Rickettsia felis URRWXCal2 uid58331

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|67458394|ref|YP_246018.1| thioredoxin [Rickettsia felis URRWXCal2]
    MSFPRRRESRVKRDKSSFSKNFKVLDSRFRGNDIKAICTILQKHKGKIMANNVTDSSFKKEVLESDLPVLVDFWAEWCGP
    CKMLTPIIDEISKELKGKVKVLKMNIDENPNIPSEYGIRSIPTIMLFKNGEQKDTKIGLQQKNSLLDWINKSI

    >gi|67458424|ref|YP_246048.1| protein-disulfide isomerase [Rickettsia felis URRWXCal2]
    MRSIFIVPIFLLFLSSCSEEKTQNKNQEEKQIIVQETLQNNNTSQEINQEAVNSENAAESIVPANDNNQTDEVSTPPSQE
    QKNPEIKPVKVTFKVDDNDMVLGNKKSNVIVVEYFSPT
    CPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLDAA
    ILARCKGDINSFVQFHNIILQQQDKWAYSNKYRELLTDIGQLGGVPPEEYKQCLNSDKITETLIANTNFVANAPKFIGTP
    SFFVNGVQTGNYSIDSISTAVDKALEEQKEKAKNEMSL

    >gi|67458503|ref|YP_246127.1| Iron-sulfur cluster assembly accessory protein [Rickettsia felis URRWXCal2]
    MPRRGSASPRNDDLVASTQRHLEKIFIILYNLQDFYKVILVTITITDRAFERVYELVELEKDKNLVLRVSVDSGGCSGLM
    YNYELVSKDNIEQDDYVITKHNATIIIDPISQKFMLDCTLDFIEELGSSYFNVSNPQAKAKCGCGNSFSV

    >gi|67458590|ref|YP_246214.1| bacterioferritin comigratory protein [Rickettsia felis URRWXCal2]
    MTLELGKKAPDFSLHIGNDKVIKLSDLKGKFIVLYFYPKDDTPGCTIEAQDFNRLKPEFDKLNTVIIGVSKDKLDSHDKF
    KEKYSLGFDLASDANSNLCEQLGVWIEKSMFGKKYMGIDRATFLLDKKGIVKHIWRSVNAKNHAQEVLEKLKTLL

    >gi|67458757|ref|YP_246381.1| rhodanese-related sulfurtransferase [Rickettsia felis URRWXCal2]
    MSVQNICSTKAYDILISNDNAFLVDVRTKEEWQQVGIPHLDNKNKLVFLSWQLNKDFEDNFLSIIKDKIDAAIFFLCRSG
    YRSFIAANFIANMGYKNCYNISDGFEGNNQDKGWKQNNLPWQF

    >gi|67458924|ref|YP_246548.1| thioredoxin peroxidase 1 [Rickettsia felis URRWXCal2]
    MNMSVFVGKTAPDFTAKAIMPNNNIDEKFKLSDYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVD
    SHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI
    DALTHHQKHDEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL

    >gi|67459010|ref|YP_246634.1| Thiol:disulfide interchange protein TlpA [Rickettsia felis URRWXCal2]
    MTLRNYNKYLIYIIVFLLSIIIFIPKIYAKHQDKLEFLRGSSVPDNIIFFDEEKNQYSLDQFEGKTILLVFWATWSAPCV
    KEMPDLDMLQKDFRKLPFSVIPISEDYQDIKIVKEYFKSYQIRYLPIYHDYRNELFKALGVVSLPTSILIDPNGKIITSF
    VGNTNWYDEKVRDTILSAIPGNYPEPKNSYNEQSLNKPAKPLPPVKKDAIVTPNK

    >gi|67459054|ref|YP_246678.1| Thiol:disulfide interchange protein DsbA [Rickettsia felis URRWXCal2]
    MQHIIGKILVIFVVVIGVLFVFKTMKTYSTNPVSVEVKQSEDARKCEEERVQEIIKDYLLKTPEIIIESIEGLQKRKVQE
    NETKVNNYLKDNKLGIEDSTSFPIIGNKDGDVTIIAFYDYN
    CSYCKKGDVSINELLQNDSKVKVILRPLPILGDASEYLA
    RIVLAVYKVNPSKFKAVHDELIKIRDVSKESIKELLTENGLNATEIEETADSNEIKDLITQNMKIARSLRIQGVPAYIID
    SKLIPGLIDFPQLLNIVKEIRDAR

