Rickettsia peacockii Rustic uid59301

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|238650215|ref|YP_002916065.1| thioredoxin [Rickettsia peacockii str. Rustic]
    MANNVMDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDENPNTPSEYGIRSIPTIMLFK
    NGEQKDTKIGLQQKNSLLDWINKSI

    >gi|238650237|ref|YP_002916088.1| glutathione S-transferase family protein [Rickettsia peacockii str. Rustic]
    MKKLYHNPICPLSRQARVFLKALDIEFTTIKEDYWQFNKDFLKINPAGTLPILAESYGLFVVGIYPFVEYLNSKYPNFNF
    LDEDIDICCEIRRLFFWFNDKFYREVTKIIIDEKVIRSIAKMSSPRTEFLRVAKNNLNYHLEYITSLLEKRSYLVSDSLT
    IADIAASCHLSVLDYFGEIYWDKWTLIKHWYSLIKSRPAFRLLLQDRIPGFTPPNYYTDLDF

    >gi|238650267|ref|YP_002916119.1| thioredoxin reductase [Rickettsia peacockii str. Rustic]
    MYNTDVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIAAEELIKQLALQAAPFNPIY
    HLNQQAIELNKQDDFFEIKTSKNTLIKSKVIIIAAGAGSFGPNKPPLANIEDFESKSVFYFINDKSKFAGKNIVIAGGGD
    SAVDWAISLSDIANKIYLVHRRDKFTAAPESVRQLRHIAETDKIELITGYQLNALDGNNSELQSVIVKDLQNNTRKLDAN
    ILLPFFGLKQDLGSLANWGLNVKLHHIEVDSSYYQTNIEGIYAIGDIAHYVGKLKLILTGFAEAASSLHHAYSRVFDGKA
    LHFEYSTTKNTGKRSKSVTK

    >gi|238650285|ref|YP_002916137.1| thioredoxin reductase [Rickettsia peacockii str. Rustic]
    MKITTKVLIIGSGPAGLSAAIYTARAALKPILINGMQPGGQLTITTGVENYPGFAETVQGPWLMEQMSMQAKNVGTEIVS
    DYVEKVDLSKRPFKVFTGAGNEYDAESIIICTGAEAKWLGIASEQKFRGFGVSA
    CATCDGFFFKNQEIVVVGGGNSAVEE
    ALYLTNHANKVTIVHRRDSFRAEKILQDRLFKNSKISVIWDHVVDEIVGSNKPKSVTGVKIQNVHTKEISLLNCSGVFIA
    IGHAPNTGLFTGQIVMDDDNYIITKSGTTRTSVEGVFAAGDVQDKIYRQAVTAAGTGCMAALEAEKFLNK

    >gi|238650342|ref|YP_002916194.1| Periplasmic thiol:disulfide interchange protein DsbA [Rickettsia peacockii str. Rustic]
    MRSIFIILIFLLFLSSCSEEKAQDKNHEEKQIIEHETQNNETSKETNQEAVNSENTAESIVPANDNNQTDEVSTPASQKQ
    KNPAIKPVKVTFKVDDNDMVLGNKKSNVIVVEYFSPT
    CPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLDAAI
    LARCKGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITAILIANTNFVAKAPQFIGTPS
    FFVNGVQTGSYSIDTISTAVDKALEEQKEKAKNEKSL

    >gi|238650373|ref|YP_002916225.1| thioredoxin peroxidase [Rickettsia peacockii str. Rustic]
    MTLELGKKLPDLSLHIGQDNVIKLSDLKGKFVILYFYPKDDTPGCTIEAQDFNKLKPEFDKLNTVIIGVSKDKLDSHDKF
    KEKYSLGFDLASDANSNLCEQLGVWIEKSMFGKKYMGIDRATFLLDKEGIVKHIWRSVNAKNHAQEVLEKLRTMLS

    >gi|238650440|ref|YP_002916292.1| glutaredoxin 3 [Rickettsia peacockii str. Rustic]
    MNKAILHTIIVYTLASCPYCIKAKALLDEKNVAYEEIEVSNFTQEEKEKFIKKSGGKKTVPQIFIDNMHVGGCDALFDLE
    KEGRLDKLLENQPKTTSPDAGA

