Rhodothermus marinus DSM 4252

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|268315613|ref|YP_003289332.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodothermus marinus DSM 4252]
    MMRLHTRLWLVGLLGLAFMLPGPEKELEIGAKAPLVDLKMRDVSGKMLSLKDVAGENGLLVIFSCNTCPWVAAWEDRYLI
    VAQKAKELGIGMIAVNPNEAYRDRGDGFEDMQRRAKEKGYTFPYVLDEGSKLADAFGATRTPHVFLFNKDLVLVYRGAID
    DNARNPEAVKHHYLLDAMEALAAGKPIPVATTRSIGCTIKRVES

    >gi|268315674|ref|YP_003289393.1| alkylhydroperoxidase like protein, AhpD family [Rhodothermus marinus DSM 4252]
    MERCEAIRQTVQQKFGFVPQLFEELLRTNPAVAEAYLQAGAALQQGVLSPPEQQIVQLTVAAWNACHYCTAAHGTAALGM
    GLSPETVDAILEGRLPEDERLALLVEATRAVLERRGWLDEDALQKLEARGLDRAALYEIIALIGVKTITNYINHLAHTPV
    DEVFRPVTERTAYRRLVESTTV

    >gi|268315755|ref|YP_003289474.1| thioredoxin [Rhodothermus marinus DSM 4252]
    MGENVKYVTLTDDNFEQEVLQSDVPVLVDFWAVWCGPCRMIAPIIEELAAEYEGRAKVGKLDVDHNPRTAMQYGIRSIPT
    LLFFKNGQVVDQLIGAVPKKVLVEKLEALVSAEAA

    >gi|268315756|ref|YP_003289475.1| thioredoxin reductase [Rhodothermus marinus DSM 4252]
    MTQPDLSAFEGIDFEGAEHHTLVIIGTGPAGLTAALYAARANLAPVVFRGPEPGGQLITTTEVENYPGFPEGILGPELMQ
    RFEQQAARFGADLRYGTVTAVDFSRRPFRLLVDDQTPVLADAVIIATGASAKYLGLENERRLIGRGVSA
    CATCDGAFFRG
    MEVAVVGGGDTAMEEALFLTRFATRVYVIHRRDQLRASKIMQERAFKNEKITFIWNTVVEDVLGENEVEGVRLRNVKTGE
    VSVLPVKGLFIAIGHKPNTEVFRGWLEMDEQGYIKTKNCSTHTNIPGVFACGDVQDRVYRQAVTAAGSGCMAAIDAERWL
    AEQEHAAASTTVAG

    >gi|268315763|ref|YP_003289482.1| Rhodanese domain protein [Rhodothermus marinus DSM 4252]
    MAFTTLIDPETLQAHLDDPDWVVVDCRFSLSDPAYGRRAYQDAHIPGAVYAHLDEDLSGPIVPGRTGRHPLPDPEQLARK
    LGAWGIDNRTQVVAYDDAGGAFAARLWWLLGWLGHEAVAVLDGGWPRWVREGRPVRSGVETRPARTFVPRLRPERAVSAD
    EVLRHLHDPAWRLLDARAPARYRGEQEPIDPVAGHIPGAVNAPFAENLTPEGTFRPPEQLRQRFEALLGNVPPERVICY
    C
    GSGVTAAHNLLSMAHAGLPGARLYAGSWSEWIADPRRPVARGAAP

    >gi|268315837|ref|YP_003289556.1| Rhodanese domain protein [Rhodothermus marinus DSM 4252]
    MAAMKTRILLLLALLSGPAACTTERTEAPQTTTTAVADTTAIVRLTAEEFLARYTPDAVVIDVRTPEEFAQGHLKGALNI
    NVQAPDFREQIQARGLDPNRPVYLY
    CRSGRRSQRAAEILREMGFRQLYNIGGFEDLARAGAEVAR

    >gi|268315838|ref|YP_003289557.1| Rhodanese domain protein [Rhodothermus marinus DSM 4252]
    MWTHLLRLLTRPAETHDVLRPEVFLHRRRPEDVVIDVRTPEEFAQGHLEGAINLDLMASDFHEKVARLDPNRTYYLYCRS
    GNRSGQAARLLRKRGLEAYNIGGLEDLARAGATIVR

    >gi|268315840|ref|YP_003289559.1| thioredoxin [Rhodothermus marinus DSM 4252]
    MTLPEFFQKEVIEKSHEKPVVVDFWAPWCGPCRILGPVLEKLARESKGAWRLVKVNTDQHPELAMHYGVRGIPTVKLFRN
    GEVVDEFVGALPEPAVRRWLQQHVPEPSAS