    >gi|67459073|ref|YP_246697.1| thioredoxin reductase [Rickettsia felis URRWXCal2]
    MKITTKVLIIGSGPAGLSAAIYTARAALKPILINGMQPGGQLTITTDVENYPGFAETVQGPWLMEQMSMQAKNVGTEIIS
    DYVEKVDLSKRPFKVFTGAGNEYEAESIIICTGAEAKWLSIASEQEFRGFGVSA
    CATCDGFFFKNQEIVVVGGGNSAVEE
    ALYLTNHASKVTITHRRDSFRAEKILQDRLFKNPKISVIWDHVVDEIVGSDKPKSVTGVKIQNVHTKEISLVNCSGVFIA
    IGHAPNTGLFTGQIAMDDDNYIITKSGTTKTSVEGVFAAGDVQDKIYRQAVTAAGSGCMAALEVEKFLNK

    >gi|67459092|ref|YP_246716.1| thioredoxin reductase [Rickettsia felis URRWXCal2]
    MTHTTDVVIIGTGPVGLFAVFQAGMLGMKCHIIDAQEIIGGQCITLYPEKPIYDIPAYPKIAAEELIKQLELQAAPFKPV
    YHLNQQAIELNKQDDFFEIKTSKNTLIKSKVIIIAAGAGSFGPNKPPLANIEDFEGKSVFYFINDKSKFAGKNIVIAGGG
    DSAVDWAISLSEIANKIYLVHRRDKFTAAPESVRQLRHIAETGKIELVTGYQLNALDGNNSELQSVIVKDLQNNTRKLDA
    NILLPFFGLKQDLGSLANWGLNVKLHHIEVDNSYYQTNIEGIYAIGDIAHYAGKLKLILTGFAEAASSLHHAYSRVFDGK
    ALHFEYSTTKYGERK

    >gi|67459128|ref|YP_246752.1| glutathione S-transferase [Rickettsia felis URRWXCal2]
    MKKLYHYPICPLSRQARVFLKELDIEFTTIKEDYWQFNKDFLKINPAGTLPILEESYGLFVVGIYPFVEYLNSKYPNFNF
    LDEDIDICCEIRRLFFWFNDKFYREVTKIIIDEKVIRSIAKMSSPRTEFLRAAKNNLNYHLEYITSLLEKRSYLVSDSLT
    IADIAASCHLSVLDYFGEIYWDKWTLIKHWYSLIKSRPAFRLLLQDRIPGFTPPSYYTDLDF

    >gi|67459199|ref|YP_246823.1| dihydrolipoamide dehydrogenase [Rickettsia felis URRWXCal2]
    MQEFDLVVIGSGPAGYTGSIRAAQLGMKVACIEKNDTLGGTCLNIGCIPSKALLNSSKKYEEALKHFESIGITADVKLDL
    QKMLANKDKVVSDLTKGIESLFAKNKITRIKGEAKIISSDIIEVNKEQIKSKNILITTGSSVIEIPNIKIDEEFIVSSTG
    ALKLSKVPENLIVVGGGYIGLELGSVWSRLGAKVTVIEYAPSIVPMLDKEIATQFMKLQQKQGIVFKLNTKVLSAEVKSG
    KVNLTIEEGGKSSVVTSDVVLMAVGRKAYTQNLGLESVGIITDKQGRIEINDRFQTSSPNIYAVGDVVKGAMLAHKAEEE
    AVAAVEIMAGQAGHVNYNLIPSVIYTYPEVASVGETEEQLKEKGISYKVGKFPFLANSRARAIGSTEGMVKILADSKTDR
    VLGAHIIGADAGTLIAELTAYMEFGAASEDIARTCHAHPTLSEAIKEAALSVDKRTINM

    >gi|67459235|ref|YP_246859.1| Iron-sulfur cluster assembly accessory protein [Rickettsia felis URRWXCal2]
    MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKAGGCAGQTYYVEYADSKNQFDEVVEEKGVRILIDPKALMYILGSEM
    DYVETKFKSQFTFTNPNEKANCGCGKSFNV

