Rhodospirillum centenum SW uid58805

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|209963455|ref|YP_002296370.1| hypothetical protein RC1_0108 [Rhodospirillum centenum SW]
    MAAIYRVEGMTCQGCANSVSRAIETQTGATRALVDLTAGTVSVEGQVSEAEVRSAIEAAGFDFKGTV

    >gi|209963469|ref|YP_002296384.1| dihydrolipoamide dehydrogenase [Rhodospirillum centenum SW]
    MADTQFDLIVLGAGPGGYVAAIRAAQLGMKTAVVEREHLGGICLNWGCIPTKALLRTAEVAHLIQHAKDYGITVEGPVRF
    DLAPIIKRSRQVAAQLSAGVKGLLKKNKVTVIDGSGRLLGKGRLAVEKDGKPAGEYAAKHIIIATGARARVLPGLEPDGR
    LVWTYKEAMVPERMPKSILVVGSGAIGVEFACFYRQMGVEVTLVEVLDRILPVEDEEISAIAAKQFTKQGIRIHTGTKVT
    KLEKAADSVTATLDLGGGRTETVTVDRVIAAVGIVGNVEDIGLEATRVKVERNHIVTDAWMRTDEPGVYAIGDVCGAPWL
    AHKASHEGVLCVEKIAGVQGVHPMDVRNIPGCTYSLPQVASVGLTERKAREAGHEVRVGRFPFIGNGKAIALGEPEGLVK
    TVFDARTGELLGAHMVGTEVTELIQGYTIAKTMETTEAELMHTIFPHPTLSEMMHESVLAAYGRAIHY

    >gi|209963776|ref|YP_002296691.1| alkyl hydroperoxide reductase C [Rhodospirillum centenum SW]
    MLTVGDKFPAFDLKAVVSTDPKTAFTQINNETYKGKWLVVFFWPKDFTFVCPTEIAAFGKLSGEFADRDAQVLGASTDSE
    FVHLAWRQHHADLKDLPIPMLADIKRELSGELGILHKLEGVALRATYIVDPEGVIRFASVHDLSVGRNVNEVLRTLDALQ
    TDELCPCNWQKGDEVLKAA

    >gi|209963815|ref|YP_002296730.1| Iron-sulfur cluster assembly accessory protein [Rhodospirillum centenum SW]
    MVALTDSAVQAARTAVEAAAGQAAGLRIMVRPAGCAGLQFGLQLEEGPGDADAVIRFEGLDVYVDQDSVPLLDAVTVDFV
    ERLEGAGFVFENAAPGGGCTCSTRSCH

    >gi|209963822|ref|YP_002296737.1| Iron-sulfur cluster assembly accessory protein [Rhodospirillum centenum SW]
    MSTTLKERPKALTLTDAAAERVRLLMARSSEPILGLRVGVKARGCSGMSYFVEYAKDRKKFEEVVEDKGVTILIDPAATM
    FLLGSEMDYVEDRFQSGFTFRNPNEKARCGCGESFTV

    >gi|209963843|ref|YP_002296758.1| protein-disulfide isomerase, putative [Rhodospirillum centenum SW]
    MRQNLRSTWTRRGFLGALALAAGIVALPLLAGPSALAQQPASLPGFDLARATEDKVIGDPKAPITIIEYASLTCSHCAHM
    HTDILPRIKAEFIDTGQAKLIFRDFPMDQVALTASMFSRCVAPERYFSMLSALFKSQKAWFAAKDPLAEVGKTARMAGLT
    PEQQEACLSNKQLETHILQTRLDGIKKYNISGTPTLILNDGAVVIDGAREEELINALVKLGAKRKAE

    >gi|209963968|ref|YP_002296883.1| thioredoxin-disulfide reductase [Rhodospirillum centenum SW]
    MATHRTKVLIIGAGPAGYTAAIYTARANLEPLLVQGMQPGGQLTITTDVENYPGFEHAVQGPWLMEQMQKQAEHVGTRMI
    GDLIVDVDFSRRPFVCKGDSGDEYVADAVIIATGAQARWLGVAGEQHYQGAGVSA
    CATCDGFFFRGRPVAVIGGGNSAME
    EALYLTHHASKVTLVHRRDSFRGERILQDRVLKNPKIEVVWNHVVDEILGEGGESFENPKRVTGVRLKHAQTGETREIAL
    EGVFVAIGHDPATRVFRGKVAMDDEGYILTAPDSTRTDVPGVFAAGDVKDKVFRQAVTAAGMGCMAALEAEKWLATLEGS
    PADAAAEASRPDMIGAWE