    >gi|238650529|ref|YP_002916381.1| HesB protein family protein [Rickettsia peacockii str. Rustic]
    MTITITDRAFERVCELVKLEKDKNLVLRVSVDSGGCSGLMYNYELVSKDNIEQDDYVITKHNATIIIDPISQKFMLDCTL
    DFIEELGSSYFNVSNPQAKAKCGCGNSFSV

    >gi|238650624|ref|YP_002916476.1| glutaredoxin [Rickettsia peacockii str. Rustic]
    MSLKMLENKNFKFIENEIKNNKVVLFMKGIKKSPACGFSGTVVAILNKLGVEFRDINVLFDAELREDLKKFSDWPTFPQL
    YINGELVGGCDIARELYQSGELEKMLKAYTR

    >gi|238650789|ref|YP_002916644.1| HesB protein family protein [Rickettsia peacockii str. Rustic]
    MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYADSKNQFDEVVEEKGVRILIDPKALMYILGSEM
    DYVETKFKSQFTFTNPNEKANCGCGKSFSV

    >gi|238650825|ref|YP_002916680.1| dihydrolipoamide dehydrogenase [Rickettsia peacockii str. Rustic]
    MEQYDVAVIGGGPGGYVAAIRAAQLKKKVVLIEKEHLGGVCLNWGCIPTKSLLKSAEVFEYIKHAKDYGIDAKGAEINIK
    KIVERSREISNKLAGGVKLLLKKNKVTVIDGVASLAGNKVININDKPTVKAGNIIIATGARSRVLKGFKPDGKQIWTSKE
    AMIPQHVPKSMIIVGSGAIGIEFASFYNSIGVDVTVIEAHNRILPAEDMEISGIAHKNFEKKGIKIITNAKLIKQTKSKD
    KIEVELELADKTQKLQAEILLMAVGITANTENLGLEKTKIKVENGYITTNGLMQTAASGIYAIGDVAGVPCLAHKASHEG
    IIAAESIAGLKPHTINKHNIPGCTYSSPQIASVGLTEEAATTLGYELKIGRFPFIANGKALVSGDSDGLIKTIFDAKTGE
    LLGAHMIGSEVTELIQGYVVSKNLEGTELDLINTIFPHPTLSEMMHESVFSAYDRAIHI

    >gi|238650867|ref|YP_002916722.1| dihydrolipoamide dehydrogenase [Rickettsia peacockii str. Rustic]
    MQEFDLVVIGSGPAGYTGSIRAAQLGMKVACIEKSDTLGGTCLNIGCIPSKALLNSSEKYEAALKHFENIGITADVKLDL
    QKMLANKDKVVLDLTKGIESLFAKNKVTRIKGEAKISSSNIVEVNKEQIKAKNILITTGSSVIEIPNIKIDEEFIVSSTG
    ALKLSKVPENLIVVGGGYISLELGSVWRRLGAKVTVIEYAPSIVPMLDKEIATQFMKLQQKQGIEFKLNTKVLSAEVKSG
    KVNLTIEEDGKSSVVTSDVVLMAVGRKAYTQNLGLESVGIITDKQGSIEINDRFQTAVSNIYAVGDVVKGAMLAHKAEEE
    AVAAVEIMAGQAGHVNYNLIPSVIYTYPEVASVGETEEQLKEKGINYKVGKFPFLANSRARAIGSTEGMVKILADSKTDR
    VLGAHIIGADAGTLIAALTAYMEFGAASEDIARTCHAHPTLSEAIKEAALSVDKRTINM

    >gi|238650917|ref|YP_002916773.1| thiol:disulfide interchange protein [Rickettsia peacockii str. Rustic]
    MTLRNYNKYLIYIIVFLLSIIIFIPKIHARLYEPPKDKLAFLRGSSVPDNIIFFDEEKNQYSLDQFEGKTILLVFWATWS
    AP
    CVKEMPDLDILQKDFRKLPFSVIPISEDYQDIKVVKEYFKSYQIRYLPIYHDYRNELFKALGVVSLPTSILIDQNGKI
    VTSFVGNTNWYDETVRGTILSAISGNYPEPKNSYNAQSLNKPAKPLLPIKKDAL

    >gi|238651064|ref|YP_002916921.1| thioredoxin peroxidase 1 [Rickettsia peacockii str. Rustic]
    MSVFVGKTAPDFTAKAIMPNNNIDDKFKLSNYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVDSH
    FSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVCHMLVNDLPIGRDINYTLKVIDA
    LTHHQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL