Rickettsia canadensis McKiel uid58159

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|157803191|ref|YP_001491740.1| thioredoxin [Rickettsia canadensis str. McKiel]
    MASNVNDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDENPNTPSEYGIRSIPTIMLFK
    NGEQKDTKIGLQQKSYLLDWIHKFV

    >gi|157803211|ref|YP_001491760.1| protein-disulfide isomerase [Rickettsia canadensis str. McKiel]
    MQSIFIVLIFLLFLSSYSEGKVQGKNHEEKQIIEQKTVQNNETSQKINQEAINSENAAESIVPANDNNQTNEVSTPDSQE
    HKDPKIKPIKVTFKVDDNDMVLGNKKSNVIVIEYFSPT
    CPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLDAA
    ILARCKGDINSFVQFHNIILKQQDKWAYSNKYRELLTDIGKLGGISPEEYKQCLNSDKITETLIANTNLVAKTPKFIGTP
    SFFVNGVQTKNYSIDNIAKAVDKALDEQKEKAKK

    >gi|157803249|ref|YP_001491798.1| 2-dehydro-3-deoxyphosphooctonate aldolase [Rickettsia canadensis str. McKiel]
    MTITITDRAFQRVRKLIGLEKDKNLALRVSVDSGGCSGLMYNYELVSKNTIEQDDYVITKHNATIIIDPISQKFMLDCIL
    DFIEELGSSYFNVHNPQAKAKCSCGNSFTV

    >gi|157803311|ref|YP_001491860.1| hypothetical protein A1E_00635 [Rickettsia canadensis str. McKiel]
    MNEKIAILSTYSFVNIEEPANLIPKLLLIAKRKYVRGTILLSKEGFNGSFSGSYENVNLVLEELIKLTVPKDVNVKINYS
    DLHPFQKLKVRLKKEIVAMNVDDLNVDLFKGEYIESKDWDSFITKQDVIVIDTRNDYEVEIGTFKSAINPYTKTFKQFPA
    WVHQNEKLLKGKKIAMF
    CTGGIRCEKSTSLLKSIGYDDVYHLKGGILQYLEDTQNKNNLWQGECFVFDDRRAVEDDLSPS
    ERHTRLPST

    >gi|157803396|ref|YP_001491945.1| glutaredoxin, GrxC family protein [Rickettsia canadensis str. McKiel]
    MNKTILHTIIIYTLASCPYCIKAKALLDKKEVVYEEIEVSNFTQEEKEKLIKKAGGSRTVPQIFINNIHIGGNDDLQKLN
    EEGRLDKLLEGQPKKTPPAAASV

    >gi|157803591|ref|YP_001492140.1| methylated-DNA--protein-cysteine methyltransferase [Rickettsia canadensis str. McKiel]
    MDIKINNVLKSAWLDTPIGSMLTISDEERLYLLDFAESKGLEYKIKRLKIKTKSAITEDRTKPILSIKEELKSYFTGTLK
    KFDTPIYLLGSEFQKLVWQELMNVPYGETRSYFDQAKIIGRERSYRAVANANGANKCAIIIP
    CHRIINNNGELGCYSSGL
    DRKKWLIEHERTFTTN

    >gi|157803650|ref|YP_001492199.1| Iron-sulfur cluster assembly accessory protein [Rickettsia canadensis str. McKiel]
    MKNVISLTDSAAKQIKLLIAKRDKPTFGIRVGVKSGGCAGQTYYVEYADSKNQFDEIVEAKGVRILIDPKALMYILGSKM
    DYVETKFKSQFTFTNPNEKGNCGCGKSFSV

    >gi|157803679|ref|YP_001492228.1| dihydrolipoamide dehydrogenase [Rickettsia canadensis str. McKiel]
    MQEFDLVVIGSGPAGYTGSIRAAQLNMKVACIEKNDALGGTCLNIGCIPSKALLHSSKKYEEALKHFESIGITAEIKLDL
    QKMLVNKDKLVLNLTKGIESLFAKNKVTRIKGEAKIISNNIVEVNNEQIKAKNILITTGSSIIEIPNIKIDEEFIVSSTG
    ALKLSKVPENLIVVGGGYIGLELGSVWRRLGAKVIVVEYAASIVPMLDKEIAMQFMKLQQKQGIQFKLNTKVLSAEVKSG
    KVNLTIEEGGKNVVITSDVVLIAVGRKAYTQNLGLESVGIITDKQGRIEINNHFQTTVSNIYAVGDVVKGAMLAHKAEEE
    AVAAVEIIAGHTGHVNYNLIPSVIYTYPEVASVGETEEQLKEKGINYTVGKFPFLANSRARVIGSTEGMVKILADSKTDK
    VLGAHIIGADAGTLIAELTAYMEFGAAAEDIARTCHAHPTLSEAIKEAALSVDKRTINM

    >gi|157803744|ref|YP_001492293.1| translation initiation factor IF-3 [Rickettsia canadensis str. McKiel]
    MRKLYHYPICPLSRQARVFLKELEIEFTTIKEDYWQFNKDFLQINPSGTLPVLEESYGLFVIGIYPFVEYLNSKYPNFNF
    LDENIDICTEIRRLFFWFNDKFYREVTKIIIDEKVIRSIAKISSPRTEFLRAAKNNLNYHLEYITSLLEKRSYIVSDSLT
    IADIAASCHLSVLDYFGEIFWDKWTLIKHWYSLIKSRPSFRLLLQDRIPGFTPPSYYIDLDF

