Rickettsia conorii Malish 7 uid57633

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15891925|ref|NP_359639.1| thioredoxin [Rickettsia conorii str. Malish 7]
    MANNVMDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDENPNTPSEYGIRSIPTIMLFK
    NGEQKDTKIGLQQKNSLLDWINKSI

    >gi|15891952|ref|NP_359666.1| hypothetical protein RC0029 [Rickettsia conorii str. Malish 7]
    MRSIFIILIFLLFLSSCSEEKAQDKNHEEKQIIEHETQNNETSKATNQEAVNSENTTESIVPANDNNQTDEVSTPASQKQ
    KNPAIKAVKVTFKVDDNDMVLGNKKSNVIVVEYFSPT
    CPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLDAAI
    LARCKGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITAILIANTNFVAKAPQFIGTPS
    FFVNGVQTGNYSIDTISTAVDKALEEQKEKAKNEMSL

    >gi|15892016|ref|NP_359730.1| hesB protein [Rickettsia conorii str. Malish 7]
    MTITITDRAFERVCELVKLEKDKNLVLRISVDSGGCSGLMYNYELVSKDNIEQDDYVITKHNATIIIDPISQKFILDCTL
    DFIEELGSSYFNVSNPQAKAKCGCGNSFSV

    >gi|15892190|ref|NP_359904.1| glutaredoxin 3 [Rickettsia conorii str. Malish 7]
    MNKAILHTIIVYTLASCPYCIKAKALLDEKNVAYEEIEVSNFTQEEKEKFIKKSGGKKTVPQIFIDNMHVGGCDALFDLE
    KEGRLDKLLENQPKTTSPAAGA

    >gi|15892374|ref|NP_360088.1| thioredoxin peroxidase 1 [Rickettsia conorii str. Malish 7]
    MNMSVFVGKTAPDFTAKAIMPNNNIDDKFKLSNYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVD
    SHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI
    DALTHHQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL

    >gi|15892467|ref|NP_360181.1| thiol:disulfide interchange protein tlpA [Rickettsia conorii str. Malish 7]
    MTLRNYNKYLICIIVFLLSIIIFIPKIHARLYEHPKDKLAFLRGSSVPDNIIFFDEEKNQYSLDQFEGKTILLVFWATWS
    AP
    CVKEMPDLDMLQKDFRKLPFSVIPISEDYQDIKVVKEYFKSYQIRYLPIYHDYRNELFKALWVVSLPTSILIDPNGKI
    VTSFVGNTNWYDEKVRGTILSAISGNYPEPKNSYNAQSLNKPAKPLLPIQKDAL

    >gi|15892520|ref|NP_360234.1| putative thiol:disulfide interchange protein dsbA [Rickettsia conorii str. Malish 7]
    MQHIIGKILVIFIVIIGVLFVFKTMKTYSTNPVSVEVKQSEDARKCEEERVQEIIKDYLLKTPEIIIESIEGLQKRKVQE
    NETKVNNYIKDNKLSIEDSTSFPVIGNKDGDVTIIAFYDYN
    CSYCKKGDVSINELLQNDPKVKVVLRPLPILGDVSEYLA
    RIVLAVYKVNPSKFKAVHDELIKIRDVSKESIKELLTESGLNATEIEEIADSNEIKDLITQNMKIARGLRIQGVPAYIID
    SKLIPGLIDFPQLLNIVKEIRGN

    >gi|15892541|ref|NP_360255.1| thioredoxin reductase [Rickettsia conorii str. Malish 7]
    MKITTKVLIIGSGPAGLSAAIYTARAALKPILINGMQPGGQLTITTDVENYPGFAETVQGPWLMEQMYMQAKNVGTEIVS
    DYVEKVDLSKRPFKVFTGAGNEYDAESIIICTGAEAKWLGIASEQKFRGFGVSA
    CATCDGFFFKNQEIVVVGGGNSAVEE
    ALYLTNHANKVTIVHRRDSFRAEKILQDRLFKNSKISVIWDHVVDEIVGSNKPKSVTGVKIQNVHTKEISLLNCSGVFIA
    IGHAPNTGLFTGQIVMDDDNYIITKSGTTRTSVEGVFAAGDVQDKIYRQAVTAAGTGCMAALEAEKFLNK

    >gi|15892560|ref|NP_360274.1| thioredoxin reductase [Rickettsia conorii str. Malish 7]
    MYNTDVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIAAEELIKQLALQAAPFNPIY
    HLNQQAIELNKQDDFFEIKTSKNTLIKSKVIIIAAGAGSFGPNKPPLANIEDFESKSVFYFINDKSKFAGKNIVIAGGGD
    SAVDWAISLSDIANKIYLVHRRDKFTAAPESVRQLRHIAETDKIELITGYQLNALDGNNSELQSVIVKDLQNNTRKLDAN
    ILLPFFGLKQDLGSLANWGLNVKLHHIEVDSSYYQTNIEGIYAIGDIAHYVGKLKLILTGFAEAASSLHHAYSRVFDGKA
    LHFEYSTTKNTGKRSKSVTK

