Rhodospirillum rubrum ATCC 11170 uid57655

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|83591360|ref|YP_425112.1| glutathione peroxidase [Rhodospirillum rubrum ATCC 11170]
    MSPLYDIEVTTLDGAPQTLADYAGKVLLIVNVASKCGFTPQYKGLEALQRRYRDRGFCVLGFPCNQFGHQEPGDAGEIKS
    FCTLTYDVSFPMFAKIDVNGPDAHPLYRLLKAEAKGLLGSEAIKWNFTKFLVSADGETISRFAPTDTPESLRARIEALLP
    AAQGPLGA

    >gi|83591374|ref|YP_425126.1| periplasmic protein thiol-disulfide oxidoreductase DsbE [Rhodospirillum rubrum ATCC 11170]
    MTSPDPQASSPARSGGRRWVYFLPLAVLAGLTGLFLFGLGNDPRLLPSQLINRPLPEFALEAPPGRDRPLTSEVLKGDVS
    LVNIFGSW
    CVACLQEHPVLRQIAAEGVVRIHGIDWREKNPADGMAWLRRHGDPYDAVGQDPDSKLAIDLGVTGAPETFVV
    DAQGVVRYKHVGPITQQDWTEKLKPLIADLRKAAQ

    >gi|83591641|ref|YP_425393.1| alkylhydroperoxidase AhpD core [Rhodospirillum rubrum ATCC 11170]
    MATVRLLDDAEISTLPEVKAVFDDIRATRGSDFVNNIWRGLANDPALLKRTWEQVKTVMVGEGALDPLTREMIYLAVSTA
    NSCSY
    CAHSHTAAARAKGMTPAQHAEVLAIIGLAAQTNALVTAMQIPVDEAFLVDGK

    >gi|83591738|ref|YP_425490.1| Thiol-disulfide isomerase and thioredoxins-like [Rhodospirillum rubrum ATCC 11170]
    MMLKPFFRKIARGPGLGIGHAAAAAIAVILTISAGDARAQTVPPSLAPSPSPVATPAFAAPVAADRGLDIHPAAARASLP
    DLAFSDGAGRPLHLSDYRGKVVVLNLWATW
    CGPCVKEMPALESLAAQTAGGAIAVLTLSQDRGGEAPVRAFYERAGLTHL
    PILLDPQMKTGRALGLRGLPTTLVIDALGREAARHEGMLDWDSPAVLALLTALADEAGDSLPL

    >gi|83591816|ref|YP_425568.1| OsmC-like protein [Rhodospirillum rubrum ATCC 11170]
    MGSVFFIHRRFFPEIAVFQGNCIAHDKIAHHLLGHPPGGPPRPAPITQERPMTIAYRTKATAVGGREGRATSEDGLLDVA
    LALPKELGGPGKATNPEQLFAAGYAACFESALRHVARGRKLALASTTVTAEVGIGPRADKGFSLEVALDITLGGVDQATA
    EDVVAEAHEV
    CPYSHATRGNIPVTLQVHTA

    >gi|83591919|ref|YP_425671.1| OsmC-like protein [Rhodospirillum rubrum ATCC 11170]
    MIKKTASVHWEGQGKHGQGQISTETGALTNYPYGFASRFEDDRQGTNPEEILGAAHAACFTMAFSFACDKAGLATTHVDT
    TASVALAKQGEGFVIERIDLTLSASVPGIDDATFQAIAATAKAE
    CPLSKALAAVPEITLKATLI

    >gi|83592021|ref|YP_425773.1| NADPH-glutathione reductase [Rhodospirillum rubrum ATCC 11170]
    MADYDYDLLTIGAGSGGVRASRLAGGFGARVAVVEGSRIGGTCVMRGCVPKKLLVYGAQYANDLEDMIGYGWSMGGVAFD
    WPSLITAKNRELDRLEGVYRTMLRNGNVALLEGRARFLDAHSVDIDGKTVTADKILIAVGGWPQMPVIPGIEHAITSNEA
    LDLMVMPERLTIVGGGFIAVEFASIFNALGVDVSVVIRKDKILRGFDADIRDTLTEELVRRGITIVPGTVINRIDKRPGG
    GYRLIRTPGEAIDTDLVMYATGRAPNTAGLGLEAAGVKVAASGAVIVDEWNRTTVDTIYAIGDVTDRIALTPVAINEAIA
    FAHTVFNDTPRVMDYENVASAVFSQPPVGTVGLTEEQARARGPVRIFRTRFRAMKHVLAGRDEKTMMKLVVDARTDRVLG
    CHMVGADAPEIIQGLAVALKCGATKAQFDATIGIHPTAAEEFVTMRDPVPEPVFAQPAD