    >gi|268315842|ref|YP_003289561.1| beta-lactamase domain protein [Rhodothermus marinus DSM 4252]
    MLFRQIFDPKLAQYAYLIGCQQTKEAIVIDPERDVDQYLRLAEEEGLRIVAVAETHIHADFLSGARELAERVGARLYLSA
    EGEADGWASNWAKNGRYDVTFLRDGDTFRIGNIEFKAVHTPGHTPEHLCYLVTDRGGGATEPMGLVTGDFVFVGDLGRPD
    LLESAARISGMKEPSARRLYQSVLRFLELPDYLQVWPGHGAGSACGKALGAVPESTVGYEKRFNASLAPAREGEDAFVQA
    ILSGQPEPPLYYARMKAYNRDGVPLLGRLPAPRRLSVAELDRLVKQGEVTFVDTRLDRMAFMLAHLPGALYAPFNRSFNT
    TVGSLVADDQTPLVLIIDDEDVEQAVRDLVRIGYDRIEAYATPETLVRYFNEGGARASIPTITFEDVVRLREQPDVAVLD
    VRYASEYEAGHIPGAINASYTRLPEYLDRIPKDRTLLVH
    CVTGGRSAAAASFLAAQGYRVQYVADDFATYQQIGPVESGQ
    PVTA

    >gi|268315844|ref|YP_003289563.1| protein of unknown function DUF395 YeeE/YedE [Rhodothermus marinus DSM 4252]
    MLEWLSQPWPWYVAGPLIGLIVPLLLLIGGKSFGVSANLRHLCAAVLPTRVDFLRYDWKRQGLWNLTFALGIVLGGFIAA
    TLLASPDPYVHISEATRADLAALGITDFRGLVPSEFISWKGLTTLPGLIMVVLGGFLIGFGARYAGG
    CTSGHAIMGLADL
    QLPSLVATIGFFIGGLIATYLILPLIL

    >gi|268316093|ref|YP_003289812.1| heavy metal translocating P-type ATPase [Rhodothermus marinus DSM 4252]
    MADEAQEKACAELVEQSAAEADGLVQVEVDPASGRLTLTYDRARLSAAEAERLARRLAAAFEERPARCTLHVQEQGGRSC
    ETCALALERRLQALPGVRQARVSFRGGVLHVVYDAAQTTPEELARVVERFGVRTLPPKPEVSWRLWLEGTRREALFVALT
    LAGLVTGWLAGRLGAPLVAAVAYGVAYVFGGWDGLRNGIGALRHRTVDVDLLMVLAALGALVIGAPAEGATLLFLFSLSN
    LLQHYAIGRSRRAIQALMELRPDRARVLREGQEVEVPVEEVRVGEVFVLRPGDRVPLDGVIVRGESALDESSITGESMPV
    DKGPGQEVFAGTINTTGSLEVRVTRPASASTLARMIELVEQAQSEKAVTQRLIDRLEQPYALGVLAMTALAIVISVAFLN
    EPFARAFYRAMTLMVAASPCAVVISTPAAVLSAIAAGARRGVLFKGGVYVEALARVRAIAFDKTGTLTEGRTRLVQVGAR
    PGVGLSEDELLRLAAAVQQRSEHHLARATVAAARERGLTISEAEGFQAVVGKGVRAVVEGATLHVGNLRYFEAAWQAADG
    FDEGRAAVEALARQGRTAVLVARERDGQREVLGWLAFADRLRPGAAETIRRLRALGVAHVALLTGDNRHVAEAIGREAGV
    DAVHAELLPAQKVAHVKALVDRYGAAAMVGDGVNDAPALAAATVGIAMGGAGTDVALETADVVLMRDDLGQLPYVLALSR
    ATRRTLLVNFAIAFGMMGLMIGAILLQGLPLPLAVVGHEGSTVLVSLNGLRLLGFRAS

    >gi|268316165|ref|YP_003289884.1| thiamine biosynthesis/tRNA modification protein ThiI [Rhodothermus marinus DSM 4252]
    MVEQTTGERSRALLFLRPASELTLKSSRTRRRFQQLLVRNLKDALRSQEIPFRFVGSWSWFLIETEAPLQAIEALRHVPG
    IGPIMPVELVTGTSLEEIVQRGAEAFAERVRGRRFAVRARRRGDHPYRSRDIEVELGAALRPFAERVDLTNPEVTVHVEV
    REDRAYFYTTIIKGLGGLPIGSQGQALVLISGGFDSAVAAWLAMRRGVSVDYLFCNLGGKAYERAVLQVAKVLADAWSFG
    TRPRFYSVDFGPVVDEMRRHVRPAYWQVVLKRLMYRAGEAVARRTEALALITGESLGQVSSQTLKNLQAIEAGTSLPVLR
    PLLTYDKEEIINLARKIGTATLSERVREYCALPPDRPVTATRPEAVDAEMARIDLSVLDQAVASAEVYDLRSLSASELVT
    PYLFIEEIPEGAVVIDCQSEALYEHWHYPGALHMDPWQLLQQFRHLDRDRAYVLY
    CPRGLQSAYVAEVMQRAGYEAYSFK
    GGVPALRAYARARGIEVPEL

