Rickettsia bellii RML369 C uid58405

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|91204817|ref|YP_537172.1| thioredoxin [Rickettsia bellii RML369-C]
    MVIYNFTCKKYRGHMASNVTDKSFEEEVLKSDLPVLVDFWAEWCSPCRMLTPIIEEISKDLESKVKVLKMNIDENPEIPS
    KYGIRSIPTVMLFKNGEQKDTKVGLHQKNSLIEWINNNI

    >gi|91204906|ref|YP_537261.1| dihydrolipoamide dehydrogenase [Rickettsia bellii RML369-C]
    MEQYDIAVIGGGPGGYVAAIRAAQLKKKVVLIEKEHLGGVCLNWGCIPTKSLLKSAEVFEYIKHAKDYGVDVGSAKIDIK
    KIVERSREISNKLAGGVKMLLKKNKVTVIDGVAKLEANKVININDNLKIKADNIIIATGARARVLKGFEPDGKQIWTSKE
    AMIPQHVPKSMIIVGSGAIGIEFASFYNAIGVDVTVIEAHSKILPVEDIEISNLAHKSFEKKGIKIITNAKLIKQTKLKD
    GLEIELELAGKTQKLQAEILLMAVGIVANTENLRLEKTKVKVENGYIVTNGLMQTAESGIYAIGDVAGAPCLAHKASHEG
    IIAAENIAGLKPHAINKHNIPGCTYSSPQIASVGLTEEAAKALGHELRIGRFPFMANGKALVGGDAEGLIKTIFDAKTGE
    LLGAHMIGSEVTELIQGYVVSKNLEGTELDLINTIFPHPTLSEMMHESVLAAYDRAIHI

    >gi|91204994|ref|YP_537349.1| bacterioferritin comigratory protein [Rickettsia bellii RML369-C]
    MTLEIGKKAHDFSLHIGKEKVIKLSDLKGKFVVLYFYPKDDTPGCTLEAQDFNKLKPEFDKLNAVIIGVSKDKLDSHDKF
    KEKYCLEFDLASDANSNLCEQYGVWVEKSMFGKKYMGIDRATFLLDKESVVRHIWRSVNAKGHAQEVLDKLKSLQ

    >gi|91205145|ref|YP_537500.1| Thiol:disulfide interchange protein tlpA [Rickettsia bellii RML369-C]
    MGLSNYNKYFFTITVFLLLIIVFTPKIYANPKNGSNVPDDIIFFDEEKNQYSLDQFEGKTILLVFWATWSANCVKEMPDL
    DTLQKDFRKLPFSVIPVSEDYQDVKVIIEYYKSYQIRYLPIYQDYRNQLFKALGVISLPTSILIDPNGKIVTSFIGNTNW
    YDEKIRETILSAIPGNYPEPKNSYNGQSLNKPAKPL

    >gi|91205260|ref|YP_537615.1| thioredoxin reductase [Rickettsia bellii RML369-C]
    MKITTKVLIIGSGPAGLSAAIYAARASLNPILINGIQPGGQLTITTDVENYPGFAESVQGPWLMEQMRMQAENVGTKIVN
    DYVEKVDLSQRPFKVSTGSRTEYEAESIIICTGAEARWLGIPTEQEFMGFGVSA
    CATCDGFFFKNQKVVVVGGGNSAVEE
    ALYLTNHASKVTIVHRRDNFRAEKILQERLFKNPKISVIWDHVVEEIVGNNNPKSVTGVKIQNVHTKETSLVNCSGVFVA
    IGHKPNTALFAEQVTMDNDNYIITTPGSTKTNIEGVFAAGDVQDKIYRQAITAAGTGCMAALEAEKFLNK

    >gi|91205393|ref|YP_537748.1| dihydrolipoamide dehydrogenase [Rickettsia bellii RML369-C]
    MQEFDLVVIGSGPAGYTGSIRAAQLGMKVACIEKNDTLGGTCLNIGCIPSKALLNSSEKYEEALKHFENIGINAEVKLDL
    QKMLANKDKVVSDLTKGIDGLFAKNKITRIKGEAKIISSNIVEVNGEQISAKNILIATGSSVIEIPNIKIDEEFIVSSTG
    ALKLSKVPENLIVVGGGYIGLELGSVWRRLGSKVTVVEYAESIVPMLDKEVASQFMKLQLKQGIEFKLKTKVLSAEVKSG
    KVNLTIEEEGKSSVITSDVVLMAVGRKAYTQNLGLEAVGIATDKQGRIEINEHFQTVVPNIYAVGDAVKGAMLAHKAEEE
    AIAAAEIMAGQAGHVNYNLIPSVIYTSPEVASVGETEEQLKEKGVSYKVGKFPFLANSRARAVGKTEGMVKILADSKTDK
    VLGAHIIGADAGTLIAELTAYMEFGAAAEDIARTCHAHPTLSEAIREAALGVDKRTINI

    >gi|91205508|ref|YP_537863.1| methylated-DNA--protein-cysteine methyltransferase [Rickettsia bellii RML369-C]
    MSLKSTFLDTPLGSMLAISDEEKLYLLDFAESKGLERKIKILKVKTKLPIIDGNTKPISSVEKELKSYFDGNLQKFNTSL
    RLVGSEFQKLVWEKLMNVPYGETRSYFTQAKAVGKETAYRAVANANGANRFAIIIP
    CHRIINNNGELGGYGSGLHRKKWL
    IEHERKFTTN