    >gi|67459307|ref|YP_246931.1| methylated-DNA--protein-cysteine methyltransferase [Rickettsia felis URRWXCal2]
    MFNEIQRQEYYQALINKDDRYENIFFVAVKTTGVFCRPTCAARKPKFENCEFYKTAKEALHASYRPCQRCKPLSHPYEAS
    DLVRTLVDAVELEPAKRWKDSDFDKLSVDASTARRQFKKRFGMTFVEYARARRMGIAMKQIRMGESVINTQIDMGYESSS
    GFRDAFSKIMGGPPTKLNKHLNILKAAWLDTTLGAMIAISDEKLLYLLEFVDRRGLELEIERLRIKTKSAIIPGSTKPIL
    MIEEELKLYFNGTLQKFNTPIYLLGSPFQKMVWQELINIPYGETQSYLNQAKALGKPTSYRAVANANGMNQLAIIVP
    CHR
    IINSNGELGGYGGGLHRKKWLIEHERKFTTN

    >gi|67459308|ref|YP_246932.1| methylated-DNA--protein-cysteine methyltransferase [Rickettsia felis URRWXCal2]
    MSLKSAWLDTPLGSMLVISDEERLYLLDFAESKGLEHKIKRLKAKTKSAITEDRTKPILSIEEELKLYFNGTLQKFNTSI
    YLLGSEFQKLVWQELMNVPYGETRSYFTQAKLIGRERSYRAVANANGANKFAIIIP
    CHRIINNNGELGGYGSGLDRKKWL
    IEHEKQNY

    >gi|67459451|ref|YP_247075.1| GrxC family glutaredoxin [Rickettsia felis URRWXCal2]
    MNKAILHTIIIYTLASCPYCIKAKALLDEKNVVYEEIEVSNFTQEEKEKFIKKSGGKKTVPQIFIDNIHVGGCDALFDLE
    KEGRLDKLLEGQPKKKMPAAGA

    >gi|67459582|ref|YP_247206.1| glutaredoxin-like protein grla [Rickettsia felis URRWXCal2]
    MTENKNFEFIENEIKNNKVVLFMKGTKEATMCGFSAKVVAILNKLGVEFRDINVFVNPEFREDLKKFSDWPTFPQLYIKG
    ELVGGCDIATELYNNGELEKMLKG

    >gi|67459662|ref|YP_247286.1| dihydrolipoamide dehydrogenase [Rickettsia felis URRWXCal2]
    MEQYDVAVIGGGPGGYVAAIRAAQLKKKVVLIEKEHLGGVCLNWGCIPTKSLLKSAEVFEYIKHAKDYGIDSKGAEINIK
    KIVERSREISNKLAGGVKLLLNKNKVTVIDGVASLAGNKIININDKPIVKADNIIIATGARSRVLKGFEPDGKQIWTSKE
    AMIPQHVPKSMIIVGSGAIGIEFASFYNSIGVDVTVIEAHNRILPAEDTEIAGITHKNFEKKGIKIITNAKLIKQTKSKD
    KIEVELELSGKTQKLQAEILLMAVGITANTENLGLEKTKIKIENGYIVTNGLMQTAESGIYAIGDVAGVPCLAHKASHEG
    IIAAESIAGLKPHAINKHNIPGCTYSSPQIASVGLTEEAAKTLGYELKIGRFPFIANGKALVSGDSDGLIKTIFDAKTGE
    LLGAHMIGSEVTELIQGYVVSKNLEGTELDLINTIFPHPTLSEMMHESVLAAYDRAIHV

    >gi|67459201|ref|YP_246825.1| ribonuclease D [Rickettsia felis URRWXCal2]
    MQIIDNQKTLEEFCNKLANKTCLSIDTEFERRYTYYAQLSIIQVKAEEYCGIIDALSNLDLNIFNKLLADNNITKIFHAP
    REDLEIFYNLFKTLPSNVFDIQIAANICGFGKQLSYDDLCYKLIGITIDKTHQKSNWLKRPITSDMLNYAMLDVEYLYKI
    YKELNNIIIRNNLTNKYQTTLSSLLDVRNYKVEPKNAWKKIKYRSDDESFNRKIQALAAYREENAQTINIPRKHFILDED
    LIKLSKYPPLNHKDFKNLNLKSKYLHKQKYKDEIISLCNNL