Bacillus cereus ATCC 10987 uid57673

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|42779520|ref|NP_976767.1| alkyl hydroperoxide reductase, F subunit [Bacillus cereus ATCC 10987]
    MILDADIKTQLSQYLQLMENDILLKVSAGDDDVSKDMLALVDELATMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGI
    PLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHFESYISLS
    CHNCPDVVQALNVMSVLNSGITHTMIDGAAFKE
    EVESKDIMAVPTVFLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRN
    VGVPGEAEFKNKGVAY
    CPHCDGPLFTGKDVAVIGGGNSGIEAAIDLAGIVNHVTVLEFMPELKADAVLQERLNSLPNVTV
    LKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
    NNPYKQIIISMGSGANAALGAFDYLIRN

    >gi|42779521|ref|NP_976768.1| alkyl hydroperoxide reductase, subunit C [Bacillus cereus ATCC 10987]
    MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTFVCPTELEDLQNQYATLKELGVEVYSVSTDTHFTHK
    AWHDSSETIGKIEYIMIGDPTRTITTNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRN
    NPGEVCPAKWQEGSATLKPSLDLVGKI

    >gi|42779579|ref|NP_976826.1| hypothetical protein BCE_0499 [Bacillus cereus ATCC 10987]
    MNTFKTIEELATYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLENYNYVEKIEILLQDMQEIAGRYAVFTGPTVLLFYNG
    KEILRESRFISLENLERTIQLFEE

    >gi|42779671|ref|NP_976918.1| bacterioferritin comigratory protein [Bacillus cereus ATCC 10987]
    MITVGEMAPEFTLEGSNGEQVRLADFRGKNVVLYFYPKDMTPGCTTEACDFRDAYGLFQEKDTVILGVSPDSANRHLKFV
    EKHELPFVLLVDEDHKVAELYDVWKLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHVEDVLSYIK

    >gi|42779678|ref|NP_976925.1| hypothetical protein BCE_0598 [Bacillus cereus ATCC 10987]
    MKSSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRL
    KEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVD
    QFKKDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYINGNLANPDFDSMKKAIDKELKK

    >gi|42779741|ref|NP_976988.1| heavy metal-transporting ATPase [Bacillus cereus ATCC 10987]
    MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKTMVLETAQNKESEVVTEAKQLVTKLEPHIKVQEEKN
    TKMAKEVFILEGLD
    CANCAMKIENKVKEMPTVSAATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVVREEKG
    GHDHGHSHDHGEANVKKMVGRLVVGGILTAIAALAGLPQMITIPLFVLAYVLIGGDIVWRAVRNITRGQVFDENFLMAIA
    TLGAFAIQQYPEAVAVMLFYQVGELFQSIAVNRSRKSITSLMDIRPDYANVKVGNETKQVSPEDVQIGDYIIVKPGEKVP
    LDGKVVEGTSMVDTSALTGESVPREVEIGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITKF
    ARYYTPVVVITAAIMAFIPPLILEGATFSDWIYRALVFLVISCPCALVVSIPLGFFGGIGGASKSGVLVKGSNYLEALND
    VKYIVFDKTGTLTKGVFKVTKMEPSEGITNEELLEYAAFAEVYSNHPIAQSIRNAYGKSVDEKIIDDYNEISGHGTVVKV
    QGKEIFAGNAKLMRKENITFKQPETVGTLVHVAVDGKYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAKPVGEA
    VGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKVAFVGDGINDTPVLARADVGIAMGGLGSDAAIEAADIVIMTDEPS
    KIATAVNIAKRTRRIVWQNIIFALGVKGLVLLLGAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL

    >gi|42779790|ref|NP_977037.1| hypothetical protein BCE_0712 [Bacillus cereus ATCC 10987]
    MKLTIKQDDIEADLSYGQLAIGKENGYSPLQLLVSSIAGCSAIVFRTILEKKRITYDTFTIETEIGRSEALSKPVESVHL
    HYKIKAQNITEEQLDKALQLAVKN
    CTIVQSVKDSIKVTETIELIK

    >gi|42779880|ref|NP_977127.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Bacillus cereus ATCC 10987]
    MNNRYSRQELFSPIGEEGQQKIREKHVLIIGAGALGSANAEMFVRAGVGTVTIVDRDYVDWSNLQRQQLYAESDVKNNLP
    KAVAAKKRLEEINSEVRVEALVQDVTAEELEELVTNVDVMIDATDNFETRFIVNDIAQKHSIPWIYGACVGSYGLSYTIL
    PSKTPCLSCLLQSIPLGGAT
    CDTAGIISPAVSLVVSHQVTEALKLLVEDYESLRDGLVSFDVWKNEYSCMNVQKLRKHNC
    PSCGENALYPYLNKDNTSKTAVLCGRNTVQIRPPHKEEIDFERYKELLNDRVHDLNVNPYLLSFSVEEKRLVAFKDGRVL
    VHGTKDISEAKTIYHRYFG

    >gi|42779899|ref|NP_977146.1| thioredoxin, putative [Bacillus cereus ATCC 10987]
    MKKILIFGGIIIVLFAAMFAVAQMEKKNASTNEKDYYSNKISLEDLNKNIEDKKEQTIYFYQTSCVHCQKVSPIVVPLAK
    DLNVDMKVIDIENLNEPWDKYNIQGTPTIIHFKDGKEVSRISGEQSKEKFKEWFEQTKK

    >gi|42779942|ref|NP_977189.1| rhodanese domain-containing protein [Bacillus cereus ATCC 10987]
    MSIKVDMSLDCKGLACPMPIVKTKKAMEGLTSGQVIEIEATDKGSTVDIQSWANKVGHQYIGTKQEGDVLRHYVRKAHEH
    ELNEVAKYPLTITNTELEEILLSDEECIVLDVREAAEFAFGHIPSAVSVPLGELDSAALDQTKQIYVV
    CRTGNRSDVACH
    MLKEKGYVNVKNVIPGMLEWQGNIKN

    >gi|42779943|ref|NP_977190.1| metallo-beta-lactamase family protein [Bacillus cereus ATCC 10987]
    MNVKPLQAKDVAEKVLFGELFILDVRNEADYEDWKIEGKEVTSMNVPYFDLLEGVDHIASELPKDKDVLVVCAKEGSSIF
    VAEQLTEAGLENIYYLASGMKAWSEYVKPIKVGDLKNGGSMYQFNRLGKGCLSYMVVSNGEAAVIDAVRTVEAYEEFAKE
    HGVTITNVMDTHLHADHISGGRKLAEKVGGTYWLPPKDAEEVVFSYEPLVEGTVITVGGTKIRIDALYSPGHTIGSTSFI
    VDDSYLLSGDILFVDSIGRPDLAGKAEDWVSDLRNTLYSRYKELSQNLVVLPAHYSKVSEMTESGIVSAKLKDLFANNAG
    LNIEDEVEFRKTVTENLPPQPNAYEEIRQTNMGKIHPSVDKEREMEIGPNRCAVHE

    >gi|42779945|ref|NP_977192.1| rhodanese-like domain-containing protein [Bacillus cereus ATCC 10987]
    MNTILSTLFIVFAVAFVISRFLPVKGVQNISGKQLKNIAGKKGKQLIDVRTVSEYRGNHMKGFQNIPLNELASRASQLDK
    NKEVIVI
    CQSGMRSKQAAKVLKKLGFQHVINVSGGMNGL

    >gi|42779946|ref|NP_977193.1| rhodanese domain-containing protein [Bacillus cereus ATCC 10987]
    MKEMTVKEVEEKLLRKEEVNIVDVREVEEVAEGKIPEACNIPLGLLEFRMHELDKKKEYIIVCRSGGRSARAVQFLESYG
    FQAINMVGGMLAWEGKVE

    >gi|42780383|ref|NP_977630.1| transcriptional regulator Spx [Bacillus cereus ATCC 10987]
    MVTLYSSPSCTSCRKAKLWLEENHIPYTERNIFSDPLTIEEIKEILRMTESGTDEIISTRSKVFQELNVNLESLPLQDLY
    KMIRDYPGILRRPIMIDEKRLQVGYNEDEIRRFLPRTVRTFQLREAQRLVN

    >gi|42780446|ref|NP_977693.1| pyridine nucleotide-disulfide oxidoreductase, class I [Bacillus cereus ATCC 10987]
    MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEV
    TKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAE
    CILKTLETNKVEDVTIIGGGA
    IGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIHKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLV
    SVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRA
    FKGTLGTGIIKFMDLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDK
    RIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE

    >gi|42780672|ref|NP_977919.1| thiol-disulfide oxidoreductase [Bacillus cereus ATCC 10987]
    MKKNRLLFRVIILLILSGAVGFTLYQGYFSKEEKMEIGKEAPNFVVTDLEGKKIELKDFKGKGVFLNFWGTWCKPCEKEM
    PYMNELYPKYKEKGVEIIALDADETDIAVKNFVKQYDLKFPVAIDKGGEIIKTYGVIPLPTSFLIDKDGKVIQEIKGEQT
    KEQLEEYLKKITP