    >gi|268316172|ref|YP_003289891.1| cytochrome c biogenesis protein transmembrane region [Rhodothermus marinus DSM 4252]
    MKICRRSQYAGLLILLALLASPARAQRATEIVQWRAHPQPERVAPGDSLWLRLEATIAEGWKVYALDSPPPTRGVRVRLD
    TLPDLRQAGSPRQQTPLESYDPFFEKVVRYFLNRAVLAVPLVVTPDATPGTRTLRARVAFMTCNDRVCLPPTEVPVEATV
    QIDPQATSKTAPPRFEPAVPPIEPEAAPPTSDETPALTDAAAQDLVRARSGGLWGFLLLAVGAGLAALLTPCVFPMIPLT
    VSFFTRQSGSRAQAVRMALVYGLAIVVTFTGLGVLTALLVGASGAQTIAANPWVNLFIGLVFILFALSLLGLYELRLPSG
    LVNYFNRQSQTHGGYLGVLFMGLTLTLVSFSCTAPFVGGLLAATALGEWGYPVLGMVAFSLTFATPFVLFALFPRALEAL
    PRSGAWMQTIKVVLGFVELAAALKFLSNADLVWGWGLLSRPLVIALVSVLFFLTGFYLIGKLRLPHEPPVETVGVGRLLV
    AVLFFGLSLYMLPGLLGAPLGNLDAYLPPRRATDVGLVALLQGSGNGESAAEMSWYEDPDVAFAEARATGRPVFIDFTGY
    T
    CTNCRQMEATVFPHPEVAKRLQNDFVRLRLYTDDASVGPEWQRYQLQLTGTVALPTYAIVALEGGPLLARHTGLASVEE
    FLAFLEEGSRAFQQWLAQQQRAQTTEPTAALR

    >gi|268316546|ref|YP_003290265.1| Rhodanese domain protein [Rhodothermus marinus DSM 4252]
    MATYAHPEVLVSTDWVAEHLNDTEHVRIVESDEDVLLYETGHIPNAVKIDWVQDLQDPIVRDYISKERFEELCASRGIAN
    DTLVVFYGDKNNWWACYAFWVFKLFGHEKCAIMDGGRQKWIAEGRPLTREVPSFPRTTYRAKAPDPSIRAFREEVLAHMR
    AGKPLIDVRTPAEYRGELTHMPDYPQEGALRAGHIPGAKNVPWSMAVREDGTFKPREELARIYLQEKGLKPDDEVITY
    CR
    IGERSSHTWFVLKYLLGFEHVKNYDGSWTEWGNLVGVPIEKGDPEAAQS

    >gi|268316588|ref|YP_003290307.1| alkylhydroperoxidase like protein, AhpD family [Rhodothermus marinus DSM 4252]
    MEREKHGVPEDRLTAFEAYRARMNRRILEADHLGIKRFFHLDETAYHDGALDRKTKELLGLVASMVLRCNDCIDYHLINC
    VRLGFSDEELFDAMNVALIVGGSIVIPHLRHAVETLDLLRARENPTE

    >gi|268316600|ref|YP_003290319.1| thioredoxin [Rhodothermus marinus DSM 4252]
    MQGTNAAVYEVTDFQRDVLEASYRIPVLVDFWAPWCGPCQILGPVLERLAQKYAGKWKLVKVNTDEHPELAMQYGVRGIP
    AVKLFVNGEVVGEFVGALPEYAIEQWLAEVLPDENRAQLEQIEQLLDEGKLAEAEPLLRKLLTADPGNDKARVLLARIRV
    FDDPDEAERLLENLDIAEAAYLQQIEGIRTIARLLRLKDQPESLPEGPGRDFYRQAIEALARKDFDTAVERLIDVLRKDR
    YYDDDGARKAGVAIFTLLGARHPVTQRWRRTFDMWLY

    >gi|268316621|ref|YP_003290340.1| DSBA oxidoreductase [Rhodothermus marinus DSM 4252]
    MAARNLSDVRGRLRNRRAGLNRLIFGLALLGLLDTTHLWVQQQRQFEEGCFGVASLAPLEKAFDCASVVQSAAGTLLGVS
    NTIWGALFYAAVALLSALALLRPALHRHRYKLIRAGLLGVGLLYTLYLLYYQAFELATFCALCLVSAGLVLTMAGLQAYE
    LFTFRPATMERPERIRTERLALGGLALAALLLMGADVYLNDALSPKTSTTTAAAATEAQPATQTCSFDTERPPVRYFRDL
    IMMNDPTAGNPDAKVVVIEYLDPN
    CPHCKHLHPIMKQVVESYGLQAYFVFKPIPLWQFSIPQVAALYAAAREGKFEAMLE
    AQFERQRSGGLTLEEILDIAEAIGMDRNELARQINEGVFNEYMQRQSRQASMIGVRGVPTVLINGHFVPGYARTVECLGQ
    LIEQQAKGS