    >gi|83592044|ref|YP_425796.1| glutaredoxin-like protein [Rhodospirillum rubrum ATCC 11170]
    MSVQDRIKSEVDGTPVVLFMKGTPAFPQCGFSAAVVQVLNHYGVAFKGINVLEDDEIRQGIKEFANWPTLPQLYVKGEFV
    GGCDIVREMAADGELATLFEKSGIPTTAA

    >gi|83592077|ref|YP_425829.1| glutaredoxin GrxC [Rhodospirillum rubrum ATCC 11170]
    MVAVEIFTTPSCPYCRRAKALLGDKGVAYREIDVSGDPRLREEMTRRAGGRSTVPQIFIDGRALGGCDDIHALDRLGKLD
    GLLSGSAP

    >gi|83592343|ref|YP_426095.1| nitrogenase-associated protein [Rhodospirillum rubrum ATCC 11170]
    MADVLFFEKPGCRNNTRQKALLIASGHRVEAHDIRQQPWTAETLRPYFGDKPVAQWINPAAPRVKAGEVRPEALDESEAL
    ALMVKDALLIRRPLMAVGQTKTCGFDRAAVNAWIGLIAQDPGDIETCPSQATNHRCAEEPGAA

    >gi|83592363|ref|YP_426115.1| (Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase [Rhodospirillum rubrum ATCC 11170]
    MRQDKHASTPLRPGEAEGFRRTRYRVAGMDCGSCAAKIERALMPLPGVAQVGVSVTAGTLTVDHGPKVGRAQIVRIVDAL
    GFTVLEDGPNPTTSPATVVSSCGCSGSCADGVPRAASHDHDHDHDHDHDHDHDHDHEHGHDHGASPVGDVEGRRWWRSGR
    GMLTLGCGAALAVAYGLGLVFPPLADGLFIAAMLIGLLPIARRAFTSARYGSPFSIETLMTVAALGAVALGAVEEAAAVV
    FLFLVGEALEGLAAGRARAGIRALSALVPKTAQREGADGGVREVLADRLAIGDVIVVRPGDRVPADGLVLSGNGEVDEAP
    VTGESLPKAKAAGDGLFAGTINGIGLLRVRVTAAAADNTIARVVRLVEEATESKAPIARFIDRFARLYTPAVIAAALAVA
    VLPPMVLGGAWETWIYRALALLLIGCPCALVISTPAAIAAGLSAGARRGLLIKGGAVLEILGKVTTVAFDKTGTLTRGEP
    VVTDLQARALSAGEALALAAGLAEGSSHPVSRAILARARLDAILPRRIDDAGTRAGEGLDGTVDGEALFLGSPKAARRRM
    GGFEDDVDGAILALEQAGKTVSLLVLGEGATARVGAVFGLRDEPRPDAGEGVAALKAAGVEAMMLTGDTPHAARALGQGL
    DIAVHAGLMPEDKLRLVRERQNRGALVAVVGDGINDAPALAAADVGIAMGGGTDVALETADAAILRSRVGDVAAMIDLSK
    RTLAIIHQNVAIALGLKALFLVTTVAGLTGLWPAILADTGATVLVTANALRLLRRRR

    >gi|83592551|ref|YP_426303.1| dihydrolipoamide dehydrogenase [Rhodospirillum rubrum ATCC 11170]
    MSDFDVVVIGGGPGGYVCAIRAAQLGLRVACVEKRPTLGGTCLNVGCIPSKALLQSSHLFDEANHGFAAHGITVGTLGLD
    MKTMMARKDEVVEANTKGIVFLFKKNKVTHVVGSARIAGAGQVVVSGEGGEQTLTTRAIVIATGSEVTPLPGVTIDEERI
    VSSTGALALAKVPKSLVVIGAGVIGLELGSVWRRLGAEVTVVEYLDHILPPMDGEVRKQSQRILEKQGLRFKLGRKVTAA
    ERKGEGVSLTVEPAKGGEAETLEAETVLVAVGRRPFTDGLGLEEVGVEKTDRGFVKVDGDFQTAIEGIFAIGDVIGGMML
    AHKAEDEGMALAEMLAGESAHVNYGAIPSVVYTWPEIAGVGKTEEMLKKDGVAYKVGKFPFTANARAKANGDTDGFVKIL
    SNAETGRVLGCHIIGAQAGDLIMEVVLGMEFGASSEDIARTCHAHPQLGEAVKEAALAVNKRTIHM