    >gi|42780779|ref|NP_978026.1| rhodanese-like domain-containing protein [Bacillus cereus ATCC 10987]
    MLVTVEWLREHIKDENVRIIDCRFDLANPNWGREKYEEEHIPHALYFDLNVDLSSPITEHGGRHPLPNIEEFADKLSQAG
    IDEHTKVIAYDSEAGANASRLWWLLNYVGHEKVYILDGGFPAWKENGLPVTTEISVAKRKAFKANVQNHMLVTMETVREN
    IYAGADVTLIDSREPKRYAGVEELVDPKAGHIPTAVNYFWKDGMLQSGQFKNEAQQQERFQNLSKDKETIVY
    CGSGVTAC
    PNIVALKLAGFQNVKLYAGSWSDWISYPENQIAKEED

    >gi|42780922|ref|NP_978169.1| thioredoxin family protein [Bacillus cereus ATCC 10987]
    MKKLIVIILAGALIWAGVNFYNSKKEEKERKAKQAELQKTEVLPQVGFKAPDITLKGLDGKLYSLHDAKGKPYLINFWAS
    W
    CGPCEMEAPDLVRMYDKYKKDVEIFAVNATIGDPVQEASAFADRHGFKFPVLLDMDGVAGLDYKVFSLPTTFFVNKDGI
    IVEQVRGVLPPDQLEEKFKKLIES

    >gi|42781000|ref|NP_978247.1| peptide methionine sulfoxide reductase [Bacillus cereus ATCC 10987]
    MSEKTYELATFAGGCFWCMVKPFDELPGIHKVRSGYAGGHVENPTYEQVKAGTSGHLEVVQITFDPSIFPYKKLLDLYWP
    QIDPTDDGGQFFDRGPSYRTAIFYHNETQKELAEKSKQALAESGMFKEPIVTEIRPAAPFYEAEEYHQHFYKKNPEKYAT
    EQKESGREDFIKENWQKK

    >gi|42781030|ref|NP_978277.1| hypothetical protein BCE_1961 [Bacillus cereus ATCC 10987]
    MATTKPYRVLLYYMYTTIENPEEFAAEHLAFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRFDGIVFKID
    EADGHAFKKMHVRPRPELVTLRLEDDINPHEITGKYLEPKDFYEAMKQEDTVIIDARNDYEFDLGHFKGAIKPDIESFRE
    LPDWIRENKEVLEGKKILTY
    CTGGIRCEKFSGWLVREGYEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQ
    KEHVIVGKDYFTGEPCERYVNCANPECNKKILCSEENEAKYLRACSHECRVSPRNRYVIQHELTEEQVAAALEKIEAGK

    >gi|42781071|ref|NP_978318.1| 2-hydroxychromene-2-carboxylate isomerase family protein [Bacillus cereus ATCC 10987]
    MTVKMKVYSDFICPFCFLAKGPLDEVAKEKDVEIEWMPFELRPSPYSKIDPWNEPEKLGSWDAFILPTAKKLGIEMRLPR
    VSPHPYTHLAFEGCQFAKERGLGNEYHHRVFTAFFQEEQNIEDIDVLTKLAVEVGLPEAEFKDALVTRKYKEKHQEAIQH
    AYEEANIMAVPTVMIGDEVIQGLASKETLERVIDKEIEKDKTNSFEGMQCNTDGYC

    >gi|42781173|ref|NP_978420.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus ATCC 10987]
    MYQAYYESELGLLEITANDKGITSVIFVDERXEEHINEMIDQCINELDEYFKGNRKEFTVPLSAEGTAFQKKVWDALYTI
    PYGVSASYLDIAEKVGNTKAVRAIGGANSRNPISIIVP
    CHRVIGKSGKLVGYAGGLWRKEWLLKHEGILK

    >gi|42781267|ref|NP_978514.1| glutathione peroxidase [Bacillus cereus ATCC 10987]
    MTVYDFSAKTITGEEKSLKDYEGKALLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILGFPCNQFGGQEPGTEADITSF
    CELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMKAVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGN
    N

    >gi|42781407|ref|NP_978654.1| thioredoxin family protein [Bacillus cereus ATCC 10987]
    MKEIKSEQEFKDIIASEEPVVVKFFTTWCPDCVRMDNFIGDVMEEFNKFEWYSINKDEFPSIAEEYQVMGIPSLLVYQNG
    EKLGHLHSANAKTEEQVTEFLEAY