    >gi|268316645|ref|YP_003290364.1| periplasmic binding protein [Rhodothermus marinus DSM 4252]
    MRIVSLLPAATEWVCAFGADASLVGRSHECDFPPEILDRPVLTRPRVDARGTSAEIDRQVRTVWEQGLSLYEIDWERLRA
    LQPDLILTQAQCPV
    CAVSVSELEAGLADWPAPRPQVLAMAPQTLKQVLDAALEIGRHIGRLHEAMSYLARAEKRLRHLRD
    FLGLRRRSDPSTFPRVACIEWIEPLIVAGHWMPDVVEMAGGQAVLAESGQPSRTITWAELQAADPDVLLLMPCGFTVAQT
    ARELPELMQRPEWQALRAVQEGRVFVLDGHAYFNRPGPRLYRSIELVAVCLHPDRLSLELLDVQPWELQTLETALT

    >gi|268316671|ref|YP_003290390.1| protein of unknown function DUF255 [Rhodothermus marinus DSM 4252]
    MPNRLQFEKSPYLQQHKDDPVDWWPWCEEAFEKAKAEDKPIFLSIGYAACHWCHVMAHESFQDEEVARLLNDAFINIKVD
    REERPDIDHLYMTVCQMVTGHGGWPLTIIMTPDKKPFFAATYIPKRSRYGRPGLLEIIPRIKEAWQQHRDEIIASAEKLT
    GTLQKVMSFEAPSQIIDAEWLEIAYRRLDDIFDRKHGGFGHAPKFPTPHTLLFLLRYWHRSGEAHALQMVEHTLVQMRLG
    GIYDHVGFGFHRYATDEAWRVPHFEKMLYDQALLTMAYTEAYQATGNPFYERTAREILTYVLRDLRAPEGAFYSSEDADS
    EGEEGKFYVWTVEELREVLGPELTPLAIELFNVDPEGNYEEEATGERTGKNILYLSKPPEALARERGWTPEELEAKLEEI
    RQRLFAYRARRVRPGRDEKILTDWNGLMIAALARAAQVFDEVAYVEAARSAADFLLRTMHTPEGRLWHRYREGEAGIPGM
    LDDYAFLTWGLLDLYETTFETSYLETALALTEQMLAHFWDPRGAFYMTPDDGEPMIVRPRETLDNALPSGNAVALMNLVR
    LGHMTGRTAYEEHADAMIRFFSGPVKQQPPIFTGMLIAIDLAFGPIYELVLAGEPDDPTLREMLRTIHRRYLPRKVLLLR
    RPGEAGERLVRVAPFVAAQLPVDGRATAYVCHDYRCEQPVTDPEALARQLDALQPAQPA

    >gi|268316765|ref|YP_003290484.1| OsmC family protein [Rhodothermus marinus DSM 4252]
    MQIKTVTFENNRGERLAARLDLPVDTQPVAYALFAHCFTCSKNLKAVTTISRALTTQGYAVLRFDFTGLGESEGDFSETT
    FATNFEDLRAACRFLSAQYEPPALLIGHSLGGAAVLAVAGEFPEVKAVATIGAPCDPAHVRHLLRPALDTIKTVGEAVVD
    LGGRPFRIKKQFLEELERVNLEDQVRTMRRPLLLFHSPTDQIVGIENAACLFQAARHPKSFVSLDQADHLLSNSDDAAFV
    GEVLGAWARRYVGRRPVPDTYRLDPGEARAVVRTGRAHYRTDIAADGHALVADEPAPLGGTDAGPSPYGYLAAALGA
    CTT
    ITLRLYADRKGWPLEAATAYIYHEKVHLNDCTECAEQGIEQTPGGKIDRFTVELTLEGALDAAQRQRLLEIAGRCPVHRT
    LKSPVVTRTRLRD

