Rickettsia africae ESF 5 uid58799

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|229586232|ref|YP_002844733.1| Thioredoxin [Rickettsia africae ESF-5]
    MANNVMDSSFKKEVLESDLPVLVDFWAEWCGPCKMLTPIIDEISKELQGKVKVLKMNIDENPNTPSEYGIRSIPTIMLFK
    NGEQKDTKIGLQQKNSLLDWINKSI

    >gi|229586255|ref|YP_002844756.1| Protein-disulfide isomerase [Rickettsia africae ESF-5]
    MRNIFIILIFLLFLSSCSEEKAQDKNHEEKQIIEHETQNNETSKATNQEAVNSENTAESIVPANDNNQTDEVSTPASQKQ
    KNPAIKPVKVTFKVDDNDMVLGNKKSNVIVVEYFSPT
    CPHCAYYHQTIFPELKKKYIDTNKIAYVVREFIATKQDLDAAI
    LARCKGDTNSFTQLHNIILIQQDKWAYSNKYRELLTDIGQLGGISPEEYKQCLNNDKITAILIANTNFVAKAPQFIGTPS
    FFVNGVQTGSYSIDTISTAVDKALEEQKEKAKNEMSL

    >gi|229586304|ref|YP_002844805.1| Iron-sulfur cluster assembly accessory protein [Rickettsia africae ESF-5]
    MTITITDRAFERVCELVKLEKDKNLVLRISVDSGGCSGLMYNYELVSKDNIEQDDYVITKHNATIIIDPISQKFMLDCTL
    DFIEELGSSYFNVSNPQAKAKCGCGNSFSV

    >gi|229586448|ref|YP_002844949.1| Glutaredoxin, GrxC family [Rickettsia africae ESF-5]
    MNKAILHTIIVYTLSSCPYCIKAKALLDEKNVAYEEIEVSNFTREEKEKFIKKSGGKKTVPQIFIDNMHVGGCDALFDLE
    KEGRLDKLLENQPKTTSPAAGA

    >gi|229586594|ref|YP_002845095.1| Thioredoxin peroxidase 1 [Rickettsia africae ESF-5]
    MNMSVFVGKTAPDFTAKAIMPNNNIDDKFKLSNYAAGDNIVLFFYPLDFTFVCPSEIIAFHNKLGEFTERRTKVVAVSVD
    SHFSHLAWKNTPHNKGGLGQVQFPMVSDIKKDISSKYNVLNEDGVALRGTFLIDKDFIVRHMLVNDLPIGRDINYTLKVI
    DALTHHQKHGEVCPAGWHKGEEAITPSHEGIAHYLSSHAEKL

    >gi|229586669|ref|YP_002845170.1| Thiol:disulfide interchange protein tlpA [Rickettsia africae ESF-5]
    MTLRNYNKYLIYIIVFLLSIIIFIPKIHARPYEQPKDKLAFLRGSSVPDNIIFFDEEKNQYSLDQFEGKTILLVFWATWS
    AP
    CVKEMPDLDMLQKDFRKLPFSVIPISEDYQDIKVVKEYFKSYQIRYLPIYHDYRNELFKALWVVSLPTSILIDPNGKI
    VTSFVGNTNWYDEKVRGTILSAISGNYPEPKNSYNAQSLNKPAKPLLPIKKDAL

    >gi|229586709|ref|YP_002845210.1| Thiol:disulfide interchange protein dsbA [Rickettsia africae ESF-5]
    MQHIIGKILVIFIVIIGVLFVFKTMKTYSTNPVSVEVKQSEDARKCEEERVQEIIKDYLLKTPEIIIESIEGLQKRKVQE
    NETKVNNYIKDNKLSIEDSTSFPVIGNKDGDVTIIAFYDYN
    CSYCKKGDVSINELLQNDPKVKVVLRPLPILGDVSEYLA
    RIVLAVYKVNPSKFKAVHDELIKIRDVSKESIKELLTENGLNATEIEEIADSNQIKDLITQNMKIARSLRIQGVPAYIID
    SKLIPGLIDFPQLLNIVKEIRGN

    >gi|229586727|ref|YP_002845228.1| Thioredoxin reductase [Rickettsia africae ESF-5]
    MKITTKVLIIGSGPAGLSAAIYTARAALKPILINGMQPGGQLTSTTDVENYPGFAETVQGPWLMEQMYMQAKNVGTEIVS
    DYVEKVDLSKRPFKVFTGAGNEYDAESIIICTGAEAKWLGIASEQKFRGFGVSA
    CATCDGFFFKNQEIVVVGGGNSAVEE
    ALYLTNHANKVTIVHRRDSFRAEKILQDRLFKNSKISVIWDHVVDEIVGSNKPKSVTGVKIQNVHTKEISLLNCSGVFIA
    IGHAPNTGLFTGQIVMDDDNYIITKSGTTRTSVEGVFAAGDVQDKIYRQAVTAAGTGCMAALEAEKFLNK

    >gi|229586742|ref|YP_002845243.1| Thioredoxin reductase [Rickettsia africae ESF-5]
    MYNTDVVIIGAGPVGLFAVFQAGMLGMKCHVIDAQEVIGGQCITLYPEKPIYDIPAYPKIAAEELIKQLALQAAPFNPIY
    HLNQQAIELNKQDDFFEIKTSKNTLIKSKVIIIAAGAGSFGPNKPSLANIEDFESKSVFYFINDKSKFAGKNIVIAGGGD
    SAVDWAIALSDIANKIYLVHRRDKFTAAPESVRQLRHIAETDKIELITGYQLNALDGNNSELQSVIVKDLQNNTRKLDAN
    ILLPFFGLKQDLGSLANWGLNVKLHHIEVDSSYYQTNIEGIYAIGDIAHYVGKLKLILTGFAEAASSLHHAYSRVFDGKA
    LHFEYSTTKNTGKRSKSVTK