    >gi|42781858|ref|NP_979105.1| dihydrolipoamide dehydrogenase [Bacillus cereus ATCC 10987]
    MSKLVVIGGGPAGYVAAITAAQSGKEVTLIDEADLGGTCLNVGCMPTKSLLESAEVHDIVRKANHYGVMLNEGSISVDWK
    QMQARKSQVVTQLVQGIQYLMKKNKIKVIQGKAKFETDHRVRVTHGGKEIVVDGEQFIIAAGSEPTELPFATFDGKWILN
    SSHAMSLENIPKSLLIVGGGVIGCEFASIYSRLGTKVTIVEMAPQLLPGEDEDIAHILRGKLENDGVEIFTGAALKGLNN
    YKKQASFEYEGSTQVVNPEFVLVSVGRKPRVQQLDLEKAGIQYSNKGISVNEHMQTNASHIYAAGDVIGGIQLAHVAFHE
    GTTAALHASGEDVKVNYHAVPRCIYTAPEIASVGLSEKLAREQYGDILIGEFPFSANGKALIIGEQTGKVKVIVEPKYQE
    IVGISIIGPRATELIGQGTVMIHTEVTADIMRDYIAAHPTLSEAIHEALLQAVGHAVHA

    >gi|42781915|ref|NP_979162.1| carboxymuconolactone decarboxylase [Bacillus cereus ATCC 10987]
    MAYIAFFSSHTTIGTYNWNGGNNKMAHEQHSSVNDVLHHYKEGIGSFTNQIPEIAETYNAFTQACFQEGSLTKREKQLIA
    LGISLATQDEY
    CTVYHTKGCLDQGCSDKEILEACGVSAAFAGGAAMSQAVTLVQECLTELKNHKH

    >gi|42782476|ref|NP_979723.1| transcriptional regulator Spx [Bacillus cereus ATCC 10987]
    MVVLYTTASCSSCRKAKAWLEENQIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIDELSLNEFY
    TLIIEHPLMLRRPIMLDEKRLQIGFNEEEIRKFLPRSVRTFLNIELQKLAN

    >gi|42782573|ref|NP_979820.1| hypothetical protein BCE_3522 [Bacillus cereus ATCC 10987]
    MTKNNEAGWNLDNSYATLPHSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKETEIAIFAGNALPEGAHPLAQAYA
    GHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTT
    GEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEDPENRYTALLQEVIKKQASLIAKW
    QLVGFIHGVMNTDNITISGETIDYGPCAFMDHYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEAL
    KIAQDEISKFSVQYENLWFLGMKKKLGLFSNEEQDHSLIEQLLKMMEKYKADYTNTFRSLTLNTLENTPLFDSSEFKEWY
    KLWQSRLERQDESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALANPYAYATDQEEYCVTPAPTNR
    PYRTF
    CGT

    >gi|42782632|ref|NP_979879.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus ATCC 10987]
    MAERYSRQHLFKPIGSRGQEKIRNKHVLIVGVGALGSASAESFVRAGIGKLTIIDRDYVEWSNLQRQQLYSEQDAREKLP
    KAIAAKNRLEKLNAEVQIHAFVMDACVENLEGLLENVDVIIDATDNFDIRFIINDLSQKHNIPWVYGSCVGSYGMSYTII
    PQETPCLHCVLKNVPVTGVT
    CDTAGIISPTVQIVAAYQVAEALKILVEDFAAIRKTFFMFDIWSNQNHFIKLGKIKTDAC
    LSCGLNRTYPYLSYENQTKIAALCGRNTVQIRPVDNRKYNFDDIEKVLKKVGEVDRNPYLLSCQLDEYRIVVFRDGRVFI
    HGTNDISKAKQLYYRVFG

    >gi|42782682|ref|NP_979929.1| ahpC/TSA family protein [Bacillus cereus ATCC 10987]
    MWRKLTIIVVLLCLAGYAAYEQFGKNDQAVQGERTKSEAAMKEMIASNGIEIGKSAPDFELTKLDGTNVKLSDLKGKKVI
    LNFWATW
    CGPCQQEMPDMEAFYKEHKENVEILAINYTPSEKGGGIEKVSNFAKEKGITFPILLDKNIDVTTAYKVITIPT
    SYFIDTKGVIQDKFIGPMTQKEMEKRIAKLK