    >gi|268316820|ref|YP_003290539.1| glutamate synthase, NADH/NADPH, small subunit [Rhodothermus marinus DSM 4252]
    MGSLRGFIEIPRENPEKRPVEERVRDFREVYRLLPDERIQQQAARCMDCGIPFCHSGCPLGNVIPEFNDLVYRNRWRDAY
    ERLRATNNFPEFTGRVCPAPCESACVLGLIEPPVTIEQIEWAIIERAFREGWVKPEPPARRTGKKVAVIGSGPAGLA
    CAD
    QLNRAGHWVTVFERDDRIGGLLRYGVPDFKMEKWVIDRRVAILEAEGITFRTGVHVGRDYPVDQLRRDFDAIVLCTGATQ
    PRDVKVPGRELAGIHFAWEYLWQATKRVARDDLEAAGIPIIDAAGKDVIVIGGGDTASDCIGVANRQGARSITNFHIWPA
    PPKERTPEMPWPYHPHLLQVTTSHEEGCERVWSVQTIAFEGRNGHVERVITVDVEPGPPGPDGRRMRREVPGSRREWPAD
    LVLIAIGYEGPERSPLLEALGVELDERGRVKADEHFQTNVPGVFVAGDAHRGASLVVWAISEGREAARGVDLYLMDYTTL
    PTKGEGDLPLLR

    >gi|268316900|ref|YP_003290619.1| iron-sulfur cluster assembly accessory protein [Rhodothermus marinus DSM 4252]
    MSTTTLQAPIQLTPRAAQEIRKIMQTKQIPEGYALRVGVRGGGCSGMSYLLGFDRKREYDLEFEVEGITIYMDRRHGLYL
    MGTTIDYHDGLNARGFVFNNPNATQTCGCGSSFAV

    >gi|268316922|ref|YP_003290641.1| OsmC family protein [Rhodothermus marinus DSM 4252]
    MPVRKAQAVWNGNLREGSGRMAFGSFEGPYSFASRFEEGEGTNPEELIAAAHAGCFSMALANRLAQAGHTPERVQTEARV
    HLEMTNDGPRISKIELHTEVEAPGLDEQTFLEHAEAAKAG
    CPVSKALAAVPVIELHARLV

    >gi|268316936|ref|YP_003290655.1| Redoxin domain protein [Rhodothermus marinus DSM 4252]
    MQESLPLSPSLLYALAGLLVVGGLALLWLAPRLSPRRRLEGAAAWTGALFGGVVMLSGLALGALAYLRQQQPEIVQPPGV
    VGRPAPELAFRLVDTDEPRTLADYRGKVILLNLWATW
    CGPCLAEIPELNRFQLAYRDRGVVVIMISDEPRQTILEFTKER
    PLEAVSGYLPEDAHWPWPYNRVEQARPTTFVIDRDGIIRETWPGAADFAQFEAAVLPYLE

    >gi|268316946|ref|YP_003290665.1| mercuric reductase [Rhodothermus marinus DSM 4252]
    MKKILELRIGGMTCTHCARTIEQALMRVPGVVRAQVPGWQSGRAVVTWEGDAVDAEALRKAVAQAGHGYRLEAWEVVREI
    GSETPTRSGSDRIDYDLLIIGGGSAAFAAALRARELGFRSLIVNDGLPPGGT
    CVNVGCVPSKALIRAAEAHHRAAHHPFA
    GIRSTSRVEDFGAVIGQVQALTDELRRHKYLDLIDGRQIVFREGRARLAGPTAIQVGDETITGRAVLIATGSRTALPPVP
    GLADGPYLTNETLYRLSVLPEHLIVLGGGYIGLENAQAFARLGSRVTVLELLPQILPQEDADVAEALTTYLQAEGIDIQT
    EARVVEVAWQEGSVVVTYERDGATHRLEGSHLLVATGRRGNTDDLGLEALGIATDRQGFLQVDETLRTAVPTVLGAGDVI
    GNPPFVYTAAYEGQLAAENALMNRHEVRDYSALPWVVFTDPQVAGVGLSEREAQAAGLEYETSVLPLSEVPRALVGRDTR
    GFIKLLRDPVTDRLLGARIVAPEGGELVMELSLALRYEIPVSELARRFHPYLTWSEAVKLAALGFTKDVRQLSC
    CAV

    >gi|268316947|ref|YP_003290666.1| Mercuric transport protein MerT [Rhodothermus marinus DSM 4252]
    MSTNRTEKPDRIARSSLLAAIGAGVLASVCCVGPLAAVAVGVGGAWVSRLSALEPYRPFFVALALGALGLAWYREARRLP
    EPDCDCETGLRPKTRRLLLGLGTVLVLGLLATPSLIGRTHPTAMAQQVRSEPVQEVVLEVQGMTCEACSQAVVYALRRVE
    GVQAAEVTLEPPEARVRFDTTKVSVMQLIEAIRETGFGAALKNRTGATS

    >gi|268316982|ref|YP_003290701.1| methionine-R-sulfoxide reductase [Rhodothermus marinus DSM 4252]
    MAVQKITRTEEEWRRLLTPEQYRILREHGTEPAFTGAYWNHKEPGIYRCAGCGLPLFSSEAKYDSGTGWPSFYAPIDPTH
    VETSDDYSLGMHRIEVHCAACGGHLGHVFPDGPPPTGLRY
    CINSAALVFEPADQAP

