Rickettsia prowazekii

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15603883|ref|NP_220398.1| thioredoxin (trxA) [Rickettsia prowazekii str. Madrid E]
    MSCYNEITTLLEFDSNDINTTQRINMVNNVTDSSFKNEVLESDLPVMVDFWAEWCGPCKMLIPIIDEISKELQDKVKVLK
    MNIDENPKTPSEYGIRSIPTIMLFKNGEQKDTKIGLQQKNSLLDWINKSI

    >gi|15603904|ref|NP_220419.1| hypothetical protein RP025 [Rickettsia prowazekii str. Madrid E]
    MRNIFIVLIFLFLSNCSEVKAQDKKYEGKQIIVQEPLQNNKTPQETNQESINSATKSVVHNNDNNQTEEVLIHDSREQKK
    PEIRPTKVTFKIDDNDMVLGNKKSNVIVVEYFSPT
    CPHCAYYHQTIFPELKKKYIDTNKIAYVIREFIATKQDLDAAILA
    RCKGDINSFIQFHNIILQQQDKWAYSNKYRELLTDIGQLGGIPPEEYKQCLNSDKITATLIANTNLVAKAPKFIGTPSFF
    VNGVQTENYSIDNISKAVDKALDDETKKQINF

    >gi|15603942|ref|NP_220457.1| HESB protein (hesB1) [Rickettsia prowazekii str. Madrid E]
    MTITITDRAFERIYELIELEKDKNLVLRVSVDSGGCSGLMYNYELVSKDNIEKDDYVFTRHNATIIIDSISQKFMLNCTL
    DFIEELGSSYFNVSNPQAKAKCGCGNSFSV

    >gi|15604077|ref|NP_220592.1| glutaredoxin 3 (grxC1) [Rickettsia prowazekii str. Madrid E]
    MNKSILHTIIIYTLASCPYCIKAKALLDKKNVIYEEIEVSNLTQEEKEKFIKKSGGKSTVPQIFIDNMHVGGCDDLFNLE
    KEGRLDKLLEHQPKN

    >gi|15604195|ref|NP_220710.1| thioredoxin peroxidase 1 (tdpX1) [Rickettsia prowazekii str. Madrid E]
    MSVFVGKTAPDFTAKAIMPNNNIDDKFKLSDYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVIAVSVDSH
    FSHLAWKNTPHNKGGLGQVQFPMVSDITKDISSKYNVLNEDGIALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVIDA
    LTHHQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL

    >gi|15604237|ref|NP_220753.1| hypothetical protein RP370 [Rickettsia prowazekii str. Madrid E]
    MILNMTINYIKKDRYKVLNLVLITISIIALSTAYIAEYIFHYTPCPLCVYERFPYLMLIKISLTALIIRQLNKYTLILIL
    ITILSSCILSTYHSFVERGIVQPSAI
    CSSMIRIPQGLSIQHIKQMFYSQPITSCTKPAIKILGISMTEYNLLLNICLLIF
    LGLILFYPKSNK

    >gi|15604262|ref|NP_220778.1| thiol:disulfide interchange protein TLPA (tlpA) [Rickettsia prowazekii str. Madrid E]
    MTLRNYNKYLIYIIVFLLSIIIFFPKIQAKLYEKPKGKLEFLKGLSVPDNIFFFDEEKNQYSLDQFEGKTILLVFWATWS
    AT
    CIKEMPDFDMLQKDFRKLPFSVIPISEDYQDIKIVKEYFKRYHIRYLPIYHDYRNALFKALGIISLPTSILIDPNGKI
    VTSFVGTTNWYDEKVRDTILSVIPGNYPEPKNSYNEQSLNKPAKHLPKIKNFIIKNEQNNE

    >gi|15604296|ref|NP_220812.1| hypothetical protein RP431 [Rickettsia prowazekii str. Madrid E]
    MKHIIGKILVIFVVIIGVLFVFKTIKTYSTSSIFVEVKQREDAKKCEEERVQEIIKDYLLKTPEIIIESIEGLQKRKIHE
    NETKVNNYLKANKLTIEDSTNFPVIGNHNGDITIIAFYDYN
    CSFCKKGDFSINELLKNDQKVKVVLRPLPILGDSSEYLA
    RIVLAVYKVNPNKFKDIHDKLIKIRAVSQESIKELLIEHGLNYTEIEEIADSNEIKDLITQNIKIARSLRMQGVPTYIIN
    SKLIHGLIDLPQLLNIVQEIMDNKIS

    >gi|15604310|ref|NP_220826.1| thioredoxin reductase (trxB1) [Rickettsia prowazekii str. Madrid E]
    MKITTKVLIIGSGPAGLSAAIYTARSALKPILINGMQPGGQLTMTTDVENYPGFAETIQGPWLMEQMSMQAKNVGTEIIS
    DYVERVDLSKRPFKIFTGTGNEYEADSIIICTGAESKWLGIASEQEFRGFGVSS
    CAICDGFFFKNQEIVVVGGGNSALEE
    ALYLTNHANKVTVVHRRNSFRAEKILQDRLFKNPKISVIWDHIIDEIVGSNKPKAVTGVKIQNVYTNEINLVNCSGVFIA
    IGHAPNTALFKGQIAIDDDNYIVTQSGSTRTNVEGVFAAGDVQDKIYRQAVTAAASGCMAALEVAKFLNK

