Rickettsia massiliae MTU5 uid58801

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|157964074|ref|YP_001498898.1| thioredoxin [Rickettsia massiliae MTU5]
    MEEFMANNVMDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDENPNTPSEYDIRSIPTI
    MLFKNGEQKDTKIGLQQKKSLLDWINKSI

    >gi|157964090|ref|YP_001498914.1| protein-disulfide isomerase [Rickettsia massiliae MTU5]
    MNMRSIFIVLIFLLFLSSCSEEKAQDKKHEEKQIIEHETLQNNETSKETNQEAVNSENTAESIVPANDNNQTDEVSTPAS
    QEQEPKNPAIKPVKVTFKVDDNDMVLGNKKSNVIVVEYFSPT
    CPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQD
    LDAAILARCKGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITEILIANTNFVAKAPQF
    IGTPSFFVNGVQTGSYSIDTISTAVDKALEEQKEKAKNEMSL

    >gi|157964129|ref|YP_001498953.1| Iron-sulfur cluster assembly accessory protein [Rickettsia massiliae MTU5]
    MTITITDRAFERVCELVKLEKDKNLVLRVSVDSGGCSGLMYNYELVSKDNIEQDDYVTTKHNATIIIDPISQKFMLDCTL
    DFIEELGSSYFDVSNPQAKAKCGCGNSFSV

    >gi|157964269|ref|YP_001499093.1| GrxC family glutaredoxin [Rickettsia massiliae MTU5]
    MMNKAILHTIIIYTLASCPYCIKAKALLDEKNVAYEEIEVSNFTQEEKEKFIKKSGGKKTVPQIFIDNMHVGGCDALFDL
    EKEGRLDKLLENQPKKTSPAAGA

    >gi|157964408|ref|YP_001499232.1| thioredoxin peroxidase 1 [Rickettsia massiliae MTU5]
    MNMSVFVGKTAPDFTAKAIMPNNNIDDQFKLSDYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVD
    SHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDGIALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI
    DALTHHQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL

    >gi|157964477|ref|YP_001499301.1| Thiol:disulfide interchange protein tlpA [Rickettsia massiliae MTU5]
    MTINYYMTLRNYNKYLICIIVFLLSIIIFIPKIHAKLYEKPKDKLAFLRGSSVPDNIIFFDEEKNQYSLDQFEGKTILLV
    FWATWSAP
    CVKEMPDLDMLQKDFRKLPFAVIPISEDYQDIKVVKEYFKSYQIRYLPIYHDYRNELFKALGVVSLPTSILI
    DPNGKIVTSFVGNTNWYDEKVRDTILSAIPGNYPEPKNSYNEQSLNKPAKPLLSIKKDAIVTPSK

    >gi|157964514|ref|YP_001499338.1| Thiol:disulfide interchange protein dsbA [Rickettsia massiliae MTU5]
    MKFKKKVFMQHIIGKILVIFVVVIGVLFVFKTMQTYSTNPVSVEVKQSEDARKCEEERVQEIIKDYLLKTPEIIIESIEG
    LQKRKVQENETKVNNYLKDNKLGIEDSTSFPVIGNKDGDVTIIVFFDYN
    CSYCKKGDVSINELLQNDPKVKVVLRPLPIL
    GDASEYLARIVLAVYKVNPSKFKAVHDELIKIRDVSKESIKELLTENGLNATEIEEIADSNEIKDLITQNMKIARSLRIQ
    GVPAYIIDSKLIPGLIDFPQLLNIVEAIRDNKSS

    >gi|157964529|ref|YP_001499353.1| thioredoxin reductase [Rickettsia massiliae MTU5]
    MIIMKITTKVLIIGSGPAGLSAAIYTARAALKPILISGMQPGGQLTITTDVENYPGFAETVQGPWLMEQMSMQAKNVGTE
    IVSDYVEKVDLSKRPFKVFTGAGNEYDAESIIICTGAEAKWLGIASEQKFRGFGVSA
    CATCDGFFFKNQEIVVVGGGNSA
    VEEALYLTNHASKVTIVHRRDSFRAEKILQDRLFKNPKISVIWDHVVDEIVGNNKPKSVTGVKIQNVHTKEISLLNCSGV
    FIAIGHAPNTGLFTGQIVMDDDNYIITKSGTTRTSVEGVFAAGDVQDKIYRQAVTAVGTGCMAALEAETFLNK

    >gi|157964541|ref|YP_001499365.1| thioredoxin reductase [Rickettsia massiliae MTU5]
    MKSMYNTDVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIAAEELIKQLELQAAPFN
    PIYHLNQQAIELNKQDDFFEIKTSKNTLIKGKVIIIAAGAGSFGPNKPPLANIEDFESKSVFYFINDKSKFAGKNIVIAG
    GGDSAVDWAIFLSDIANKIYLVHRRDKFTAAPESVRQLRHIAETDKIELVTGYQLNALDGNNAELQSVIVKDLHNNTRKL
    DANILLPFFGLKQDLGSLANWGLNVKHHHIEVDSSYYQTNIEGIYAIGDIAHYGGKLKLILTGFAEAASSLHHAYSRVFD
    GKALHFEYSTTKYGEKK