    >gi|268317041|ref|YP_003290760.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodothermus marinus DSM 4252]
    MPEVGQEAPDFEGIDQHGRTIRLRDFRGRKVALYFYPKDDTPGCTKQACSLRDGYARLQEAGIVVLGVSADDANSHRRFA
    EKYGLPFPLIADPEAKICQAYGVWGERTLYGRKFMGIRRTTFLIDEDGRIRQVIRRPKVEQHADEVLKGFGLS

    >gi|268317225|ref|YP_003290944.1| OsmC family protein [Rhodothermus marinus DSM 4252]
    MQPTEDLVFRVSGVAESPARFRAQTRRFTVLVDEPEELGGTDEAPNPVEYVLIGFGGCLNVMAHLIAQELGFTIRRLEIE
    LKGTLNPDRLFGRSDAERAGYQQIEVQLRVDADADEATLQEWLARINDRCPVNDNLSNPTPVTISVTSLQEQQPVT

    >gi|268317226|ref|YP_003290945.1| Rhodanese domain protein [Rhodothermus marinus DSM 4252]
    MAQTSTRPAVLVDTEWAEAHLNDPNVRFVEVDVDTSAYETGHLPGAVGWNWKTQLQDQLTRDIIKQADYEELLSRSGIRP
    ETTVVLYGDNNNWFAAWAYWLMKYYGHEDVRLMDGGRKKWVAENRPLTTEVPTYEPTGYKVTRINAHLRAYRDDVAELIR
    QERFALVDVRSPEEFRGEILAPPGLSETAQRGGHIPGATNIPWSQAVREDGTFKSIEELQALYAGQGVTPDKPVITY
    CRI
    GERSSHSWFVLHELLGYENVRNYDGSWTEWGNLVGAPIER

    >gi|268317235|ref|YP_003290954.1| UBA/THIF-type NAD/FAD binding protein [Rhodothermus marinus DSM 4252]
    MPVTTADITLTPEELRRYNRHLILPEVGLEGQKKLKAASVLLVGAGGLGSPLALYLAAAGVGRLGLVDFDVVDETNLQRQ
    VLHGTKDVGRPKLESARDRILDINPYVQVDLYETRLTSENALDIIKEYDLVADGTDNFPTRYLVNDACVLAGKPNVYASI
    FRFEGQVSVFGTPDGPCYRCLYPEPPPPGLVPS
    CAEGGVLGVLPGLVGTIQATEVIKMILGIGTPLIGRLLLVDALHMQF
    RTLKVRKNPECPICGEHRTIHELIDYEQFCGLPSRNGEAAAQQAAESEVPEITVHELKARLERGDRPVILDVRKPHEVQI
    ASIGHDLLIPVDELPERLSELESYRDREIVVY
    CRSGARSARATKLLREAGFRDVKNLKGGILAWSQEIDPSLPQY

    >gi|268317370|ref|YP_003291089.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodothermus marinus DSM 4252]
    MALTYSQEIAPGTEAPPFDLPVVNPEADGLDKPTRSLEDFADARALVVVFTCNHCPYAQHIEDALIEVARAYQPKGVRFV
    AINANDPEQYPEDAPEEMARRARAKGYPFPYLFDETQEVAKAYGALCTPDLYVFDADRRLVYHGRFDDTRPGQGRPATGA
    DLKRALDELLDTGKVSGPQYPSMGCNIKWKPGNEPR

    >gi|268317407|ref|YP_003291126.1| protein of unknown function DUF255 [Rhodothermus marinus DSM 4252]
    MRRLIVCCGLMLAALLPLGVQAQSSLFDPAIMAPIGWKRVEEAMAAAEKSGKKVLIDISAPWCPWCRRMQKEVYPDSAVV
    AYLKAHFEYARLNGEDNTRRLTFRGYDLTEAELAQALGLTGYPTTVFLEPDGTYITRVPGFVPTETFLQILRFIGSEAYR
    TQSFEEFAGKQR

    >gi|268317450|ref|YP_003291169.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodothermus marinus DSM 4252]
    MRHWINWTAPVLLTGSLLLIGCRPKAPEQATASEQVPLSGVDEIKPPRPAPDFEAPGLDGAPFRLSAHRGSVILLNFWAT
    W
    CLPCRTEIPDLIALQRELGDRGLLVVGVSTDEEGAEVVAPFVKNFKINYPVVLDDGSVSEAYGGVWALPTTVVIDRAGR
    IRYEIIGIFPTKEMRPRLEALLDESAS