    >gi|42782808|ref|NP_980055.1| heavy metal-transporting ATPase [Bacillus cereus ATCC 10987]
    MNEQKEANLQISGMTCAACANRIEKGLKKVEGVHDANVNFALEKTKIMYDPQKTNPQQFKEKVESLGYGIVSDKAEFTVS
    GMT
    CAACANRVEKRLNKLEGVNEATVNFALESATVNFNPDEINVNEMKSAITKLGYKLELKSDEQDGSTDHRLQEIERQK
    KKFIVSFILSFPLLWAMVSHFSFTSFIYLPDMLMNPWVQLTLATPVQFIIGGQFYVGAYKALRNKSANMDVLVALGTSAA
    YFYSVYLSIQSIGSSEHMTDLYFETSAVLITLIILGKLFEAKAKGRSSEAIKKLMGLQAKTATVVRDGTEMKILIEEVVA
    GDIVYVKPGEKIPVDGEIVEGKSAIDESMLTGESIPVDKTIGDVVIGSTMNKNGFLKVKATKVGRDTALAQIIKVVEEAQ
    GSKAPIQRVADQISGIFVPVVVGIAIITFAVWMIFVTPGDFGGALEKMIAVLVIACPCALGLATPTSIMAGSGRSAEYGI
    LFKGGEHLEATHRLDTVILDKTGTVTNGKPVLTDVIVADGFHEEEILRLVGAAEKNSEHPLAEAIVDGIKEKKIDIPSSE
    TFEAIPGFGIESVVEGEQLLIGTRRLMKKFNIDIEEVSKSMEELEREGKTAMLIAINKEYAGIVAVADTVKDTSKAAIAR
    LKKMGLDVVMITGDNTQTAQAIAKQVGIDHVIAEVLPEGKAEEVKQLQAQGKKVAMVGDGINDAPALATADIGMAIGTGT
    DVAMEAADITLIRGDLNSIADAIFMSKMTIRNIKQNLFWALAYNGLGIPIAALGFLAPWVAGAAMAFSSVSVVLNALRLQ
    RVKLK

    >gi|42782809|ref|NP_980056.1| copper-ion-binding protein [Bacillus cereus ATCC 10987]
    MEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSVVKLKDIVAVIEDQGYDVQ

    >gi|42782823|ref|NP_980070.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus ATCC 10987]
    MNSYKNDYIYWTLLTHENWQFHIAATENGLCFIGSQDETFEELNIWARKKLPQHILIHSPDYLQVYTKEIIEYLENKRET
    FAFPIDAYGTEFQLSVWNTVREIPYGKTYSYTEIAERIQKSKAVRAVATAIAANPLLITIP
    CHRVIGKNGKLTGFRGGLE
    MKKELLTLEKSQVEFL

    >gi|42783065|ref|NP_980312.1| dihydrolipoamide dehydrogenase [Bacillus cereus ATCC 10987]
    MVVGDFPIELDTVVVGAGPGGYVAAIRAAQLGQKVAIIEKANLGGVCLNVGCIPSKALINAGHRYENAMHSDDMGITAEN
    VKVDFTKVQEWKNGVVKKLTGGVEGLLKGNKVEIIRGEAYFVDANTLRVMTEDAAQTYTFKNAVLATGSTPIEIPGFKYS
    KRVINSTGALSLPEIPKKLVVIGGGYIGMELGTAYANFGTEVTVVEAGDEILAGFEKAMSSVVKRALQKKGNVTIHTKAM
    AKGVEETETGVKVSFEVKGEIQTVEADYVLVTVGRRPNTQEIGLEQVGVKMTDRGIIEIDEQCRTNVPNIYAIGDIVPGP
    PLAHKASYEGKVAVEAISGHASAIDYIGIPAVCFTDPELASVGYTKKQAEEAGMTVTVSKFPFAANGRALSLNSTDGFLQ
    LVTRKEDGLLVGAQVAGAGASDIISEIGLAIEAGMTAEDIAQTIHAHPTLGEITMEAAEVALGMPIHIVK

    >gi|42783084|ref|NP_980331.1| glutaredoxin family protein [Bacillus cereus ATCC 10987]
    MKKIEVYTQPDCPPCVIVKEFLKHNNVVYEEFDVKKDAAARNRLLYDYDSYSTPTVVIDGEVVAGFQIEKLQQLLNIE

    >gi|42783239|ref|NP_980486.1| Na+/H+ antiporter NhaC [Bacillus cereus ATCC 10987]
    MVSKIESVLLTVFIFFCIGFSVIKLEVSPHIPILFGIVLLLAFGFMKKIDWSTMEKGMISSISAGIPSIFIFLLVGVLIS
    VWIAAGTIPTLMVYGFQLVSPKIFIPTVFVV
    CAIVGTSIGSAFTTAATVGLAFMGMGSALGYDPALIAGAIISGAFFGDK
    MSPLSDTTNLAPAVTGVDLFEHIRNMLWTTVPAFIIAFIAFFILGSGTSGDVDFTNFISALEKNATISIFTLIPILLLFL
    FAFKKVPAVPTLLAGIIVGIIILFIFKPSTSLTDLMKIMQDGYVSKTGMKDIDSLLSRGGLQSMMMSIALIFLALCMGGL
    LQGMGIITQLMNIISSFVKTSTRLIISTASTAIGVNFLLGEQYLSIVLTGQAFANKYDEVGLERRNLSRVLEDAGTVINP
    LVPWGVSGVFLSNVLGVPTFDYVPFAIFCLACPVVTIIVGFTGFGLSWKKEKAVTLS