    >gi|209963970|ref|YP_002296885.1| thiol:disulfide interchange protein DsbD, putative [Rhodospirillum centenum SW]
    MPRLALLLPFVLLLALAVGLPTPAAANPVRTDHVEADLRAELPAAVPGEPLWLAVTQRIRPGWHTYWKNPGDSGIATEVT
    WTLPPGWQAGPLVWPAPERFPVGPLVNFGYKDEVHLLTRVDVPADAAPGGTVTIVAQADWLVCEDICIPESARLELTLPV
    AAGPVAPTPERAALFAQARRSLPVPSPFPATFLAGETAHQLVLSTGDLAGAELADAFFFPEHWSVTPAAAPQELRLDADG
    VRLVLPRSGALPAESVKGVLLLTERLEGREIRQALEIDAPIEAVPASGSPAPGRAAADTAALGVGLALLLALAGGAILNL
    MPCVFPVLSIKVLALVSHAPGRAPVHGAAYAAGVLATFAAVAGLLLALRAGGAQIGWGFQLQDPLVVAVLAYVMFLLGLW
    LSGVYELGGGAQGLGQGLAARGGYAGSFFTGVLATVVATPCTAPFMGTAVGFALLQPWPLALSVFLALGLGMALPFLLLT
    LSPALLRRMPRPGLWMERLKQALAFPLYATAVWLVWVLSIQAGPDAVAWVLGGMVLVAFAAWLYGVTRSSGTGWRLGASV
    FGVLALAGAVAMARVPALAGPAVPPPPSGTAAAAGDSVPFDEAALAALRAEGRPVFVNFTAAW
    CITCLVNERTSLSADAV
    KQAMAAKGVAYLKGDWTNRDAGIARVLEGFGRSGVPLYLLYRPGEAEPEVLPQILTPGLVLEALEALPDRAP

    >gi|209963971|ref|YP_002296886.1| hypothetical protein RC1_0638 [Rhodospirillum centenum SW]
    MTSPVSRRRFLSRTALAATALAATGGGGLLSVLLPRPARAAPVLGKAAPDFSATDIAGRAVRLADLRGNTVVLEWTNHLC
    PFVMKHYGGGNMQALQRDYTGKGVVWITVVSSAEGQQGHVTPAEAQRIVDEAKAAPTHKILDPKGTIGRAYAAKTTPHMF
    VIDPAGVLVYDGAIDDRPTARLEDLDGATSYVRAALDATLAGRPVAVPASQPYGCTIKYAKDAV

    >gi|209964138|ref|YP_002297053.1| Peptide methionine-S-sulfoxide reductase MsrA, putative [Rhodospirillum centenum SW]
    MGLFRSPRQNLPTAADALPGRAEPLPVGNIHAVNGHPLKPPFPAGLETAVFGMGCFWGVERKFWQVPGVYSTAAGYAGGP
    TPNPTYEEVCTGRTGHAEVVLVVYDPATVSYAELLKVFWENHDPTQGMRQGNDVGTQYRSAIYATTPEQLRLAEASRDSY
    ASRLKAQGYGAVTTEIREAPAFYYAEDYHQQYLHKKPWGYCGLGGTGVSCPLPTGVAAD

    >gi|209964162|ref|YP_002297077.1| OsmC [Rhodospirillum centenum SW]
    MSTLYSTTVTAIGGRNGSARSDDGLIDLRLSLPGGLGGKGDATNPEQLFAAGYAACFGNAVLHASRSGGPRLRDSDVEVA
    ATVGLSPTPSGGFGLSVALAVTLAGIDQSAAEALVAAAHRI
    CPYSNAVRGNIAVALSVTTR

    >gi|209964257|ref|YP_002297172.1| dsba oxidoreductase, putative [Rhodospirillum centenum SW]
    MVRPSSVAAALLAAFLAGTAALPASAAEPLDRKAVEQIVREYLLANPEIILEAVQALEKKQQDESAAATVEAIRSNREQL
    TASKASPVLGNPKGDLVLVEFFDYQ
    CGYCKHSQPERNAALKEDGKVKLVLKEFPILGPGSVVATKAALAARAQDRYAPLH
    EALMQHQGRLDEETVMQIAEKAGLDMAKLRKDMESESVQAEIDANLALARQLGIQGTPAFVIGDTLVPGAIEKDTFLELF
    KNARAAAKEKQG