    >gi|83592753|ref|YP_426505.1| thioredoxin-disulfide reductase [Rhodospirillum rubrum ATCC 11170]
    MLDSNLKAQVKTYLENVTQPIELVASLDESAKSEEMLDLLEDIAGLSDKITLIGRDDEGRKPSFSINRAGTDIGVRFAGL
    PMGHEFNSLILALLHVGGHPSKTAPEVVEQIESLDGDYNFETYFSLS
    CQNCPDVVQALNLMSALNPRIKHTAIDGALFQD
    EVESRQVMAVPAIYLNGEPFAQGRMTLEQILAKLDTGAAERTAAKLKDKEAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
    AERFGGQVLDTMGIENFISVAHTEGPKLAAALESHVKDYAVDIMNLQRAEKLIPAKTPGGLVEVQLASGAALKARTVILS
    TGARWRQMNVPGEDAYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLIEFDARLRADQVLQTKLA
    SLNNVTIITSALTSEVHGDGAKVVGLSYKDRTTEEFHRIDLDGIFVQIGLVPNTEWLKGTVALSPRGEIEIDARGQTSLP
    GVFAAGDATTVPYKQIIIAMGEGSKAALSAFDYLIRLPQAEETAAA

    >gi|83592754|ref|YP_426506.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodospirillum rubrum ATCC 11170]
    MSLIGSEVKPFKADAFKAGKFVTVTDDTLKGKWSVVFFYPADFTFVCPTELEDLAENYAEFQRLGVEIFSVSTDTHFAHK
    AWHDTSEAIKKIEYTMVGDPTGTISRNFDVLIEDAGLADRGTFVIDPEGRIQIVEITAGGIGRDALELLRKVKAAQYVAS
    HPGEVCPAKWKEGEKTLAPSLDLVGRI

    >gi|83592950|ref|YP_426702.1| 3-mercaptopyruvate sulfurtransferase [Rhodospirillum rubrum ATCC 11170]
    MTRSRTEALVTPQWLHDHLDAPDLRIIDASYFMPASGRDAHQEYEAAHIPGAIFFDINAVADTSQPKPHSLPAPEVFSSA
    CRGLGIGDGQRLVVYDRNGGAMAAARVWWMFRLFGQTEVSVLDGGLGAWQAEGRPTDDLPRLHGRRHFTARLDNTLMRTA
    SQVREAVESGRAQVVDARSSGRFTATAPEPWPVARVGHIPGSINLPYTDLVVASEHGRLADREILTQAFAKAGVDLGKPL
    IAT
    CGSGVSACVIALAAAQLGHETVAVYDGSWFEWSGLADYPTAP

    >gi|83593051|ref|YP_426803.1| YeeE/YedE [Rhodospirillum rubrum ATCC 11170]
    MSVFWPPLLGGMLLGLSAALLLIGNGKVAGISGMAGRLLQGQSRVESAVFLIGLLLGPALYALIVGAWPAVTIVASWPVI
    VIAGLLVGFGTRMGSG
    CTSGHGIVGLARLSRRSLAATATFLVCGVLTASLMGILR

    >gi|83593116|ref|YP_426868.1| HesB/YadR/YfhF [Rhodospirillum rubrum ATCC 11170]
    MTDQPPPAAPSPGAETADIRISAAAAARIHALMEAENDSALMLRVTVSGGGCSGFSYGFDLERTTAEDDLLFEQHGVRVV
    IDEASLDLLHGSEIDYTDDLMAAAFTVRNPNATSTCGCGTSFSI

    >gi|83593198|ref|YP_426950.1| glutathione peroxidase [Rhodospirillum rubrum ATCC 11170]
    MEQASKGSGGGDWLIRGVFSLGLALASFGGPASAQAAGAHDYSFPAIDGGTLPLAAWAGHPVLVVNTASECGFTAQYEGL
    EALWKAYRAKGLIVLGVPSNDFGGQEPGSAAEIKDFCESTFAVDFPLTDKTAVSGARAHPFYAWAKASRPDLSAPRWNFH
    KYLIAPDGSLAASFSALTDPKDRDLTDAIDKLLEK

    >gi|83593213|ref|YP_426965.1| dihydrolipoamide dehydrogenase [Rhodospirillum rubrum ATCC 11170]
    MTETSFDVVVLGAGPGGYVAAIRAAQLGLKTAVVEREHLGGICLNWGCIPTKALLRSAEVFRQIRHAGAYGLKVTGAEVD
    VAAVVKRSRGVAKQLAGGVGHLLKKNKVTVIDGHGRLAGAGKLTVEKDGKTTTLAAKAIILATGGRARTLPGLEADGKLV
    WTYKNAMIPESLPKRLLVVGSGAIGIEFASFYTDCGSQVTVVEVLERVLPVEDEEISAFAKKSFEKQGMTIKTATTVKAL
    KKSGDEVTATLEKDGKTEEITVDRVIMAVGIAANIEDIGLETVPSIKVERGHVVTDAFCRTGDPGIFAIGDLTAPPWLAH
    KASHEGVLVAEVIAGKKDLHPLDTMKIPGCTYCHPQVASIGLSEAKAKAKGFTVKVGRFPFVGNGKAIALGEAEGLIKTV
    FDARTGELLGAHMIGAEVTELIQGFAIAKTLETTEEDLIHTVFAHPTLSEMVHESVLDAYGRAIHF