    >gi|42783281|ref|NP_980528.1| dihydrolipoamide dehydrogenase [Bacillus cereus ATCC 10987]
    MAKEYDLVIVGGGTGGYVAAIRASQLGLKTALVEKENLGGTCLHKGCIPSKALLRSAEVYATAKKSEEFGVIASNVELNF
    AKVQERKEKIVTQLHKGVQHLMKQGKIDVFEGIGRILGPSIFSPMPGTISVELASGEENEMLIPKNVLIATGSRPNSLPG
    LELDGEYVMSSDHALKMETLPSSIIIVGGGVIGIEWASMLADFGVEVTVLEYAKTILPLEDQDVSKEMQRLFKKKGIKVV
    TGAKVLPETLVKDNGVTIQAEHNGENKEFKAEKMLVSVGRQANTQNIGLENTDIVVEKGYIQTNEFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIAAVEHIAGKEVTPIDYSMVSKCVYSSPEVASVGLTEQEAKEKGYKLKVGKFSFRAIGKALVYGES
    DGFVKLVVDEETNDILGVHMIGPHVTDMISEAGLARVLDATPWEVAHTIHPHPSLSEAIGEAALAVDGKALHA

    >gi|42783331|ref|NP_980578.1| rhodanese-like domain-containing protein [Bacillus cereus ATCC 10987]
    MSTTWIILLAVIVAFIGYTVWMYFYQKKLITTLSEEEFRAGYRKAQLIDIREADEYTAGHILGARNIPLSQIRLRHKELR
    KDQPVYLY
    CQSGFRTGRAAQYLKKQGYKDFYQLQGGFKTWTGKIKKK

    >gi|42783605|ref|NP_980852.1| organic hydroperoxide resistance protein [Bacillus cereus ATCC 10987]
    MDKLYTASVTATGGRNGKVVSDDGILNLDVKMPKALGGAGGEATNPEQLFAAGYAACFDSALQLVIRTKRVKVESTEVTA
    HVSIGKDTDGGFGLSAVLDVHVAGVSHSEAQELVEAAHGV
    CPYSKATRGNIEVTLNVR

    >gi|42783694|ref|NP_980941.1| thioredoxin [Bacillus cereus ATCC 10987]
    MAIVNANDQSFAAETSEGVVLLDFWAPWCGPCKMIAPVLEEIDAELGEKVKVVKVDVDENQETARQFEVMSIPALFVLKD
    GKVVDQALGYKPKEALVELVSKHF

    >gi|42783821|ref|NP_981068.1| thiol peroxidase [Bacillus cereus ATCC 10987]
    MANVTFKGNPMTLVGTEVKVGDQAPNFQVLANDLSPVSLETYKGEVKLISVVPSIDTGVCDAQTRRFNQDAAGIENAKVL
    TISVDLPFAQKRWCAANGLENVVTLSDHRDLSFGEAYGLVMKELRLLARAVFVVDSNDKVVYVEYVSEGTSHPNYEAALE
    AAKAAK

    >gi|42783882|ref|NP_981129.1| thioredoxin family protein [Bacillus cereus ATCC 10987]
    MKSLESMEQFQELKNEENVIFMFSAEWCPDCRFVDPFMPEVEEKYSDFSFYYVDRDEFIDLCVKLDVFGIPSFVAYNKGE
    ETGRYVNKDRKTQEXIEEFIEGLK

    >gi|42783896|ref|NP_981143.1| hypothetical protein BCE_4850 [Bacillus cereus ATCC 10987]
    MHYDVIVIGGGPSGLMAAIGAAEEGASVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNN
    EDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVVLQTGEVLETNHVV
    IAVGGKSVPQTGSTGDGYAWAEKAGHTITELFPTEVPILSNEPFIRDRSLQGLALRDVNLSVLNPKGKAIISHKMDMLFT
    HFGLSGPAALRCSQFVVKALKKFKTNTVQMSIDALPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLEKNE
    IDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYN
    ITSALVTGRIAGTTAGENAKMKY