    >gi|209964308|ref|YP_002297223.1| glutaredoxin-related protein [Rhodospirillum centenum SW]
    MDQTVHERIRRDITDNDVVLYMKGTPVFPQCGFSAAVVQVLSHIGVKFKGIDVLVDPALRQGIKEFTNWPTIPQLYVKGE
    FVGGCDIVRDMFESGELVPFFKEKGVEVPENV

    >gi|209964344|ref|YP_002297259.1| Iron-sulfur cluster assembly accessory protein [Rhodospirillum centenum SW]
    MATLATHGPASPTPPAAPSGRRVLLTASAARRIAHLAQQEGNPALMLRLSVSGGGCSGFQYGFSFDDSTNDDDHVYERDG
    SRLVVDEVSLDLLAGAEVDYVEDLMGSAFRINNPNASSSCGCGSSFSL

    >gi|209964463|ref|YP_002297378.1| 3-mercaptopyruvate sulfurtransferase [Rhodospirillum centenum SW]
    MVSDPLVSTQWLAEHLADPSVRVVDASWHMPGVARDPRAEHAAVRIPGAVFFDIDGIAAPDTDLPHMLPAAEAFAQAVSM
    LGIGSADTIVVYDSNGILSAPRVWWTFRVFGHAKVFVLDGGLPRWQAEGRPLEGSPPPMPAPRPFRARHDPSLVRDVGDM
    LAGLETGAAQIVDARPAGRFDGSVPEPRPGLRSGHMPGARNVPVSDLMDADTKTMLPAEALAARFRAAGLDLERPVVAS
    C
    GSGITACVLALALHRLGRTDVPVYDGSWCEWGARPDLPVETGPAGGTR

    >gi|209964466|ref|YP_002297381.1| OsmC [Rhodospirillum centenum SW]
    MSLTSTRQFDFMGGSGHRLSGRLDLPAGETRAAALFAHCFTCSKDHHASIRISRALAERGFAVLRFDFTGLGNSAGDFAN
    TDFSSNVGDLVAAARALADAVAPPRLLLGHSLGGAAVIRAASELPEVGAVVTVNAPFGPAHLRRLVAGREAEIAAEGRAR
    IEIGGRSFPITADFLEDIGDQPMAATLATLGRPLLVFHDPDDPVVPVENADRILAAARQPKSFIALDGAGHLVADREDAA
    HVAEIAAAWATRALRLAPADTAASPRNEVGRASVREAGDSRLGVLVTAGGRVFRADEPPPVGGGSGPDPYQLLLAALGA
    C
    TAMTLRLYAERKDWPLAGIAVDLAHGKTDGGDGRRIDRFERRLILDGPLDAAQKQRLLEIAERCPVHRTLESAPVIRTVL
    GGTDG

    >gi|209964471|ref|YP_002297386.1| hypothetical protein RC1_1159 [Rhodospirillum centenum SW]
    MAGPGRAEIEVEALDAMLKGGQPVAILDVREPWEVDLCSIDGSITIPLGQLPRHAAGLPTDRPLVGVCHHGFRSAQAVSW
    LRFQGFDRAVNLAGGIDAWARRIDPTMKVY

    >gi|209964567|ref|YP_002297482.1| DSBA-like thioredoxin family protein [Rhodospirillum centenum SW]
    MSMLIEIFSDLICPWCYLGWHRLDLALAQRPGLRAETRWLPFQLNPDMPAGGMDRFFYLAHRFGSLERARQLFAAVEQAA
    AQDGLPLHLGRIRRTPSTLEAHALVLLAERYGRAVQVAKALFRAYFVDGMDIGNRGVLIAVAGACGMDRTTVARHLEAGE
    DTAAVSASDARARSLGIQAVPCFVFNRQYGLAGAQEPAALLPLLDLAAVDAGPAASSPATGGMATDGRTLGLTG