    >gi|229586769|ref|YP_002845270.1| Glutathione S-transferase [Rickettsia africae ESF-5]
    MKKLYHNPICPLSRQARVFLKELDIEFTTIKEDYWQFNKDFLKINPAGTLPILAESYGLFVVGIYPFVEYLNGKYPNFNF
    LDEDIDICCEIRRLFFWFNDKFYREVTKIIINEKVIRSIAKMSSPRTEFLRVAKNNLNYHLEYITFLLEKRSYLVSESLT
    IADIAASCHLSVLDYFGEIYWDKWTLIKHWYSLIKSRPAFRLLLQDRIPGFTPPNYYTDLDF

    >gi|229586812|ref|YP_002845313.1| Iron-sulfur cluster assembly accessory protein [Rickettsia africae ESF-5]
    MKNVISLTDSAAKQVKLLIEKRAKPTFGIRVGVKSGGCAGQTYYVEYADSKNQFDEVVEEKGVRILIDPKALMYILGSEM
    DYVETKFKSQFTFTNPNEKANCGCGKSFSV

    >gi|229586840|ref|YP_002845341.1| dihydrolipoamide dehydrogenase [Rickettsia africae ESF-5]
    MQEFDLVVIGSGPAGYTGSIRAAQLGMKVACIEKSDTLGGTCLNIGCIPSKVLLNSSEKYEAALKHFENIGIIADVKLDL
    QKMLANKDKVVLDLTQGIESLFAKNKVTRIKGEAKISSSNIVEVNKEQIKAKNILITTGSSIIEIPNIKIDEEFIVSSTG
    ALKLSKVPENLIVVGGGYIGLELGSVWRRLGAKVTVIEYAPSIVPMLDKEIATQFMKLQQKQGIEFKLNTKVLSAEVKSG
    KVNLTIEEDGKSSVVTSDVVLMAVGRKAYTQNLGLESVGIITDKQGSIEINDRFQTAISNIYAVGDVVKGAMLAHKAEEE
    AVAAVEIMAGQAGHVNYNLIPSVIYTYPEVASVGETEEQLKEKGINYKVGKFPFLANSRARAIGSTEGMVKILADSKTDR
    VLGAHIIGADAGTLIAALTAYMEFGAASEDIARTCHAHPTLSEAIKEAALSVDKRTINM

    >gi|229586908|ref|YP_002845409.1| Methylated-DNA--protein-cysteine methyltransferase [Rickettsia africae ESF-5]
    MSLKSAWLDTPLGSMLAISDTERLYLLDFVESKGLEYKIKRLKINTKSAITEDRTRPIISIEEELQSYFSGTLQKFNTPI
    YLLGSEFQKLVWQELMNVPYGETRSYFTQAKLIGMERSYRAVANANGANKFVIIIP
    CHRIINNNGKLGGYGAGLDRKKWL
    IEHERQKY

    >gi|229587069|ref|YP_002845570.1| Bacterioferritin comigratory protein [Rickettsia africae ESF-5]
    MTLELGKKLPDLSLHIGQDNVIKLSDLKGKFVILYFYPKNDTPGCTIEAQDFNKLKPEFDKLNTVIIGVSKDKLDSHDKF
    KEKYSLGFDLASDANSNLCEQLGVWIEKSMFGKKYMGIDRATFLLDKEGIVKHIWRSVNAKNHAQEVLEKLRTMLS

    >gi|229587103|ref|YP_002845604.1| Glutaredoxin-like protein grla [Rickettsia africae ESF-5]
    MGLFLLKISKILLTICACIYCYRKCILEDKLLSLKMLENKNFKFIENEIKNNKVVLFMKGIKKSPACGFSGTVVAILNKL
    GVEFRDINVLFDAELREDLKKFSDWPTFPQLYINGELVGGCDIARELYQSGELEKMLKVYTR

    >gi|229587167|ref|YP_002845668.1| dihydrolipoamide dehydrogenase [Rickettsia africae ESF-5]
    MEQYDVAVIGGGPGGYVAAIRAAQLKKKVVLIEKEHLGGVCLNWGCIPTKSLLKSAEVFEYIKHAKDYGIDAKGAEINIK
    KIVERSREISNKLAGGVKLLLKKNKVTVIDGVASLAENKVININDKPTVKAGNIIIATGARSRVLKGFKPDGKQIWTSKE
    AMIPQHVPKSMIIVGSGAIGIEFASFYNSIGVDITVIEAHNRILPAEDMEISGIAHKNFEKKGIKIITNAKLIKQTKSKD
    KIEVELELADKTQKLQAEILLMAVGITANTENLGLEKTKIKVENGYITTNGLMQTAASGIYAIGDVAGVPCLAHKASHEG
    IIAAESIAGLKPHTINKHNIPGCTYSSPQIASVGLTEEAATTLGYELKIGRFPFIANGKALVSGDSDGLIKTIFDAKTGE
    LLGAHMIGSEVTELIQGYVISKNLEGTELDLINTIFPHPTLSEMMHESVFSAYDRAIHI