    >gi|157803773|ref|YP_001492322.1| thioredoxin reductase [Rickettsia canadensis str. McKiel]
    MYNTDVVIIGAGPVGLFAVFQAGMFGMKCHVIDAQETIGGQCITLYPEKPIYDIPAYPKIVAEELIKQLELQAAPFKPVY
    HLNQQAIELNKQGDFFEIKTSKNTLIKSKIIIIAAGAGSFGPNKPPLANIEDFEGKSVFYFINDKNKFTGKNIVIAGGGD
    SAVDWAISLSEIANKIYLVHRRDKFTASPESVRQLRNLAETGKIELVIGYQLNALDGNNGELQSVIVRDLQNNTHKLEAN
    ILLPFFGLKQNLGSLANWGLNVKLQHIEVDNSYYQTNIEGIYAIGDIAHYTGKLKLILIGFAEAASSLHHAYSRVFDGKA
    LHFEYSTTKYGKNGKKK

    >gi|157803791|ref|YP_001492340.1| thioredoxin reductase [Rickettsia canadensis str. McKiel]
    MHITAKVLIIGSGPAGLSAAIYTARAALKPILINGMQPGGQLTITTDVENYPGFAETVQGPWLMEQMYMQAKNVGTEIVS
    DYVEKVDLSKRPFKVLTGAGHEYKAESIIICTGAEAKWLGIASEQEFRGFGVSA
    CATCDGFFFKNQEIVVVGGGNSAVEE
    ALYLTNHANKVTIVHRRDSFRAEKILQARLFKNPKISVIWDHVVDEIVGDNKPKSVTGVKIQNVHTKEISLVNCSGVFVA
    IGHAPNTSLFTGQIAMDYDNYIITKPGTTKTSVEGVFAAGDVQDKIYRQAVTAAGSGCMAALEAEKFLNN

    >gi|157803811|ref|YP_001492360.1| Thiol:disulfide interchange protein DsbA [Rickettsia canadensis str. McKiel]
    MQHIIGKVLAIFVIIIGVLFIFKTMKTYSTKWFSVEVQQSDNARKYEEERIQEIIKDYLLKTPEIIIESIQGLQKRKVQE
    NETKVNNYLKDNNLGIEDSQRFPIIGNKDGDVTIIAFYDYN
    CSYCRKGNMSINELLQNDQKVKVVLRPLPILGDASEYLA
    RISLAIYKINSSKFKVVHDELMKIRNISKESINELLTENGLNATEIDETADSTEIKDLITQNIKIARNLRIQGVPAYIID
    TTLIPGLIDFPQLLNIVKDIRDNKSF

    >gi|157803851|ref|YP_001492400.1| Thiol:disulfide interchange protein TlpA [Rickettsia canadensis str. McKiel]
    MTLRNYNKYFLYIIVFLLSIILFIPKIYSKHQDKLEFLRGSSVPDNVFFFDEEKNQYSLDQFEGKTILLVFWAIWSASCV
    NEIPALDMLQKDFRNLPFSVIPISDDYQDVKVIKEYFKSYQIRYLPIYYDYRNQLFEALSIVSRPTSILIDPNGKIVTSF
    VGNTNWYDERTRETILSSIPGNYPEPKNSYNEQSLNKLAKPLQPIKNDTMKESNIQIKNEQN

    >gi|157803935|ref|YP_001492484.1| thioredoxin peroxidase 1 [Rickettsia canadensis str. McKiel]
    MSVFVGKTAPDFTAKAIMPNNNIDDKFKLSDYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERLTKVVAVSVDSH
    FSHLAWKNTPHNKGGLGQIQFPMVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVIEA
    LAHHQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL

    >gi|157804114|ref|YP_001492663.1| glutaredoxin-like protein grla [Rickettsia canadensis str. McKiel]
    MLENKNFEFIKSEVKNNKVVLFMKGTKETPMCGFSAKVVAILNKLDVEFRDINVLADPELREDLKKFSDWPTFPQLYING
    ELVGGCDIVTELHNNGALEKILKR

    >gi|157804177|ref|YP_001492726.1| dihydrolipoamide dehydrogenase [Rickettsia canadensis str. McKiel]
    MEQYNVAVIGGGPGGYVAAIRAAQLKKKVVLIEKEHLGGVCLNWGCIPTKSLLKSAEVFEYIRHAQDYGIDSKGAEINIK
    KIVKRSREISGKLAGGVKLLLKKNKVTVIDGVASLAGNKIINIGGQGDTLSIKAENIIIATGARPRILKGFEPDGKQILT
    SKEAMIPQHVPKSIIIVGSGAIGIEFASFYNSIGVDVTVIEAHTKILPAEDTEIASIAHKRFEKKGIKIITNAKLIKQTK
    LQDKIEVELELGRKIQKLQAEILLMAVGITANTENLGLEKTKVKVENGYIVTNVLMQTAESGIYAIGDVAGAPCLAHKAS
    HEGIIVAESIAGLKPHAINKHNIPSCTYSSPQIASLGLTEEAAKALGYELKIGRFPFMANSKALVSGDSDGLIKTIFDAK
    TGELLGAHMIGSDVTELIQGYVISKNLEGTELDLINTIFPHPTLSEMMHESVLVAYDRAMHI