    >gi|42783912|ref|NP_981159.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus ATCC 10987]
    MQERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKITIADRDYVEWSNLQRQQLYTEEDATQYKP
    KAVAAAEHLKAINSEVEINPVVTDVTVQEMEELVNGVDLILDATDNFETRLLINDISQKYNIPWIYGGCVGSYGVTYTIV
    PGKTPCFRCLMEHPASGAT
    CDTAGIIQPAVQLVVAHQITEALKILVEDYGALRETMLSFDLWNNQQMAFKVNRQKKETCL
    SCGRLRTYPSLTFEAQTKTEVLCGRNTVQIRPGMRNEFNLEEIKKRLQRSVDVKATPYLVSFLVEEFRFVLFTDGRAFIH
    GTNDINVAKRLYARYIG

    >gi|42783917|ref|NP_981164.1| rhodanese-like domain-containing protein [Bacillus cereus ATCC 10987]
    MTEVKTITTEEVQERLEKGETLFLVDVREDEEVAAGKIPEAVHIKMGDIPNKVDFFDKENEYIFICRSGMRSENVCHYLN
    EQGFKTVNMVGGMLQYEGETK

    >gi|42783967|ref|NP_981214.1| hypothetical protein BCE_4921 [Bacillus cereus ATCC 10987]
    MYVTVTEAAYKKIVDTIPNEAKYIKLFYDNEGCGCVMSGIIDLVAVAEKDERDVDIESSKFSFIADRTKLVFMDDKLTVD
    WHEGGGTFQLKSPSQFYNPNMKLHVRV

    >gi|42784119|ref|NP_981366.1| hesB/yadR/yfhF family protein [Bacillus cereus ATCC 10987]
    MYNRMRTERMVYFMIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEVEPNEDDTVLEFFGVEFVIDKE
    SAPIVKGVKIDYKQSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC

    >gi|42784122|ref|NP_981369.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus ATCC 10987]
    MKHLVILGGGYGGMRILQRLLPSNQLPDDVQVTLIDKVPYHCFKTEYYALVAGTISETHIRIPFPEHPRLNIQYGTVTNI
    DLEEKAVHLDGGEAIQYDDLIIGLGCEDKYHNVPGAKEYTHSLQSIEQTRKTYEQLNSLEPNATVAVVGAGLSGVEVASE
    LRESRSDLKIYLFDRKDRILFPYPEKLSRYVEEWFVKHKVTIIRNSNITKVEPNIVYNHDEPLECDAIVWTAGIQANEVV
    RNLPVEQDGSGRVVLTKYHNIPNNEHVYVVGDCAALPHAPSAQLAEGQGEQIVQILLKRWNNEPLPDELPVIKLKGVLGS
    LGKKHGFGLLANQPLMGRVPRLLKSGILWMYKYHNG

    >gi|42784173|ref|NP_981420.1| thioredoxin, putative [Bacillus cereus ATCC 10987]
    MIEVIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEGLKIGMLDLNYAPHFAKEYGIESVPCLLVFE
    NGTLMKKIYAFHSVEYLYTELK

    >gi|42784177|ref|NP_981424.1| hypothetical protein BCE_5131 [Bacillus cereus ATCC 10987]
    MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASED
    EMYELLASDGMLIKRPIVTDGTKVTLGFNEEQFESVWKKYQ

    >gi|42784290|ref|NP_981537.1| glutaredoxin family protein [Bacillus cereus ATCC 10987]
    MKVVLYTKNDCGLCVKAKQVLQEVQCEYSFQIEEIDIYEDNDLLEKYHLMIPVVEIDGKQVEYGNIHKGVIINYIKNAVK
    S

    >gi|42784308|ref|NP_981555.1| thioredoxin reductase [Bacillus cereus ATCC 10987]
    MSEEKIYDVIIIGAGPAGMTAAVYTSRANLSTLMLERGIPGGQMANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYA
    YGDVKEVIDGKEYKTIIAGKKEYKARAIIVASGAEYKKIGVPGETELGGRGVSY
    CAVCDGAFFKGKELVVIGGGDSAVEE
    GVFLTRFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEANGKVGSVTLVDVNSGEEKEVKTDGVFVYIG
    MLPLSKPFVELGITNENGYLETNERMETKVPGIFAAGDVREKMLRQIVTATGDGSIAAQSAQHYVEELLEELKTVSEK