    >gi|209964579|ref|YP_002297494.1| nitrogen fixation protein FixI (coupling cation pump) [Rhodospirillum centenum SW]
    MSLALFDLDTAPGDGLSARRPGEAGQAPGAGGCLHCGLPVPRPGDRFCCAGCEGAHALIHELGLDAYYRRRETAPAEPLQ
    ATEEVKLDLLSQVEDRPDGSHCLRMRVDGLT
    CGACVWLIETALAKQPQVEEVRVNLTTRRLTLRWSGPRERAEGLVATVR
    RLGYRLAPFDTAAENDPQARHERELLRCMAVAGFAAMNIMLLSVSVWSGHAGSMGDATRTLMHWLSALIALPTVLYAGRP
    FFRSAIAALRAGRSNMDVPISLGVTLASGISLWETMNQGQHAYFDGAVMLLFFLLIGRYLDSRARGRARSAAEHLLALAR
    APVTVLQPDGSIALSAPSAVPAGATVLVAAGERVGVDGAVAEGRSEVDTSVVTGETRPLPVEPGTRLFAGMLNLSAPLRV
    TVTASGEGTLLAEIVRLMEAAEQGRARFVALADRVARHYTPVVHTLALGTFLAWTLGVGLDWQPALLIAVAVLIITCPCA
    LALAVPAVQVVASDRLLRQGTLLKSATALERLATVDTVVFDKTGTLTLGRPELLPDAGRDAAVLDRAATLARNSRHPLSR
    ALARAAGPGPVAIGVRELPGRGLELDTADGTVRLGSRAFVGAPAAAAPGPSGAVADAELWLAEPGRAPVRFAFADRARSD
    AATVVSDLRRAGYRVELLSGDRPEAVAALAAETGLDDWRGGVDPAGKCARLAELRAAGRRVLMVGDGLNDAAALAAADVS
    ASPASAVDIAQTAADAVFQGDRLAPVADLLAVARMADRLVRQNLGFTLIYNMCAVPIAMLGHATPLVAAVAMSSSSLIVI
    GNAMRLSGRRTGARAGGGS

    >gi|209964681|ref|YP_002297596.1| glutathione peroxidase, putative [Rhodospirillum centenum SW]
    MRRLALMLSLLVATLSAGPAAAAATTGAHAFSFVSIDGRPLPLSDFAGRAVLVVNTASQCGFTPQYEGLEALWQQYRDRG
    LVVLGVPSNDFGGQEPGSAAEIKTFCETTFGIDFPMTEKVAVKGDTAHPFYRWAAAAKGAPRWNFHKYLIAPDGTLLAGF
    ASDVRPESADLRAAIEDALPR

    >gi|209964706|ref|YP_002297621.1| hypothetical protein RC1_1404 [Rhodospirillum centenum SW]
    MAAETPICNFGWKAVDFRLPGIDGRDYSLKDVAGPNGLLVMFICNHCPYVQAVIDRLVRDVTALKPHGIGAIAVMSNDTE
    RYPDDSFENMKRFARAHDFTFPYVIDATQEVARAYDAVCTPDFFGFNAALELQYRGRLDASRKQAVADAEPELLNAMIQV
    ARTGRGPEHQIPSMGCSIKWREEA

    >gi|209964890|ref|YP_002297805.1| glutathione-disulfide reductase [Rhodospirillum centenum SW]
    MPAYDFDLFTIGGGSGGVRAARIASQHGARVGLAEEGRLGGTCVNVGCVPKKLLVYAAQYAHDMEDAAGYGWTVGERTHD
    WPRLIAAKDREITRLNGIYRRLLEGAGVTLFEGRARIVDPHTVEVAGQRVTAERILVATGGWPELPGEPGAREYGITSNE
    VFHLERFPERVVVAGGGYIATEFACMFNGLGAKVTQIYRGKQILRGFDRDVREVLTEELVRSGIDLRLNTVIDRVEKAGD
    CLLAELSDGSAVECDAVVYAIGRRPMSRGIGLEEAGVALDAAGAVIVDGGYRTSVPSIYALGDVTNRVNLTPVAIAEGHA
    LADTLFGGNPRDVCYDNIPTAVFSIPPVATCGLTEEEARQRLGAVDIYRTTFKPMRHQLTGRDQRTLMKLVVDRASQRVV
    GCHMVGADTPEMIQGVAVAMNAGATKQVFDRTIGLHPTAAEEFVTMRTKAPDPEAPDRKD

    >gi|209964925|ref|YP_002297840.1| bacterioferritin comigratory protein, putative [Rhodospirillum centenum SW]
    MTVAEKTVDVGSPAPDFTLPTDGGGSVTLSQLRGRTVVVYFYPKDDTSGCTKEACGFGEAMPDFGKVDAVIIGISKDSVA
    SHDRFKAKYSLPFILASDEGSDVTERYGAWVQKSMYGRTYMGIDRSTFLIDKEGVVRAVWRKVKVPGHVEAVLAAAKGL

