Rickettsia akari Hartford uid58161

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|157825127|ref|YP_001492847.1| thioredoxin [Rickettsia akari str. Hartford]
    MIYSINYFNMFIGSRDQVAGLQQKSIITQHIEDKMANNVTDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKE
    LKGKVKVLKMNIDENPNISSEYGIRSIPTIMLFKNGEQKDTKIGLQQKNSLLDWINKSV

    >gi|157825169|ref|YP_001492889.1| protein-disulfide isomerase [Rickettsia akari str. Hartford]
    MPIFLLFLSSCSEEKTQHKHQEEKQMIEQENLQNNDTSQEMNQGAVNSENAAESIVPANDNNQTDEVSTPASQAQKNPEI
    KPVKVTFEVDVNDMVLGNKKSNVIDEVSTPASQAQKNPEIKPVKVTFEVDVNDMVLGNKKSNVIVVEYFSPT
    CPHCAYYH
    QTIFPELKKKYIDTNKIAYVVREFIATKQDLDAAILARCKGDINSFVQFHNIILQQQDKWAYSNKYRELLTDIGQLGGVP
    PEEYKQCLNSDKITETLIANTNFVAKAPKFIGTPSFFVNGVQTGNYSIDSISTAVDKALEEQKEKAKNEMSL

    >gi|157825220|ref|YP_001492940.1| Iron-sulfur cluster assembly accessory protein [Rickettsia akari str. Hartford]
    MTITITDRAFQRVCELIELEKDKHLVLRVSVDSGGCSGLMYNYELVSKDDIDQDDYVITKHNATIIVDPISQKFMLDCTL
    DFIEELGSSYFNVSNPQAKLKCGCGNSFSV

    >gi|157825405|ref|YP_001493125.1| glutaredoxin 3 [Rickettsia akari str. Hartford]
    MNKAILHTIIIYTLVSCPYCIKAKALLDEQNIAYEEIEVSNLTQAEKEKFIKKSGGKGTVPQIFIDNMHVGGCDDLFDLE
    KEGRLDKLLEGQPKKSI

    >gi|157825578|ref|YP_001493298.1| thioredoxin peroxidase 1 [Rickettsia akari str. Hartford]
    MSVFVGKTAPDFTAKAIMPNNNIDEKFKLSDYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVDSH
    FSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDCFALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVIDA
    LTHHQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL

    >gi|157825672|ref|YP_001493392.1| thiol:disulfide interchange protein tlpA [Rickettsia akari str. Hartford]
    MTSRNCNKYLIYIIVFLLSIIIFIPKIHAKLYEKPKDKLEFLKGSSVPDNIIFFDEEKNQYSLDQFEGKTILLVFWATWS
    AH
    CVKEMPDLDTLQKDFRKLPFSVVPISEDYQDIKVIKEYFKSYQIRYLPIYHDYRNELFKALGVVSLPTSILIDPNGKI
    ITSFVGNTNWYDEKVRDTILSAIPGNYPEPKNSYNEQSLNKSAKPLPPIKKDIIKNEQNNE

    >gi|157825716|ref|YP_001493436.1| Thiol:disulfide interchange protein DsbA [Rickettsia akari str. Hartford]
    MQNIIGKILVIFVFVIGVLFVFKTMKTYSTNPVSVEVKQSEDARKCEEERVQEIIKDYLLKTPEIIIESIEGLQKRKVQE
    NETKVNNYLKDHKLGIEDSTSFPIIGNKDGDVVIIAFYDYN
    CSYCKKGDIFINELLQNDPKVKVILRPLPILGDASEYLA
    RIVLSVYKVNPSKFKAVHDELINIRDVSNESIKELLTENGLNAMEIEEIADSNEIKDFITQNMKIARSLRIQGVPAYIID
    SKLIPGLIDFPQLLNIVKEIRDAR

    >gi|157825741|ref|YP_001493461.1| thioredoxin reductase [Rickettsia akari str. Hartford]
    MKITTKVLIIGSGPAGLSAAIYTARAALKPILINGMRPGGQLTITTNVENYPGFVETVQGPWLMEQMSMQAQNVGTEIIS
    DYVEKVDLSKRPFKVFTGSGNEYEAESIIICTGAEAKWLGIASEQDFMGFGVSA
    CATCDGFFFKNQEIVVVGGGNSAVEE
    ALYLTNHASKVTIVHRRDSFRAEQILQDRLFKNPKISVIWDHVVDEIVGRNKPKSVTGVKIQNVHTKEISLLNCSGVFIA
    IGHVPNTGLFTGQIAMDDDNYIITESGTTKTNVEGVFAAGDVQDKIYRQAVTAAGTGCMAALEAEKFLNK