    >gi|91205530|ref|YP_537885.1| thioredoxin peroxidase 1 [Rickettsia bellii RML369-C]
    MPKNENVCENMKVFVGKTAPDFTATAIMPNNNVEGEFTLSRYAKGHKIILFFYPLDFTFVCPSEIIAFHNKLGEFTERNT
    KVVSVSVDSHFSHLAWKNTPHSKGGLGQVQFPMVSDLKKEISSMYNVLNDGGISLRGTFLIDEDFVVRHMLVNDLPIGRD
    INYTLKVIDALAHNQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL

    >gi|91205553|ref|YP_537908.1| Thiol:disulfide interchange protein dsbA [Rickettsia bellii RML369-C]
    MQHIVGKILVIFVVIIGVLFIFKIIKTSSTKPVSIEVKQNEEPKQCEEERVKKIIEEYLLNTPEIIIQSIENLQKRKVQE
    SETKVNSYIKDNKLDIENSQNFPVIGNKDGDITIVAFYDYS
    CSYCKKGDVSLNELLQNDPEVKILLRPLPILGDVSDYLA
    KIALAVYKINPNKFKAVHSELMKIRNVSKETVEELLAKNDLNITEVEEIADSSDIRDLIAQNMQIARNLKIQGVPAYVIN
    ARLIPGSVDFPQLLSIVKEIRDSKDS

    >gi|91205687|ref|YP_538042.1| disulfide bond formation protein DsbB [Rickettsia bellii RML369-C]
    MPFNTIINYIRKDSYKMLHIGLIAISITALATAYFAEYILRYAPCPLCVYERFPYLTLIKICLTALIIRQLSKYTLVFIF
    LTLLSSCILSTYHSMVERGIVQPSSL
    CSSMIRFPKGLSIEHIRQMLYSQPITSCTKPAIKLLGISMTEYNLLLNLGLLIG
    LLIVWLYPKESSL

    >gi|91205760|ref|YP_538115.1| Iron-sulfur cluster assembly accessory protein [Rickettsia bellii RML369-C]
    MKKSVISLTDSAAKQVQLLIEKRNKPTYGIRVGVKSGGCAGQTYYVEYADNKNQFDEVVEEKGVRILIDPKALMYILGSE
    MDYVETKFKSQFTFTNPNEKANCGCGKSFSV

    >gi|91205797|ref|YP_538152.1| thioredoxin reductase [Rickettsia bellii RML369-C]
    MHNTDVLIIGAGPVGLFAIFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIAAADLIKQLELQAATFNPVY
    HLNQQAVELKKEGEFFEVKTSKDIVIKSKVIVIAAGAGSFGPNKPPLANIEEFENESVFYFINNRSKFTGKNIVIAGGGD
    SAVDWAISLSEIANKIYLVHRRDKFRAANESLRQLKDIAESGKIELVTGYQLDSLEGNNSELQSVIVRDLQNNTRKLNAN
    ILLPFFGLKQELGNLVNWDLDIKLHHIEVDPVYYQTNISGIYAIGDVAHYSGKLKLILTGFAEAASSLHHAYGKVFDGNA
    LHFEYSTTKYTQ

    >gi|91205908|ref|YP_538263.1| glutaredoxin GrxC [Rickettsia bellii RML369-C]
    MNKAILHAIIIYTLAGCPYCMKAKALLDKKEVAYEEIEVQNSQDPNVAVLRKKLNNPDRLTFPQIFIDNMHIGGCDDLYD
    LDKEGRLDKLLEGQPKKD

    >gi|91206019|ref|YP_538374.1| glutathione S-transferase [Rickettsia bellii RML369-C]
    MKKLYHYPICPISRQARVFLKELDIQFTTIKEDYWQFNKEFLKINPAGTLPVLEEQYGLSVVGIYPLVEYLHSKYPNFNF
    LDEDVDVCCEIRRLFFWFNDKFYREVTKIIIDEKVIRSIAKMSSPRTEFLRAAKNNLNYHLEYMTSLLEKRSYIVLDSLT
    IADIAAACHLSVLDYFSEIYWDKWTVIKHWYSLIKSRPAFRLLLQDRIPGFTPPSYYTDLDF

    >gi|91206103|ref|YP_538458.1| protein-disulfide isomerase [Rickettsia bellii RML369-C]
    MRNSFITLIFLLLLSGCSEEKEKVVEQESSESITPAQASTSDENNNQTTETTTPAVITPAVQEQIEQKPEVKTFKVTFKI
    DENDMVLGNKDSKIVVVEYFSPT
    CPHCAYYHSTIFPELKQKYIDTNKIAYVTREFIATKQDLDASILARCKGDINSFMLF
    HDIILKQQDKWSVSNKYRELLTDIGQLGGVTPEEYKKCLSDDKITETLIANTNFITKAPKFIGTPSFFVNGVQTENYSIN
    SISAAIDKAIEESKNKIDL

    >gi|91206114|ref|YP_538469.1| Iron-sulfur cluster assembly accessory protein [Rickettsia bellii RML369-C]
    MTITITDRAFERVKELIELEKDKDLVLRVSVDSGGCSGLMYNYELVSKDTLEKDDYVFTKHNATVIIDPISQKFMLDCTL
    DFIEELGSSYFNVSNPQAKAKCGCGNSFAV

    >gi|91205514|ref|YP_537869.1| Sco2 protein precursor [Rickettsia bellii RML369-C]
    MQSNVIKIIIGASLLIGVGALYLLLSLKTPDKPLAGQVNIYEDNAEIGGDFELIDQNGELFNSDELKGKLSLIYFGFTSC
    PDI
    CPTSLNKITKAVEILSENKIDIVPVFITIDPSRDTPAVLKEYLKHFHPKFIGLTGDEKQIREVADKFKVYYAKAASE
    NDNDQDYMLDHSSFTYLMDKNGKYLKHFYLDSAPSKIMEFLKSN