Rickettsia bellii OSU 85 389 uid58681

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|157826387|ref|YP_001495451.1| thioredoxin [Rickettsia bellii OSU 85-389]
    MVIYNFTCKKYRGHMASNVTDKSFEEEVLKSDLPVLVDFWAEWCGPCRMLTPIIEEISKDLESKVKVLKMNIDENPEIPS
    KYGIRSIPTVMLFKNGEQKDTKVGLHQKNSLIEWINNNI

    >gi|157826445|ref|YP_001495509.1| glutaredoxin-like protein grla [Rickettsia bellii OSU 85-389]
    MVYNVTNKIKHIRFLMLENKSFKFIENEIKNNKVVLFMKGTKEAPMCGFSGKVVMILTKLGVEFRDIDVLSDPELRESLK
    VFSDWPTFPQLYINGELVGGCDIVTELYSSGELEKMLK

    >gi|157826453|ref|YP_001495517.1| Iron-sulfur cluster assembly accessory protein [Rickettsia bellii OSU 85-389]
    MTITITDRAFERVKELIELEKDKDLVLRVSVDSGGCSGLMYNYELVSKDTLEKDDYVFTKHNATVIIDPISQKFMLDCTL
    DFIEELGSSYFNVSNPQAKAKCGCGNSFAV

    >gi|157826464|ref|YP_001495528.1| protein-disulfide isomerase [Rickettsia bellii OSU 85-389]
    MRNSFITLIFLLLLSGCSEEKEKVVEQESSESITPAQASTSDENNNQTTETITPAVQEQIEQKPEVKTFKVTFKIDENDM
    VLGNKDSKIVVVEYFSPT
    CPHCAYYHSTIFPELKQKYIDTNKIAYVTREFIATKQDLDASILARCKGDINSFMLFHDIIL
    KQQDKWSVSNKYRELLTDIGQLGGVTPEEYKKCLSDDKITETLIANTNFITKAPKFIGTPSFFVNGVQTENYSINSISAA
    IDKAIEESKNKIDL

    >gi|157826618|ref|YP_001495682.1| glutathione S-transferase [Rickettsia bellii OSU 85-389]
    MKKLYHYPICPISRQARVFLKELDIQFTTIKEDYWQFNKEFLKINPAGTLPVLEEQYGLSVVGIYPLVEYLHSKYPNFNF
    LDEDVDVCCEIRRLFFWFNDKFYREVTKIIIDEKVIRSIAKMSSPRTEFLRAAKNNLNYHLEYMTSLLEKRSYIVLDSLT
    IADIAAACHLSVLDYFSEIYWDKWTVIKHWYSLIKSRPAFRLLLQDRIPGFTPPSYYTDLDF

    >gi|157826731|ref|YP_001495795.1| glutaredoxin GrxC [Rickettsia bellii OSU 85-389]
    MNKAILHAIIIYTLAGCPYCMKAKALLDKKEVAYEEIEVQNSQDPNVAVLRKKLNNPDRLTFPQIFIDNMHIGGCDDLYD
    LDKEGRLDKLLEGQPKKD

    >gi|157826855|ref|YP_001495919.1| disulfide bond formation protein DsbB [Rickettsia bellii OSU 85-389]
    MLHIGLIAISITALATAYFAEYILRYAPCPLCVYERFPYLTLIKICLTALIIRQLSKYTLVFIFLTLLSSCILSTYHSMV
    ERGIVQPSSL
    CSSMIRFPKGLSIEHIRQMLYSQPITSCTKPAIKLLGISMTEYNLLLNLGLLIGLLIVWLYPKESSL

    >gi|157826995|ref|YP_001496059.1| dihydrolipoamide dehydrogenase [Rickettsia bellii OSU 85-389]
    MQEFDLVVIGSGPAGYTGSIRAAQLGMKVACIEKNDTLGGTCLNIGCIPSKALLNSSEKYEEALKHFENIGINAEVKLDL
    QKMLANKDKVVSDLTKGIDGLFAKNKITRIKGEAKIISSNIVEVNGEQISAKNILIATGSSVIEIPNIKIDEEFIVSSTG
    ALKLSKVPENLIVVGGGYIGLELGSVWRRLGSKVTVVEYAESIVPMLDKEVASQFMKLQLKQGIEFKLKTKVLSAEVKSG
    KVNLTIEEEGKSSVITSDVVLMAVGRKAYTQNLGLEAVGIATDKQGRIEINEHFQTVVPNIYAVGDAVKGAMLAHKAEEE
    AIAAAEIMAGQAGHVNYNLIPSVIYTSPEVASVGETEEQLKEKGVSYKVGKFPFLANSRARAVGKTEGMVKILADSKTDK
    VLGAHIIGADAGTLIAELTAYMEFGAAAEDIARTCHAHPTLSEAIREAALGVDKRTINI

    >gi|157827075|ref|YP_001496139.1| thioredoxin reductase [Rickettsia bellii OSU 85-389]
    MHNTDVLIIGAGPVGLFAIFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIAAADLIKQLELQAAPFNPVY
    HLNQQAVELKKEGEFFEVKTSKDIVIKSKVIVIAAGAGSFGPNKPPLANIEEFENESVFYFINNRSKFTGKNIVIAGGGD
    SAVDWAISLSEIANKIYLVHRRDKFRAANESLRQLKDIAESGKIELVTGYQLDSLEGNNSELQSVIVRDLQNNTRKLNVN
    ILLPFFGLKQELGNLVNWDLDIKLHHIEVDPVYYQTNISGIYAIGDVAHYSGKLKLILTGFAEAASSLHHAYGKVFDGNA
    LHFEYSTTKYTQ