    >gi|157825765|ref|YP_001493485.1| thioredoxin reductase [Rickettsia akari str. Hartford]
    MHNTDVIIIGAGPVGLFTIFQAGMLGMKCHVIDAQETVGGQCITLYPEKPIYDIPAYPKIAAEELIKQLEFQAAPFKPVY
    HLNQHATDLNKQGDFFEIRTSKNTIIKSKAIIIAAGAGSFGPNKPPLANIEDFEGKSVFYFINNKSKFAGKNIVIAGGGD
    SAVDWAISLSEIANKIYLVHRRDKFTAAPESVRQLRDIAETGKIELVTGYQLNALDGNNGTLQTVIVKDLQNNIRKLDAN
    VLLPFFGLKQDLGSLANWGLDVKLHHIEVDNSYYQTNIEGIYAIGDIAHYAGKLKLILTGFAEAASSIHHAYIRVFNGQA
    LHFEYSTTKYGERK

    >gi|157825798|ref|YP_001493518.1| glutathione S-transferase [Rickettsia akari str. Hartford]
    MKKLYYYPICPLSRQARVFLKELDIEFTTIKEDYWQFNKGFLKINPAGTLPILKEPYGLFVVGIYPFIEYLNSKYPNFNF
    LDENIDICCEMRRLFFWFNDKFYREVTKIIIDEKVIRSIAKMSSPRTEFLRAAKNNLNYHLEYITSLLEKRSYLVSDSLT
    IADIAASCHLSVLDYFGEIYWDKWTLIKHWYSLIKSRPTFRLLLQDRIPGFTPPSYYTDLDF

    >gi|157825851|ref|YP_001493571.1| Iron-sulfur cluster assembly accessory protein [Rickettsia akari str. Hartford]
    MKNVISLTDSAAKQVKLLIEKRDKPTFGVRVGVKSGGCAGQTYYVEYADSKNQFDEVVEEKGVRILIDPKALMYILGSEI
    DYVETKFKSQFTFTNPNEKAGCGCGKSFSV

    >gi|157825888|ref|YP_001493608.1| dihydrolipoamide dehydrogenase [Rickettsia akari str. Hartford]
    MQEFDLVVIGSGPAGYTGSIRAAQLGMKVVCVEKNDTLGGTCLNIGCIPSKALLNSSEKYEEALKHFESIGITADVKLDL
    QKMIANKDKVVSDLTKGIESLFAKNKITRIKGEAKIIASNIVEVNNEQIKAKNILITTGSSVIEIPNIKIDEEFIVSSTG
    ALKLSKVPETLIVVGGGYIGLELGSVWRRLGAKVTVIEYAPSIVPMLDKEIATQFMKLQQKQGIEFKLNTRVLSAEVKSG
    KVNLTIEEGGKSAVVTSDVILMAVGRKAYTQNLGLESVGIITDKQGRIEINDRFQTAISNIYAVGDVVKGAMLAHKAEEE
    AVAAVEIMAGQAGHVNYNLIPSVIYTYPEVASVGETEEQLKAKGINYKVGKFPFLANSRARAIGSTEGLVKILADSKTDR
    VLGAHIIGANAGTLIAELTAYMEFGAASEDIARTCHAHPTLSEAIKEAALSVDKRSINM

    >gi|157826136|ref|YP_001493856.1| bacterioferritin comigratory protein [Rickettsia akari str. Hartford]
    MTLELGKKVPDLSLHIGKDKVIKLSDLKGKFIVLYFYPKDDTPGCTIEAQDFNKLKPEFDKLNTVIIGVSKDKLDSHDKF
    KEKYSLGFDLASDANSNLCEQLGVWVEKSMFGKKYMGIDRATFLLDNEGIVKHIWSAVNAKNHAQEVLETLRTILS

    >gi|157826171|ref|YP_001493891.1| glutaredoxin-like protein grla [Rickettsia akari str. Hartford]
    MLENKNFEFIENALKNNKVVLFMKGTQEAPMCGFSAKVVAILNKLGVEFRDINVFVNPEFREDLKKFSDWPTFPQLYIKG
    ALVGGCDIATELYNNGELEKILRE

    >gi|157826261|ref|YP_001493981.1| dihydrolipoamide dehydrogenase [Rickettsia akari str. Hartford]
    MEQYDVAVIGGGPSGYVAAIRAAQLRKKVVLIEKEHLGGVCLNWGCIPTKSLLKSAEVFEYTKHAKDYGIDSEGAEINIK
    KIVERSREISNKLAGGVKLLLKKNKVTVIDGVASLAGNKVVNINNKSTVKAENIIIATGARSRVLKGFEPDSKQIWTSKE
    AMIPRHVPKSMIIVGSGAIGIEFASFYNSIGVDVTVIEAHNRILPAEDTEISGIAHKNFEKKGIKIITNAKLIKQTKSKD
    KIEVELELSSKTQKLQAEILLMAVGITANTESLGLEKTKVKVENGYIVTNGLMQTAELGIYAIGDVAGVPCLAHKASHEG
    IIAAESIAGLKPYAINKHNIPGCTYSSPQIASVGLTEEAAKALGYELKIGKFPFMANGKALVIGDSDGLIKTIFDAKTGE
    LLGAHMIGLEVTELIQGYVVSKNLEATELDLINTIFPHPTLSEMMHESVLAAYDRVVHV