGIYPFVEYLNSKYPNFNF
    LDEDIDICCEIRRLFFWFNDKFYREVTKIIIDEKVIRSIAKMSSPRTEFLRVAKNNLNYHLEYITSLLEKRSYLVSDSLT
    IADIAASCHLSVLDYFGEIYWDKWTLIKHWYSLIKSRPAFRLLLQDRIPGFTPPNYYTDLDF

    >gi|157828603|ref|YP_001494845.1| Iron-sulfur cluster assembly accessory protein [Rickettsia rickettsii str. 'Sheila Smith']
    MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYADSKNQFDEVVEEKGVRILIDPKALMYILGSEM
    DYVETKFKSQFTFTNPNEKANCGCGKSFSV

    >gi|157828638|ref|YP_001494880.1| dihydrolipoamide dehydrogenase [Rickettsia rickettsii str. 'Sheila Smith']
    MQEFDLVVIGSGPAGYTGSIRAAQLGMKVACIEKSDTLGGTCLNIGCIPSKALLNSSEKYEAALKHFENIGITADVKLDL
    QKMLANKDKVVLDLTKGIESLFAKNKVTRIKGEAKISSSNIVEVNKEQIKAKNILITTGSSVIEIPNIKIDEEFIVSSTG
    ALKLSKVPENLIVVGGGYIGLELGSVWRRLGAKVTVIEYAPSIVPMLDKEIATQFMKLQQKQGIEFKLNTKVLSAEVKSG
    KVNLTIEEDDKSSVVTSDVVLMAVGRKAYTQNLGLESVGIITDKQGSIEINDQFQTAVSNIYAVGDVVKGAMLAHKAEEE
    AVAAVEIMAGQAGHVNYNLIPSVIYTYPEVASVGETEEQLKEKGINYKVGKFPFLANSRARAIGSTEGMVKILADSKTDR
    VLGAHIIGADAGTLIAALTAYMEFGAASEDIARTCHAHPTLSEAIKEAALSVDKRTINI

    >gi|157828725|ref|YP_001494967.1| methylated-DNA--protein-cysteine methyltransferase [Rickettsia rickettsii str. 'Sheila Smith']
    MVWQELINIPYGETRSYLNQAKVLGKPNSYRAVANANGMNQLAIIVPCHRIY

    >gi|157828729|ref|YP_001494971.1| methylated-DNA--protein-cysteine methyltransferase [Rickettsia rickettsii str. 'Sheila Smith']
    MSLKSAWLDTPLGSMLAISDTERLYLLDFVESKGLEYKIKRLKINTKSAITEDRTRPIISIEEELKSYFSGTLQKFNTQI
    YLLGSEFQKLVWQELMNVPYGETRSYFTQAKLIGMERSYRAVANANGANNFVIIIP
    CHRIINNNGKLGGYGSGLDRKKWL
    IEHERQKY

    >gi|157828938|ref|YP_001495180.1| bacterioferritin comigratory protein [Rickettsia rickettsii str. 'Sheila Smith']
    MTLELGKKLPDLSLHIGQDNVIKLSDLKGKFVILYFYPKDDTPGCTIEAQDFNKLKPEFDKLNTVIIGVSKDKLDSHDKF
    KEKYSLGFDLASDANSNLCEQLGVWIEKSMFGKKYMGIDRATFLLDKEGIVKHIWRSVNAKNHAQEVLEKLRTMLS

    >gi|157828982|ref|YP_001495224.1| glutaredoxin-like protein grla [Rickettsia rickettsii str. 'Sheila Smith']
    MLENKNFKFIENEIKNNKVVLFMKGIKKSPACGFSGTVVAILNKLGVEFRDINVLFDAELREDLKKFSDWPTFPQLYING
    ELVGGCDIARELYQSGELEKMLKAYTR

    >gi|157829071|ref|YP_001495313.1| dihydrolipoamide dehydrogenase [Rickettsia rickettsii str. 'Sheila Smith']
    MEQYDVAVIGGGPGGYVAAIRAAQLKKKVVLIEKEHLGGVCLNWGCIPTKSLLKSAEVFEYIKHAKDYGIDAKGAEINIK
    KIVERSREISNKLAGGVKLLLKKNKVTVIDGVASLAGNKVININDKPTVKAGNIIIATGARSRVLKGFKPDGKQIWTSKE
    AMIPQHVPKSMIIVGSGAIGIEFASFYNSIGVDVTVIEAHNRILPAEDMEISGIAHKNFEKKGIKIITNAKLIKQTKSKD
    KIEVELELADKTQKLQAEILLMAVGITANTENLGLEKTKIKVENGYITTNGLMQTAVSGIYAIGDVAGVPCLAHKASHEG
    IIAAESIAGLKPHTINKHNIPGCTYSSPQIASVGLTEEAATTLGYELKIGRFPFIANGKALVSGDSDGLIKTIFDAKTGE
    LLGAHMIGSEVTELIQGYVVSKNLEGTELDLINTIFPHPTLSEMMHESVFSAYDRAIHI