    >gi|268317457|ref|YP_003291176.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodothermus marinus DSM 4252]
    MRHFWLLLGLLVAWPAQAQLPLADRPMPSTDGQQVTLAQLRGARGLVIVFWSNRCPWVDRYEARLKELADAYEAQGIAFV
    LVNANDPEAFPQESLEASRQQVQRKGYPMPYLKDEEAALARALGASRTPEVFVFDARNRLVYRGAIDDSPGDASNVQQAY
    LKAALEALLQGKAPETTETGAFGCLIRLPQGDQ

    >gi|268317458|ref|YP_003291177.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodothermus marinus DSM 4252]
    MGRQFLSGLFGALLLVGSGWAQTVRPATATEILEVVRESPATVKVVNMWATWCAPCVEEFPAFVRLQQQYDSSQVRVFFV
    SADFEDELPAVRRFLQSQGVRFSFLKQGADDAFVRAFSPEWTGALPATFLYDMAGNLRGFWEGKTTYDQLVEQVQKLLNR


    >gi|268317524|ref|YP_003291243.1| dihydrolipoamide dehydrogenase [Rhodothermus marinus DSM 4252]
    MANNARYDVVVIGSGPGGYETAIRASQLGFKTAIIEKNKLGGVCLNIGCIPTKALLKSAEMVAEARNLEAYGLKLKGEVK
    PDFAKVIERSRAVADKMSRGVAFLMKKNKIDVIWGQARLVGRGKIDVQPSVNMDGEKIGEPRTVEATHIILATGARARQI
    PALPVDGKKIITYKEAMLQKEQPRRLVIVGAGAIGVEFAYFYHHMGTEVTLIELMDRIVPVEDAEISKELERAYRKMGIK
    VMTGAQVESVDTKGKELKVKVKTKNGEEVIKADQVLSAVGVVGNIEDLGLEDLGVETKPGQIVVDEFYRTNVEGIYAIGD
    VAGPPWLAHKASHEGILCVEKIAGKDVQPLNYNNIPGCTYCQPQIASVGYTEEKAREAGYDIKVGKFPFTASGKATALGH
    TEGFVKVIFDAKYGEFLGCHIIGHDATELIAEAVTARTLETTYHEIIESIHPHPTLSEAIMEAARAAIGEPINI

    >gi|268317571|ref|YP_003291290.1| iron-sulfur cluster assembly accessory protein [Rhodothermus marinus DSM 4252]
    MELQITERALARIREIAANEGVDLGQTMLRIAVVPGGCSGLTYELGWDTTLQEQDLTAQFDGVQVVIDRRSYLYLKGTTL
    DFTDGLEGRGFHFVNPQAARTCACGESFGL

    >gi|268317693|ref|YP_003291412.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodothermus marinus DSM 4252]
    MIPVLLSMLLLFGFGKDDMPRVGDPAPDFEAQATGGKTIRLSDLRGHWVVLYFYPKSFTPGCTTEACTLRDAYEKIQSLG
    AVILGVSLDDLETQERFKAEYKLPFDLISDHDKKIAKAYGVLGMGGLYAKRVTFLIDPEGRIAHIFEKVDPARHDRDVYE
    TLKKLQETAKS

    >gi|268318000|ref|YP_003291719.1| heavy metal translocating P-type ATPase [Rhodothermus marinus DSM 4252]
    MERTPTPEPLTETPETETALRLPVEGMECAACAVRIERRLRTVPGVRQASVNFATGEAAVAIDPQAVRLEQLVSAVEEAG
    YGVRTETLRVPLTRTPSADELAQCFGRTNGVLRWEVVEEDGAPVLEVRYVPVVADPAALQQQLVAAGLLAESARRAIPTD
    REALRREREAHYRDVRRRFWIAALLSLPVVVLAMAHGALDFPGSRWIQLLLTTPVVFWAGRPFFTGAWRAFRHHAADMNT
    LVAIGVGSAYVYSTVATVFPGFFEAAGRSPDVYFEAAAVIVTLILLGRMLEARARARTSAAIEKLLDLQPPRARVERNGR
    LKEVPVEAVRVGDRVVVRPGEKIPVDGIVEEGTAAVDESMITGESVPVDKKPGDPVIGGTLNQSGALVVRVTRVGRDTVL
    QQIVRLVEEAQARKAPIQRLADRVAGIFVPVVMLVAIATFVLWFDFGPEPRLTHALLTFVSVLIIACPCALGLATPTAIL
    VATGRAAQLGVLIKGGDALERLHHVDLVVFDKTGTLTEGRPHLARVVPLNGHEADALLAMAAAVEQRSEHPLARAVVEAA
    EARGLTLPPVRDFEALAGLGVAARVGGRHVQIGRPAFLAEQGVPVPEEQVTALAAEGHTVVAVAVDGVPAGLLALTDTIR
    PSAEPAIRALHRTGRRVAMITGDSEAAARAVARRLGIDEVRANVLPQDKAAAVAAFQAEGHVVAMVGDGINDAPALAQAD
    VGIAMGSGTDIAIEAGDVTLMRPDLRAVVDAFRLSARTLRNIKQNLFFAFIYNVLGIPIAAGVLYPFTGLLLNPIIAAAA
    MALSSVSVVTNSLRLRRFQPEPLD