    >gi|83593229|ref|YP_426981.1| heavy metal translocating P-type ATPase [Rhodospirillum rubrum ATCC 11170]
    MSGKAAVLSPPAPPTSNEGGDVVDLAISGMTCAACSARLEKVLGKVPGVSAVSVNLGTDRARIHIEGGDRRAPDLVAAVN
    RAGFGAEPLSQSAPPPAAVPAEDRGDRLIFAMAALLTLPLVWDMIAHVSGLPGHVPPLWQWILATPVQFIAGARFYKGAW
    RALKGRAGNMDSLVVLGSTAAYGLSAWRVATGTTHHGLYFEGAAVVITLVMLGKALEGRAKRSAASAIRALMTLRPALAH
    LERDGVVSDVAVERLVVGDIVVVRPGEGVPVDGTVIEGGAAIDESLLTGESLPVTRGPGDRVIGGSIDTDGLIRLRVGAT
    GKDATLARIIALVENAQASKAPVQVMVDKVAAVFVPAVVLLALGAFTGWALLGETMETAVAAAISVLVVACPCALGLATP
    TAVMVGTGVAARRGILIRDAGALEQAHRVSVLAFDKTGTLTQGRPALDAVIIAPGADGLDENTLLALAAAVQGGSAHPLA
    RAMREAAGDRGLDLSAISDFRSLPGLGVEARVAGRALILGSRRLLDAKGIERASLESRAGALEEAGASVVWVAEGEATGG
    RLLGVIALADPPREGAALAVSRLKALGVRPVMLTGDAGRVAHAIAARLGIDDVRAEVLPEGKAAVVEALRQGGAVVAMVG
    DGVNDAPALAAADVGIAMGTGTDVAMETAGITLMRGDPGLLPEALALSRATHRKIRQNLFWAFLYNVIALPLAASGRLDP
    MLAGAAMALSSVSVVASSLWLRRWMPPSGDRFRA

    >gi|83593242|ref|YP_426994.1| protein-methionine-S-oxide reductase [Rhodospirillum rubrum ATCC 11170]
    MSSNPNQRSAPADFPPPAAKSDKDWRAILTEDQYRVMRHQGTEAAWSSALNGEKRSGAFLCAACQAPLFASDDKYDSGSG
    WPSFTRPVDKQAVDTSVDHKLIVPRTEVHCSACGGHLGHVFEDGPRPTGLRY
    CINGVALDFKPEAPQATASHTPTDD

    >gi|83593257|ref|YP_427009.1| DSBA oxidoreductase [Rhodospirillum rubrum ATCC 11170]
    MDIDFVFDTACPWCHIGWRRLLHALAERPEVVVRPRWRPFLLNPEMPAEGMDRRQYVERKFGGPRRAARMLEAAESAGRL
    VGLEFRFERIKRTPNTIDSHRLLRLGRSTSQREALFDALFQAYFVDGEDIGDRDTLIALGVACGLDGALLREHLAGGAEI
    AEVVSENTRAHAIGMSGVPGFIFNGQFAISGAQEPAIFIRMIDLALETQALLPVACSS

    >gi|83593327|ref|YP_427079.1| arsenate reductase [Rhodospirillum rubrum ATCC 11170]
    MGVTIYHNPACGTSRNVLAMIRQSGEEPRVIDYLKTPLSRAELVDLIAVLAIPVRDLLRRKGTPFDALGLEDPALSDDAL
    IDAMVAHPILINRPIVVTAKGAALCRPSEAVLAILPTPLVGSFTKEDGEVVSAPAPSTP