    >gi|42784614|ref|NP_981861.1| bifunctional methionine sulfoxide reductase A/B protein [Bacillus cereus ATCC 10987]
    MAVNEKVELATFAGGCFWCMVSPFEEMEGIIKVVSGYTGGHKENPTYKEVCSETTGHYEAVQITFDANKMPYEELLNIYW
    RQIDPTDVGGQFHDRGQSYETVIFYHNEEQHKKAEASKEGLARSGRFSKPIATKILPAATFYPAEEYHQGYHKKNEFRYE
    LYRKGSGRDAFIKQHWPKDNAHLKEKLNEMQFYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSLDKFDSGCGWP
    SFTKPVMSASVKEKMDVSHNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRY
    CINSAALRFIPKEELEKEGYGDFLILFGNK
    K

    >gi|44004353|ref|NP_982021.1| hypothetical protein BCE_A0014 [Bacillus cereus ATCC 10987]
    MKKIYKIGAVITTLCVIGITIFTLTKNESVKTEIVTPEKTIVSAADVKGSPENIKDISKEELKQKIQSHKEFIAYYYQPT
    CHYCKKAAPDINRMSKKHDRTIYRIDISTPENQSAFQEFDIPGTPVIVAYNRGEEVERLEGAVSAATYDGFFARRNSSAS


    >gi|44004494|ref|NP_982162.1| HesB-like domain-containing protein [Bacillus cereus ATCC 10987]
    MNITDKAKEFIENAMKENGVSTLRFTFEGAGCCGPSYGINLGEAEESDITETVNGVQVAMDPKVAEIVNTLTLDYVEDQQ
    GAGLVISGGSNCC

    >gi|44004520|ref|NP_982188.1| copper ion binding protein [Bacillus cereus ATCC 10987]
    MTITLNVQGMTCNHCKMSVTNALTELEGVQNVEVHLQEGTVNVEYDDTKVDVEKMKEVIEDQGYDVI

    >gi|44004521|ref|NP_982189.1| copper-translocating P-type ATPase [Bacillus cereus ATCC 10987]
    MDKQKHVTLGVTGMTCAACATRIEKVLNKMDGVDANVNLAMEKASIKYDPSQQEISNIKNKIENLGYNVAEEKITLDIEG
    MT
    CAACATRIEKVLNKMEGVSNATVNLATNSAVVEYNEGLISTENILEKIKKTGYKGQIRSEDVDRSERKEEVIKAKKRQ
    LIISIILSLPLLYTMIGHMPFDTGIPMPHILMNPWFQLLLATPVQFYIGGHFYVGAYRALRNKSANMDVLVALGTSAAYF
    YSLYEALKTLGNANYSPDLYFETSAVLITLILVGKYFETLAKGRTTEAISKLLSLQAKDALVVRDGQEIRVPLEEVVIGD
    TIIVKPGEKIPVDGIVTSGVSSVDESMITGESIPVDKKEGDAVIGATINANGVLTIKAEKVGKDTALAGIIKIVEEAQGS
    KAPIQRLADIISGIFVPIVVAIAVVAFIVWYFFITPGDLPNALEVGIAILVIACPCALGLATPTSIMVGTGKGAEKGILF
    KGGEFLEGTHKINAVLLDKTGTVTKGKPEVTDVLEFEEGMLDYAISAESASEHPLAHAIVEYGKQQGINLKDLAQFSAIP
    GHGIEANIEDKKVLVGTRKLMNEQSIEISQHEEVMKDLEYQGKTAMLVAIDGKLAGIIAVADTVKESSKAAIQTLKEIGI
    EVYMVTGDNKRTADAIAKLVDLDHVYAEVLPEDKAKIVEDLQKQGKRVAMVGDGINDAPALAKADIGMAIGTGADVAIET
    ADVTLVGGDLSHIPKAIELSRKTMKNIRQNLFWALFYNAIGIPVAAAGLLEPWVAGAAMAFSSVSVVTNALRLKRVKI

    >gi|44004529|ref|NP_982197.1| cytochrome c biogenesis protein, putative [Bacillus cereus ATCC 10987]
    MYKGGILLKIRIVAILAVVLILGFKFLSPTSETPKAQAPQSINTDKKSVSTFSVGLEKDQQAPEFTLSTLTGESVKLSSL
    RGKTVILNFWTTW
    CPPCKSEMPDMQQFYSDYKKNNIIIIGVNLTDNESNTKQVKDFTKQYKISFPILLDTKGEIRKQYKI
    ITIPTTYIIDSNGIIAENVIGPITYDKIKKLTLNSANIKKG

    >gi|44004543|ref|NP_982212.1| thioredoxin, putative [Bacillus cereus ATCC 10987]
    MLKEINLTELEQQISVISKPILLKFTAEWCPGCRQLAPVVESVSEQFGNQIVFFDVNVDKEIDLAKKFGVMSIPTLVLLK
    NGKEVDRVTAPAPNEDVIVSFIKNNYNA