    >gi|268318001|ref|YP_003291720.1| Heavy metal transport/detoxification protein [Rhodothermus marinus DSM 4252]
    MDATAWIVTLIGLAAMAWVVWYFWLSEPGRQPATQPGKTAMKTQETFQIEGMSCQHCVHAVTSALKKLPGVEVQSVEIGR
    ATVAYDPAQVSRDQLKAAIEAEGYTVVS

    >gi|268318010|ref|YP_003291729.1| heavy metal translocating P-type ATPase [Rhodothermus marinus DSM 4252]
    MKTVELSVEGMDCASCARHVAQALESVPGVCRVEVLLAAQKAVLEVDPTHPPAPEALRRAVEAAGYRVSQPEASPAATSH
    SRRIAALLALVFGTVLTVVVLGEWLGLFEELTARVPLPVGIALVVLMGYPVFRQVVQALLQGRILAYTLMSVGALAALLI
    GEWPTAAVVVFFMRVGDYVERFTTEQARRALKGLSQLMPRRARVERQGELVEVAAEAVQPGEVVLVRPGERVPVDGEVLE
    GTATLDTSALTGESMPVEAGPGDAVLAASLVRQGYLRLKATHTGAATTFGRILHLVETAEANRSNTERLADRFSTYYLPV
    VAAVALGTYLLRGDVMATVAVLVVACSCAFALATPVAVLAAIGAAARQGVVIKGGRYLEALARADVVLIDKTGTLTLGRP
    RLTDLVPLNGQSADELLALAAAAEYASEHPLAEAIREAARTRGLPLHRPEEARPLPGIGIEARVDGHRVRLQRLSDTEAF
    PEAAVLAAEGKTLILMEVDGRPAALLGAADTERPGLREALDVLRQMGLHHLELLTGDHPRAAEPLARRLGLRCRAGLLPD
    DKIRIVREYQRQGHTVVMIGDGINDAPALMQADVGIAMGSGTDVALDTAAVVLLRNDWHQLPALFRLAFRTRRTIAVNLG
    FTALYNLIGLTLAALGYLPPVLAAAAQSLPDLGILGNSARLLRARLSAS

    >gi|268318050|ref|YP_003291769.1| methylated-DNA/protein-cysteinemethyltransferase [Rhodothermus marinus DSM 4252]
    MKRRRNARTTKRTDQGDFFERVWEVVARIPPGRVTTYGHIAEYLGTRSAARTVGWALNAAAGSDLPCHRVVNRRGELTGR
    MHFEGPFVMEERLRSEGVTFTEDGRVDLSRHLWIPGEEEDHGRAAQVGTTTRSSGTR

    >gi|268318119|ref|YP_003291838.1| Methyltransferase type 11 [Rhodothermus marinus DSM 4252]
    MTTRNPKEIVRQHYAQVARKQTSCCTDACGCEANYSEAALAELPEGARLGLGCGNPLALAEWTALRGATVLDLGAGAGRD
    CLLAARQVGPEGRVIGIDLTPEMVALARENARKMGVTNVIFREGDITALPLPDASVDVVLSNCAINLVPDKARAFVEAFR
    VLRPGGLLLVADLVRQGELPEAWRDDPEAYAR
    CLTGTIPEADYLAAIEAAGFVVEYVERSVGTGPVVSLQVRARRSP

    >gi|268318274|ref|YP_003291993.1| hypothetical protein Rmar_2735 [Rhodothermus marinus DSM 4252]
    MNEPLNWLHDLDAALAEARRTHRPVWLMFVREGCAGCARMEAVSYRDAQVQAELGEAFVLLRQDIRRDRVVRARYAAVWT
    PSFYVLDARGMVHHVELGYLPPDDLRLVLRLGRAKELVPRGRYTEAIALLEEALGLFPKHPMAAQVMLWWAMARYLKSGG
    DSRQFREDMLELLRRYPDSPEARRWPWSEPPPIA

    >gi|268318275|ref|YP_003291994.1| peptide methionine sulfoxide reductase [Rhodothermus marinus DSM 4252]
    MVRQREKATLGGGCFWCLEAAFLELRGVTDVVPGYAGGHVPDPTYEQVCTGTTGHAEVVQITFDPSIISYRDLLEVFFAL
    HDPTTPDRQGNDVGPQYRSIILYHDEQQRQMAEAVIRELEASGVYDAPIVTEVVPLKAFYPAEPYHHRYYQRHPWQPYCR
    VVIAPKLIKLRQQFADRLAASDR