    >gi|83593373|ref|YP_427125.1| glutamate-ammonia-ligase adenylyltransferase [Rhodospirillum rubrum ATCC 11170]
    MQEFLFPSATARFPLPADQGRLDRGLERWRALARDDSEGIAPSFVKNFLDDPRGNALLAAVFGNSPYLSAALIREPAFVE
    TLALRGPDQVFPDLLEGMARAIAATSEATVVMQVLRVTKRRAALCIALADIARWWSLEQVTAALSALAERSLRAVVAHLL
    TRRAASGDLVLPHPEDPERDSGFFILGMGKLGGGELNYSSDIDLIVLFDAEKARYQGKRSLKECYVGLTRDLVRMMEERT
    AEGYVFRTDLRLRPDPGSTAVAISTEAAEIYYETMGQNWERAAMIKARPVAGDLVAGQAFLTHLRPFVWRKYLDFNAIQD
    IHSIKRQIDAVRGGAEIGVAGHNIKLGRGGIREIEFFAQTQQLIWGGRTPKLRSKSTCEALADLVEVGLVEAPAADELTE
    AYRYLRTLEHRLQMIDDEQTQTLPLEPDKLRHLALFMGEADAEALGVAVTTRLRRVESHYAGLFEDAPSLSQGGNLVFTG
    GEDDPETLATLRRMGFSNPEGISATIRGWHHGRYAATRSTRTRERLTELMPDLLKALAATAQPDTALLRFDEFLSKLPTG
    MQLFTLFQANPGLLGLLAEIMGDAPRLSEHLARNPRLMDIVLTPGFFEGAPSHADMTRSLDALLADAVVFEDTLDLVRRW
    ANDLRFSIGVLALRGLVEAEEAGQSLSDVADVALSRLVPRVEAEFALAHGVVPGGAMAVVALGKLGSREMTATSDLDLIV
    VYETPEDSEGSQATEAGQRPLPVSAYYTRLTQRIVNAITALTAEGALYEVDMRLRPSGNKGPLATSLTAFRRYQADAAWT
    WEHMALTRARVITGPEGLRARIDAVIAETLTRPRDAETLARDVADMRARMERDKPAASPWDVKLAPGGLVDIDFLAQFLQ
    LRHAPRTPEVLAADTVGALRRLSEAGYLDPAICRFLCAHHRRNLGIQATLRHSIAGPPRDSDLTPGLKAKLARATGWDDF
    ETLRAHMADDGARVRQIFTEIVDPTRPPPPPPLEKGPPMTEIPVAPGTAAPDFSLPTDGGGTLSLADLRGKKLVLYFYPK
    DATSG
    CTTEALGFKEQAEAFAEAGAVIVGVSKDSVKSHDGFKAKQGLPFTLASDAEGAVCQSYGVWVEKSMYGRTYMGID
    RSTFLIDGEGIIRKIWRKVKVAGHVAAVLEEARAL

    >gi|83593606|ref|YP_427358.1| HesB/YadR/YfhF [Rhodospirillum rubrum ATCC 11170]
    MMTWTESAAAAVRKVVGRSPEAATGLRLMVSTGGCAGVVYRMGLEARAQDDDAVIDLGEAKVFVDPQSLPLLDGARVDFV
    DSGTASGFVFDNPNALNTCSCGKSFSAATC

    >gi|83593644|ref|YP_427396.1| NADH peroxidase [Rhodospirillum rubrum ATCC 11170]
    MEQMSILVIGGVAAGASFAARARRLSETARITVLERGPDVSFANCGLPYHIGGEIPDRGALAVQSAASLKGLLNLDVRVQ
    TEAVAIDPKGKRVEVRDLASGQSAWLPYDKLMLAPGASPLRPPLPGIDDPRIFTLRNLQDMDRIIAATAPGQRAVVIGAG
    FIGLEMAEQLHRKGLGVDLVELQSQVLPPLDPPMAALVESELRRHDIGLHLGDAIARFESLGARLRCHLASDKTLDADIV
    ILSIGVKPESDLARAAGLELGAKGHIVVDSFQRTSDPDIYAAGDGVETVDRILGGKTAVPMGGPANRQGRVAADHIFLAD
    KARPYPGSVGTGIVRAFDAVVGITGWSEKRLAAAGHPYETVTVNDSHHASYYPGAKPMTLKILWEPDSGRLLGAQVSGSE
    GVDKRLDILSTAIIAGMTVEDLCHLELAYAPPFGSAKDLVNLAGFAACNRRDGLVSHTTELPTDPQVQVIDVRGKPLAEA
    YPAPGTTINIPFPTLRAHLDTLDKTRPVVTL
    CAFGKMSYFAARVLSQHGFTVKSFSGGLKANVDPRTPGKLPGA

    >gi|83593697|ref|YP_427449.1| protein-methionine-S-oxide reductase [Rhodospirillum rubrum ATCC 11170]
    MATATFAAGCFWGVEETFRKIPGVTGTTVGYTGGHFKEPTYRQVCAGDTGHAEAVRVDYDPDKVTYEQLLDVFWAAHDPT
    QVDRQGPDIGDQYRSAIFYHDAGQEAAAGASRARLEQSGALSRAIATRIEPAGPFWPAEEYHQRYIDKQRARTGVAPACH