    >gi|15892616|ref|NP_360330.1| dihydrolipoamide dehydrogenase [Rickettsia conorii str. Malish 7]
    MQEFDLVVIGSGPAGYTGSIRAAQLGMKVACIEKSDTLGGTCLNIGCIPSKVLLNSSEKYEVALKHFENIGIIADVKLDL
    QKMLANKDKVVLDLTQGIESLFAKNKVTRIKGEAKISSSNIVEVNKEQIKAKNILITTGSSVIEIPNIKIDEEFIVSSTG
    ALKLSKVPENLIVVGGGYIGLELGSVWRRLGAKVTVIEYAPSIVPMLDKEIATQFMKLQQKQGIEFKLNTKVLSAEVKSG
    KVNLTIEEDSKSSVVTSNVVLMAVGRKAYTQNLGLESVGIITDKQGSIEINDRFQTAISNIYAVGDVVKGAMLAHKAEEE
    AVAAVEIMAGQAGHVNYNLIPSVIYTYPEVASVGETEEQLKEKGINYKVGKFPFLANSRARAIGSTEGMVKILADSKTDR
    VLGAHIIGADAGTLIAALTAYMEFGAASEDIARTCHAHPTLSEAIKEAALSVDKRTINM

    >gi|15892651|ref|NP_360365.1| hesB protein [Rickettsia conorii str. Malish 7]
    MKNVISLTDSAAKQIKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYADSKNQFDEVVEEKGVRILIDPKALMYILGSEM
    DYVETKFKSQFTFTNPNEKASCGCGKSFRV

    >gi|15892705|ref|NP_360419.1| putative glutathione S-transferase [Rickettsia conorii str. Malish 7]
    MKKLYHNPICPLSRQARVFLKELDIEFTTIKEDYWQFNKDFLKINPAGTLPILAESYGLFVVGIYPFVEYLNSKYPNFNF
    LDEDIDICCEIRRLFFWFNDKFYREVTKIIIDEKVIRSIAKMSSPRTEFLRVAKNNLNYHLEYITSLLEKRSYLVSESLT
    IADIAASCHLSVLDYFGEIYWDKWTLIKHWYSLIKSRPAFRLLLQDRIPGFTPPNYYTDLDF

    >gi|15892790|ref|NP_360504.1| putative methylated-DNA--protein-cysteine methyltransferase [Rickettsia conorii str. Malish 7]
    MGKPNSYRAVANANGMNQLAIIVLCHRIINSNGKLGGYGRGLHRKKWLIEHERQFTTN

    >gi|15892793|ref|NP_360507.1| methylated-DNA--protein-cysteine methyltransferase [Rickettsia conorii str. Malish 7]
    MSLKSAWLDTPLGSMLAISDTERLYLLDFVESKGLEYKIKRLKINTKSAITEDRTRPIISIEEELKSYFSGTLQKFNTPI
    YLLGSKFQKLVWQELMNVPYGETRSYFTQAKLIGMERSYRAVANANGANKFVIIIP
    CHCIINNNGKLGGYGSGLDHKKWL
    IEHERQKY

    >gi|15893013|ref|NP_360727.1| bacterioferritin comigratory protein [Rickettsia conorii str. Malish 7]
    MTLELGKKLPDLSLHIGQDNVIKLSDLKGKFVILYFYPKDDTPGCTIEAQDFNKLKPEFDKLNTVIIGVSKDKLDSHDKF
    KEKYSLGFDLASDANSNLCEQLGVWIAKSMFGKKYMGIDRATFLLDKEGIVKHIWRSVNAKNHAQEVLEKLRTMLS

    >gi|15893071|ref|NP_360785.1| glutaredoxin-like protein grla [Rickettsia conorii str. Malish 7]
    MSLKMLENKNFKFIENEIKNNKVVLFMKGIKKSPACGFSGTVVAILNKLGVEFRDINVLFDAELREDLKKFSDWPTFPQL
    YINGELVGGCDIARELYQSGELEKMLKAYTR

    >gi|15893162|ref|NP_360876.1| dihydrolipoamide dehydrogenase [Rickettsia conorii str. Malish 7]
    MEQYDVAVIGGGPGGYVAAIRAAQLKKKVVLIEKEHLGGVCLNWGCIPTKSLLKSAEVFEYIKHAKDYGIDAKGAEINIK
    KIVERSREISNKLAGGVKLLLKKNKVTVIDGVASLAGNKVININDKPIVKAGNIIIATGARSRVLKGFKPDGKQIWTSKE
    AMIPQHVPKSMIIVGSGAIGIEFASFYNSIGVDVTVIEAHNRILPAEDMEISGIARKNFEKKGIKIITNAKLIKQTKSKD
    KIEVELELADKTQKLQAEILLMAVGITANTENLGLEKTKIKVENGYITTNGLMQTAASGIYAIGDVAGVPCLAHKASHEG
    IIAAESIAGLKPHTINKHNIPGCTYSSPQIASVGLTEEAATTLGYELKIGRFPFIANGKALVSGDSDGLIKTIFDAKTGE
    LLGAHMIGSEVTELIQGYVVSKNLEGTELDLINTIFPHPTLSEMMHESVFSAYDRAIHI