    >gi|157827114|ref|YP_001496178.1| Iron-sulfur cluster assembly accessory protein [Rickettsia bellii OSU 85-389]
    MKKSVISLTDSAAKQVQLLIEKRNKPTYGIRVGVKSGGCAGQTYYVEYADNKNQFDEVVEEKGVRILIDPKALMYILGSE
    MDYVETKFKSQFTFTNPNEKANCGCGKSFSV

    >gi|157827222|ref|YP_001496286.1| methylated-DNA--protein-cysteine methyltransferase [Rickettsia bellii OSU 85-389]
    MSLKSTFLDTPLGSMLAISDEEKLYLLDFAESKGLERKIKMLKVKTKLPIIDGNTKPISSVEKELKSYFDGNLQKFNTSL
    RLVGSEFQKLVWEKLMNVPYGETRSYFTQAKAVGKETAYRAVANANGANRFAIIIP
    CHRIINNNGELGGYGSGLHRKKWL
    IEHERKFTTN

    >gi|157827246|ref|YP_001496310.1| thioredoxin peroxidase 1 [Rickettsia bellii OSU 85-389]
    MPKNENVCENMKVFVGKTAPDFTATAIMPNNNVEGEFTLSRYAKGHKIILFFYPLDFTFVCPSEIIAFHNKLGEFTERNT
    KVVSVSVDSHFSHLAWKNTPHSKGGLGQVQFPMVSDLKKEISSMYNVLNDGGISLRGTFLIDEDFVVRHMLVNDLPIGRD
    INYTLKIIDALAHNQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL

    >gi|157827269|ref|YP_001496333.1| Thiol:disulfide interchange protein dsbA [Rickettsia bellii OSU 85-389]
    MQHIVGKILVIFVVIIGVLFIFKTIKTSSTKPVSIEVKQNEEPKQCEEERVKKIIEEYLLNTPEIIIQSIENLQKRKVQE
    SETKVNSYIKDNKLDIENSQNFPVIGNKDGDITIVAFYDYS
    CSYCKKGDVSLNELLQNDPEVKILLRPLPILGDASDYLA
    KIALAVYKINPNKFKAVHSELMKIRNVSKETVEELLAKNDLNITEVEEIADSSDIRDLIAQNMQIARNLKIQGVPAYVIN
    ARLIPGSVDFPQLLSIVKEIRDSKDS

    >gi|157827396|ref|YP_001496460.1| thioredoxin reductase [Rickettsia bellii OSU 85-389]
    MKITTKVLIIGSGPAGLSAAIYAARASLNPILINGIQPGGQLTITTDVENYPGFAESVQGPWLMEQMRMQAENVGTKIVN
    DYVEKVDLSQRPFKVSTGSRTEYEAESIIICTGAEARWLGIPTEQEFMGFGVSA
    CATCDGFFFKNQEVVVVGGGNSAVEE
    ALYLTNHASKVTIVHRRDNFRAEKILQERLFKNPKISVIWDHVVEEIVGNNNPKSVTGVKIQNVHTKETSLVNCSGVFVA
    IGHKPNTALFAEQVTMDNDNYIITTPGSTKTNIEGVFAAGDVQDKIYRQAITAAGTGCMAALEAEKFLNK

    >gi|157827520|ref|YP_001496584.1| Thiol:disulfide interchange protein tlpA [Rickettsia bellii OSU 85-389]
    MPQLHNIVHKSKSTTKSNFFIIIINYFMGLSNYNKYFFTITVFLLLIIVFTPKIYANPKNGSNVPDDIIFFDEEKNQYSL
    DQFEGKTILLVFWATWSAN
    CVKEMPDLDTLQKDFRKLPFSVIPVSEDYQDVKVIIEYYKSYQIRYLPIYQDYRNQIFKAL
    GVISLPTSILIDPNGKIVTSFIGNTNWYDEKIRETILSAIPGNYPEPKNSYNGQSLNKPAKPL

    >gi|157827674|ref|YP_001496738.1| bacterioferritin comigratory protein [Rickettsia bellii OSU 85-389]
    MTLEIGKKAHDFSLHIGKEKVIKLSDLKGKFVVLYFYPKDDTPGCTLEAQDFNKLKPEFDKLNAVIIGVSKDKLDSHDKF
    KEKYCLEFDLASDANSNLCEQYGVWVEKSMFGKKYMGIDRATFLLDKESVVRHIWRSVNAKGHAQEVLDKLKSLQ

    >gi|157827767|ref|YP_001496831.1| dihydrolipoamide dehydrogenase [Rickettsia bellii OSU 85-389]
    MEQYDIAVIGGGPGGYVAAIRAAQLKKKVVLIEKEHLGGVCLNWGCIPTKSLLKSAEVFEYIKHAKDYGVDVGSAKIDIK
    KIVERSREISNKLAGGVKMLLKKNKVTVIDGVAKLEANKVININDNLKIKADNIIIATGARARVLKGFEPDGKQIWTSKE
    AMIPQHVPKSMIIVGSGAIGIEFASFYNAIGVDVTVIEAHSKILPVEDIEISNLAHKSFEKKGIKIITNAKLIKQTKLKD
    GLEIELELAGKTQKLQAEILLMAVGIVANTENLGLEKTKVKVENGYIVTNGLMQTAESGIYAIGDVAGAPCLAHKASHEG
    IIAAENIAGLKPHAINKHNIPGCTYSSPQIASVGLTEEAAKALGHELRIGRFPFMANGKALVGGDAEGLIKTIFDAKTGE
    LLGAHMIGSEVTELIQGYVVSKNLEGTELDLINTIFPHPTLSEMMHESVLAAYDRAIHI