    >gi|83593763|ref|YP_427515.1| DSBA oxidoreductase [Rhodospirillum rubrum ATCC 11170]
    MTFALRPLRALRPLLLAATLIGGALAPALAAEDSLSPAQQAAVRALIRDTLVSDPEILREAVQALQAKDEAEASAQQARA
    IKDLGPLLHSPEGLPALGNPKGDVTVIEFSDYN
    CGYCKRVFPVLWDEVEADGQIKLYVMEYPILGAESVMAARAALAAIG
    QDKYAEFHKALMAHKGKFTEEAIAGIARAQGLDAAKLKTAMAGKEVDAALARSFQIGQALGISGTPAFIVADRLVPGALD
    PATLKALVKEARSGK

    >gi|83593835|ref|YP_427587.1| rhodanese-like protein [Rhodospirillum rubrum ATCC 11170]
    MRLSILRARSTGSGQASPRASRTRGARSAAAGGSWVVIFLPLHCGTRSLTMPRRARNAQTASSCSLERPNEWKEPPPVSG
    FEVTIVDAESVIAWVKAGKVTVFDVREPEEFAAAHIEGAIPNPLSRFDASLIPTDSPVPVVLH
    CRSGVRCGHAADRLRAS
    GFQGKINRMAGGIIAWQAAGGPVVSG

    >gi|83593900|ref|YP_427652.1| HesB/YadR/YfhF [Rhodospirillum rubrum ATCC 11170]
    MALPPPITLTEAAVARIKALMARADKPVAGLRVGVSTKGCSGLSYKIDYAEDGPRPFEEVVSQDGATVFLESNAVMFLIG
    SQMDFKQDKLSATFSFANPNEKARCGCGESFSV

    >gi|83594133|ref|YP_427885.1| thiol-disulfide interchange protein [Rhodospirillum rubrum ATCC 11170]
    MALVLGLAACKPEEAGRAGAKAPDLAALTLEGTPTSLRDHAGRVVVVNFWLGGCAPCLTEMPALEAFHRGWADKGVDLMA
    INVGGNAQIVRKAITDVDATFPFLVDELSLTASRYEVAVFPTTLVIDRQGIVRARFAGEMKDQVLAQAVLPLL

    >gi|83594135|ref|YP_427887.1| putative thioredoxin [Rhodospirillum rubrum ATCC 11170]
    MVVALTRARARGLWAAVGLIGALLAAGCDEAPKTARTDQGAPELVATDRQDAVVRLADQRGKVVLINFWLAECGPCLAEM
    PDFDGFYRETRGRGFEILAINMGQEDKVVGDVARRLQVSFPLLTDALGITTKRYEVVAAPTSFLIDREGRLVARFNSPLN
    RAALEKAVGPLL

    >gi|83594229|ref|YP_427981.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodospirillum rubrum ATCC 11170]
    MTESVGTLTGRPVPDFTAPAVLADNSIVEDFCLKDYLAGFYGLIFFYPLDFTFVCPSEILAHDHRLPAFAAKEAKVVAIS
    VDSQYSHLAWKKTPIAEGGLGPIGFPMVADISKAIARSFGVLLETGVALRASFLVDRGGIVRHQTVNDLPLGRNVDETLR
    MIDALRFHDAHGQVCPAGWKTGDPGMTASPEGVAAYLSANAERL

    >gi|83594230|ref|YP_427982.1| thioredoxin reductase [Rhodospirillum rubrum ATCC 11170]
    MAEHRTKVLILGSGAAGCTAAIYAARANLAPILVAGLQPGGQLTITSDVENYPGFAEAISGPWLMEQMQAQARAVGTEMI
    DDLIISADLSKRPFVCQGDSGDTYIADTVVVATGASARWLGLQSEKRWSGLGVSA
    CATCDGFFFRGKEVVVVGGGNTAVE
    EALYLTNHASKVTLIHRRDSLRAERIMQDRLFKNPKVGVVWNSTVEEILGGGDPPGVTGVRLRDTQTGALSELSCDGVFI
    AIGHTPNTALFAGQLDCDDNGYLITAPDSTATNVPGVFAAGDVQDHIFRQAVTAAGTGCMAAIEADHFLALTQE

    >gi|83594387|ref|YP_428139.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodospirillum rubrum ATCC 11170]
    MIAVGDALPSGTLHHKTAAGIEAVDPAEFLGAGKAVLFAVPGAFTPTCSDSHVPGYIAQAQALRDKGVTKVACVAVNDAF
    VLAAWSKALGAEGTVEMLADGNGDYARALGLELDLTAKGLGKRFQRCALVLDNGKVTHLAVDEGGALDVSSAEAVLALL