    >gi|15604324|ref|NP_220840.1| dihydrolipoamide dehydrogenase [Rickettsia prowazekii str. Madrid E]
    MVIGSGPAGYTGSIRAAQLGLKVACIEKNDTLGGTCLNIGCIPSKALLNTSKKYEEAIRHFDSIGIIADIKLDLQKMLSN
    KDKIVLDLTKGIESLFIKNKITKIKGEAKIISNNIVEVNKEQIKAKNILITTGSSVIEIPNITIDEEFIVSSTGALKLSK
    VPKHLIVVGGGYIGLELGSVWRRLGAKVTVVEYASSIVPMLDKEIAKQFMTIQQKQGIEFKLNTKVIASEVKSGKVNLTI
    EEWDKRSIITSDVVLIAVGRKAYTKNLGFESVGITTDNKGRIEINERFQTAVSNIYAVGDVVKGAMLAHKAEEEAIAAVE
    IMVGQAGHVNYNLIPSVIYTYPEVASVGATEEQLQEQGINYKVGKFPFLANSRARAIGSTEGMVKILADSKTDRVLGAHI
    IGSDAGTLIAELIAYMEFGASSEDIARTCHAHPTLSEAIKEAALNVDKRTINI

    >gi|15604345|ref|NP_220861.1| HESB protein (hesB2) [Rickettsia prowazekii str. Madrid E]
    MKNVISLTDAAAKQVKLLIEKRAKPTFGIRVGIKSGGCAGQTYYVEYADNKNQFDEVVEEKGVRILIDPKTLMYILGSEM
    DYVETNFKSQFTFTNPNEKANCGCGKSFSV

    >gi|15604351|ref|NP_220867.1| hypothetical protein RP490 [Rickettsia prowazekii str. Madrid E]
    MKKLYHNPICPLSRQARFFLKELDIEFTTIKEDYWQFNKDFLKINPAGTLPILEESYGLFVVGIYPFVEYLNNKYPNFNF
    LDTDIDICCEIRRLFFWFNNKFYFEVTKIIIDEKVIRSISKMSSPRTEFLRAAKNNLNYHLEYITSLLEKRSYLVSEFLT
    IADIAASCHLSVLDYFGEIYWDKWALVKHWYSLIKSRPAFRLLLQDRIPGFIPPSYYTDLDF

    >gi|15604374|ref|NP_220890.1| thioredoxin reductase (trxB2) [Rickettsia prowazekii str. Madrid E]
    MYNTDIVIIGSGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKHIYDIPAYPKIAAKELIKQLESQAAPFNPVY
    HLNQQATELNKHDDFFEIKTSKNTLIKSKVIIIAAGAGAFGPNKPPIANIEAFEGKSIFYFINDKSKFLGKNIVVAGGGD
    SAVDWAITLSEIANKIYLVHRRDKFTAATESVRQLRHIAETGKIELVTGYQLNNLDGHNSELRSVIVKDLQNNIRKLDAN
    ILLPFFGLKQDLGPLANWGFNVRLQHIEVDNYYYQTNIKGIYAIGDVAHYVGKLKLIITGFAEAACSLHHAYSRVFDGKA
    LHFEYSTNKYEQKQ

    >gi|15604450|ref|NP_220968.1| hypothetical protein RP600 [Rickettsia prowazekii str. Madrid E]
    MLVQNICSTKAYNMLILNNNAFLVDVRTQEEWKQVGIPHLDNKNKVIFLSLQLNKNFEDNFLSIINEKIDTAIFFLCRSG
    YRSFIAANFIANIGYKNCYNISDGFEGNNQDKGWKQNNLPWQF

    >gi|15604579|ref|NP_221097.1| glutaredoxin-like protein GRLA (grxC2) [Rickettsia prowazekii str. Madrid E]
    MTKNKNLEFIQNAIKKNKVVLFMKGTKEMPACGFSGTVVAILNKLGVEFSDINVLFDTALREDLKKFSDWPTFPQLYING
    VLVGGCDIAKELYQNGELEKMLKDVVV

    >gi|15604637|ref|NP_221155.1| dihydrolipoamide dehydrogenase [Rickettsia prowazekii str. Madrid E]
    MEKYDVAVIGGGPGGYVAAIRAAQLKKKVVLIEKAHLGGVCLNWGCIPTKSLLKSAEVFEYIKHAQDYGIDVGIAEINIK
    KIVERSRKIANTLA
    CGVQLLLKKNKVTIIDGVASFGENKVINVNDKPTVKAENIIIATGTRPKILQGFEPDIKQIWTSKE
    AMIPQHVPKSMIIIGSGAIGIEFASFYNSIGVDVTVIEAKNRILPSEDTEIAGIAHKNFEQKGIKIITNAKLIKQTKSQN
    EIEVELELEGKTQKLQATILLMAVGISANIENLGLEKTKVEVENGYILTNGLMQTAESGIYAIGDVAGVPCLAHKASHEG
    IIAAESIAGLNPNGINKHNIPYCIYSSPQIASVGLTEEIAKDLGYEIKIGRFPFSANGKALVSGNSDGLIKTIFDVKTGE
    LLGAHMVGLEVTELIQGYVVSKNLEGTELDLINTIFPHPTLSEMMHESVLAAYDMAIHI