    >gi|157964566|ref|YP_001499390.1| glutathione S-transferase [Rickettsia massiliae MTU5]
    MKKLYHNPICPLSRQARVFLKELDIEFTTIKEDYWQFNKDFLKINPAGTLPILAESYGLFVVGIYPFVEYLNSKYPNFNF
    LDEDIDICCEIRRLFFWFNDKFYREVTKIIIDEKVIRSIAKMSSPRTEFLRAAKNNLNYHLEYITSLLEKRSYLVSDSLT
    IADIAASCHLSVLDYFGEIYWDKWTLIKHWYSLIKSRPAFRLLLQDRIPGFTPPNYYTDLDF

    >gi|157964640|ref|YP_001499464.1| dihydrolipoamide dehydrogenase [Rickettsia massiliae MTU5]
    MQEFDLVVIGSGPAGYTGSIRAAQLGMKVACIEKSDTLGGTCLNIGCIPSKALLNSSEKYEEALKHFENIGITADVKLDL
    QKMLANKDKVVLDLTKGIESLFAKNKVTRIKGEAKISSSNIVEVNKEQIKAKNILITTGSSVIEIPNIKIDEEFIVSSTG
    ALKLSKVPENLIVVGGGYIGLELGSVWRRLGAKVTVIEYAPSIVPMLDKEISTQFMKLQQKQGIEFKLNTKVLSAEVKSG
    KVNLTIEEGGKSSVITSDIVLMAVGRKAYTQNLGLESVGIITDKQGSIEINDRFQTAISNIYAVGDVVKGAMLAHKAEEE
    AVAAVEIMAGQAGHVNYNLIPSVIYTYPEVASVGETEEQLKEQGINYKVGKFPFLANSRARAIGSTEGMVKILADSKTDR
    VLGAHIIGADAGTLIAALTAYMEFGAASEDIARTCHAHPTLSEAIKEAALSVDKRTINM

    >gi|157964661|ref|YP_001499485.1| Iron-sulfur cluster assembly accessory protein [Rickettsia massiliae MTU5]
    MKNVISLTASAAKQVKLLIAKRAKPTFGIRVGVKSGGCAGQTYYVEYADSKNQFDEVVEEKGVRILIDPKALMYILGSKM
    DYVETKFKSQFTFTNPNEKANCGCGKSFSMSHFKINN

    >gi|157964860|ref|YP_001499684.1| bacterioferritin comigratory protein [Rickettsia massiliae MTU5]
    MEYIVIISNKFEGVMTLELGKKVPDLSLHIGKDNVIKLSDLKGKFVILYFYPKDDTPGCTIEAQDFNKLKPEFDKLNTVI
    IGVSKDKLDSHDKFKEKYSLGFDLASDANSNLCEQLGVWIEKSMFGKKYMGIDRATFLLDKEGIVKHIWRSVNAKNHAQK
    VLEKLRTMLS

    >gi|157964886|ref|YP_001499710.1| glutaredoxin-like protein grla [Rickettsia massiliae MTU5]
    MTATNKVKSFLYINSVFGFGLFLLKISKILLTICACIYCYRKCILEDKLLSLKMLENKNFKFIENEIKNNKVVLFMKGTK
    ESPA
    CGFSGTVVAILNKLGVEFRDINVLFDAELREDLKKFSDWPTFPQLYINEELVGGCDIARELYQSGELEKMLKAYTR


    >gi|157964953|ref|YP_001499777.1| dihydrolipoamide dehydrogenase [Rickettsia massiliae MTU5]
    MEQYDVAVIGGGPGGYVAAIRAAQLKKKVVLIEKEHLGGVCLNWGCIPTKSLLKSAEVFEYIKHAKDYGIDVKGAEINIK
    KIVERSREISNKLAGGVKLLLKKNKVTVIDGVASLAGNKVININDKPTVKAGNIIIATGARSRVLKGFKPDGKQIWTSKE
    AMIPQHVPKSMIIVGSGAIGIEFASFYNSIGVDVTVIEAHNRILPAEDTEITGIAHKNFEKKGIKIITNAKLIKQTKSKD
    KIEVELELADKTQKLQAEILLMAVGITANTENLGLEKTKIKVENGYITTDGLMQTAASGIYAIGDVAGVPCLAHKASHEG
    IIAAESIAGLKPHAINKHNIPSCTYSSPQIASVGLTEEVAKTLGYELKIGRFPFIANGKALVSGDSDGLIKTIFDAKTGE
    LLGAHMIGSEVTELIQGYVVSKNLEGTELDLINTIFPHPTLSEMMHESVFSAYDRAIHI