    >gi|83594388|ref|YP_428140.1| putative suppressor for copper-sensitivity B precursor [Rhodospirillum rubrum ATCC 11170]
    MSRFLLALCLFLGLCLPAQAQGNDPGASAWVEKSHSRMRLISAVSAAGKAEEIALGLQVELAPHWKIYWRSPGDAGYPPS
    FDWTGSLNLAGATPRWPVPTRFSVLGIETVGYEHQVILPLMARLERPGDPLILRLAVDYLICAEVCVPDRGDFTLIVPPG
    PSGASPQAQALARFLAQVPGPSPSHGITVDEAVIETGGVVRVAVRADPPLAAPDLFVEAPAGMAFARPQVTVEEGGGRAV
    LRAGVVGGDALIGQSLPVLVADGVRGVEAGVDTRRALAPPAGAGDPRPTALGGESGGETGAPGAPTGPLAFLAMVSVALL
    GGLILNLMPCVLPVLSLKILGLVGHGGGAPRAARLSFLATSAGIIASFLVLALAAIGLKTAGMAVGWGIQFQQPLFLSGM
    VVLLALFAANLWGLFEIGLPGAVSGLGGQGRAGSSLSGAFATGAFATVLATPCSAPFLGTAVGFALARGPFEILAIFLAL
    GLGMALPYLLVALRPQIATRLPRPGRWMLRLKAVLGAVLCLTALWLLSVLAVQIGAVWAAVIGGLLAVALGVRALRPISR
    LSGGVAALLGIAALALPALPLPALSLPMAAPSQALEETAWGRWSPEAVARLVAEGKTVLVDVTAQW
    CVTCKVNKATVLDA
    APTRALLDSGRLSGLRADWTRPDPAIAAYLASFGRFGIPFNAVYGPGAPQGIALPELLSENALLEAVARAAGPSS

    >gi|83594579|ref|YP_428331.1| DSBA oxidoreductase [Rhodospirillum rubrum ATCC 11170]
    MPTARLRAFSFPKEDFALPQFLRPLFLAAALVAGIAAPGLAASIPYSERALGSPDAKVTIVEYSSLLCPHCADFHTQILP
    ELKKEYIDTGKVRLVFKDHSLGQPLAVGASVIARCAPEQNFFPLITTLFANQRTWATAKDPLAALQGYAALAGMDKAAVE
    ACLDNQDVFNGVQAGEAEAGRIGVESTPSFVIDGKPVLVGAQPIEAFRKVLDPLVGG

    >gi|83594653|ref|YP_428405.1| copper-translocating P-type ATPase [Rhodospirillum rubrum ATCC 11170]
    MDGLSETRPADSADGGTACRHCGLPVPANGPAGAEFCCVGCRGAYGLIRDSGLDQYYQRRCLDPDTPPPRPEDLGPIDFS
    AHILRQPTADGGEEAVLHLMVEGIH
    CAACVWLIETLLGRQPGVSQARLNMTTRRLTLRFRPAKGETAADLGANTLLAPVA
    RVGYRLVPYDPALLDQETRRTEKALVQAMAVAGFASANVMLLSVSVWAGVDMGPRTRDLMHWISALIAVPAVIYAVRPFA
    HSAFAALRAGRASMDMPITLAVTLATGVSLWETANGGAHAYFDAAVTLLFFLLIGRFLDHRARGRARSTAEHLLALGATA
    VTVLRDDGTLEHRPPRQVTPGATVLVATGERIGVDGTVSQGCSDVDTSLLTGETLPEPVHPGSAVFAGTLNLTGPLRLSA
    GAVGEGTLLAEIVRMMEVAEQGRARYVAIADRVARAYVPVVHALALASFLGWLTLMGAPWQQALMVAAAVLIVTCPCALA
    LAVPVVQVVATGRLLRQGILVKSPTALERLTGVDHVVFDKTGTLTLGRPDLRPADPARADAWSAEDLAAAAQLAAASHHP
    LARALALAAPEAKPAALAREWPGQGMSLPLAEGEARLGRAVFCGLEDTPAEDGGGPELWFTRPGHAPVRFGFIDRPRPDA
    AEVVAALRAQGIGVELLSGDRPAVAAALAARIGLNDWRAGCSPADKVARLAELAAAGKTVLMVGDGLNDAPALAAAHVSL
    SPASAVDVTQTAADVVFQGERLTPVIEALGVARRADRLVRQNFVLSFAYNIVTVPLAICGLVTPLIAAVAMSSSSVVVIL
    NALRLSRRR

    >gi|83594687|ref|YP_428439.1| methylated-DNA--(protein)-cysteine S-methyltransferase [Rhodospirillum rubrum ATCC 11170]
    MTPLFIDRPDSPLGRLLVVADDQSLRGVDFADNEARLMRLLEVGDGAALIPKDDPLGASSALAAYFAGDLTALDALPVHY
    GGTPFQNRVWKALRTIAFGQTLSYAALAERIGAPGACRAVGRANGLNPLSLVLP
    CHRVIGGSGALTGYAGGLARKAWLLR
    HEGLAIEGFRLAPAPRLSDVENCRPPIPGAGRPTPAPFRRHP

    >gi|83594762|ref|YP_428514.1| thioredoxin [Rhodospirillum rubrum ATCC 11170]
    MKQVSDASFEEDVLKADGPVLVDFWAEWCGPCRQIAPALEELATALGDKVTVAKINIDENPQTPSKYGVRGIPTLMIFKD
    GQVAATKIGALPKTKLFEWVEASV

    >gi|83594950|ref|YP_428702.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Rhodospirillum rubrum ATCC 11170]
    MPRITLASPVGPLWLEERHDALVALGWGEDETIPPPGAGALAATPLLAEAALQLAAYFAGARQGFDLPLAPGGTDHQARV
    WAALREIPFGRTESYGALAARVGSSARSVGTACGRNPLPILIP
    CHRVLAAAGAAGGYSGRGGLETKRRLLALEGVPLPGE
    TLSLF

    >gi|83594951|ref|YP_428703.1| hypothetical protein Rru_A3622 [Rhodospirillum rubrum ATCC 11170]
    MSRNRLGEETSPYLLQHKDNPVHWLPWGEEAFAEARALNRPVLLSIGYSACHWCHVMAHESFEHPQVAEVMNALFVSVKV
    DREEHPDVDALYQGALALMGEQGGWPLTLFLTPEGEPVTGGTYFPREPRYGRPGFVQVLRQVSEIFRSAPDKVAETAARL
    REALAEMNAGDRAGGVALSLPQLDDAARALLSHIDGVAGGLSGAPKFPMPFVFDFLWRAYLRTGDAKLRAAVTLTLERMA
    QGGIYDHLAGGFARYSTDSLWLAPHFEKMLYDNAQLIALMTLVWKTTRSPLLARRIAQTVAWAQSEMIGDNGAFAASLDA
    DSEGGEGRFYVWDEAEIDAALGEQAALFKQAYDVTPQGNWEGRTILNRATLSQPPTHASGLLDEGKEDAIDAALAPARAL
    LLDRRGQRPRPGRDDKVLADWNGLMIAALAEAGEALSRPEWVALGRSAFDAVVATMSREDGRLGHAWCAGRLGETALLED
    YAGMIHAALALHGISGEAAFLTQAQVWAETVERQYRDPRGGYFQSAADASALIVRTRGLIDSAQPSGNGLLAQGLARLFL
    LTGKELYRQRAEDILASYGASLSERFPHTVSVLAAFELLAAGIQVVLVNDDGRLGRVLAEAPSATLVVTRLSEGTPLPRD
    HPAFGKTALGGRPTAYVCRGPVCGRPLTQPDDLRQDLLGR

    >gi|83595040|ref|YP_428792.1| thioredoxin-related [Rhodospirillum rubrum ATCC 11170]
    MSLIFDGSGTPIKATTAPKSGSGSGALVKDSDTPRFAADVIEASREVPVIVDFWSPSSPACATLTALLERLVTQRAGAVR
    LVKINIDSNRELAAQLRLQSVPTIYAFADGRPVDGFMGALPEAEVKAFIDRLTGNAGDVIDEALAQADALRDQGDIDSAF
    DIYQQVLEQDQANPRAMAGALRCRLAQGANDEVREVLNRLPPALAGHAEIIALKSVLDLAEQAEKAGPTAELRARIAADP
    ADHQASIDLAVALFAAGDTEAAMDLLLESIRRDRAWNEEAARKQLLKFWEALGHTHPLTVGGRRKLSSILFS

    >gi|83595122|ref|YP_428874.1| molybdopterin biosynthesis protein [Rhodospirillum rubrum ATCC 11170]
    MDFTEEQIHRYARHILLPEVGGTGQARLLGARVLVVGAGGLGSPLVLYLAAAGVGTIGVIDADVVDLSNLQRQILHTTER
    IGMTKVDSAAAAVAAINPGVRLETHTERLTAANALELIGAYDLVADGSDNFPTRFLINDACHLLGKTLVSAAVLRFDGQL
    STFRTHQGGPCYRCLYPEPPPEGSVPT
    CAEAGVLGAVVGTMGSLQATEVIKELLGIGRSMAGRLLICDALAGGFREVRLK
    PDPACPLCGAQPTITDLSLHADQAEGSVCAG