    >gi|209965456|ref|YP_002298371.1| organic hydroperoxide resistance protein [Rhodospirillum centenum SW]
    MPVDVKYRTEATATGGRDGRARTADGSLDVRLSTPTELGGGGGEGNNPEQLFAAGYAACYLGALKLVARQEKVTVSPDAT
    VTATVGIGPRSDGGFGLEVALRVDLPGVEREQAEELVRKAHQV
    CPYSNATRGNLDVRTTVA

    >gi|209965544|ref|YP_002298459.1| dihydrolipoamide dehydrogenase [Rhodospirillum centenum SW]
    MADMQFDLVVIGSGPGGYVAAIRAAQLGLKTACVEMRDTLGGTCLNIGCIPSKALLTASEKYEEAKHGLGGFGVKVTGVE
    LDLPAMMAHKTRVVQSNVEGVQFLFKKNKVARFHGRGVIDAPGVVKVVKPDGAAETLTTKNILIATGSDVMPLPGVTIDE
    KRIVSSTGALDLDKVPGRLVVIGGGVIGLELGSVWQRLGAQVTVVEFLDRILPGMDAEVSKHAQRILGKQGLSFKLGTKV
    TGARMNAESVTLTLEPAKGGGETTLEADIVLVAIGRRPYTEGLGLETVGVALDSRGRIVTDHHFRTNVPGIWAIGDVIAG
    PMLAHKAEEEGVVAAEVMAGQSGHINYDAIPGVVYTWPEIAAVGRTEEQLKEAGIAYKVGKFPFTANGRARAMQVTEGFV
    KVLADARTDTLLGAHIIGANAGDMIEELALALEFGASSEDVARTSHAHPTLTEAIKEACLAVDGRPIHI

    >gi|209965564|ref|YP_002298479.1| mercuric reductase, putative [Rhodospirillum centenum SW]
    MAETIDTDILVIGAGSGGLSVAAGTAQLGRPTVLVEKGRMGGDCLNTGCVPSKALLAAGRAAHAVRTAGRFGIVATEPAV
    DPAAVRAHLRGVIAAIEPNDSVERFTGLGVRVLPAAARFTGPDTVETDAGQRIRARRIVVATGSRAALPPIPGIESVPVL
    TNETVFERLPLGGHLLIVGGGPIGVEMAQAFRRLGTRVTVLERATLLPKDDPELVEVVRDSLRDEGVEIVEGAEILRLEP
    GPGGGVAAVLREAGSGGERRIEGTDLLVAAGRSPTVEGLGLDAAGIAWTPTGITVDAHLRTTNRRVYAVGDVTGGPQFTH
    VAGYQAGLVVRNMLFRLVPARADYAALPRVTYTAPELAQVGLTETEARERHGDGVRISRWPLHENDRAQAERETAGLAKL
    VLDRRGRILGAGIVGAQAGELIQPWVLALSRRLSARAFTAVMVPYPTLGEVGRRAAGAFYSPALFSDRTRLLVRVLSRFG


    >gi|209965777|ref|YP_002298692.1| thioredoxin, putative [Rhodospirillum centenum SW]
    MQPSFPATPAPKPTVPGDIIKDGSDATFMADVIEASRTVPVLVDFWATWCGPCKQLGPALEKVVTAAKGAVRLVKIDTDK
    NPMVAGQLRIQSIPAVYAFYQGRPVDGFVGALPESQLKQFVDRLLQATGAAAPGGDDIATVLEEAKQILDQGDAEGAAAV
    YNEVLQAEPENAVAYVGLVRCLLAVGQTDDARKLIEGAPAAIAKSPELAGLKSQLDLADQARQAGPVPELMNRLARDPDD
    HQTRYDLALALYAAGKAEAAVEALLEIVKRDRDWNEQAARKQLLKFFEAFGPTDKLTVMARRKLSSILFS

    >gi|209965811|ref|YP_002298726.1| glutathione S-transferase, putative [Rhodospirillum centenum SW]
    MPTLYGCPGCGSAAVEAAFTLAGEPYEYILTDPGGDPATVARLHAVNPMGQVPALLLEDGTVLTESAAILLWLADRHPRL
    APAPGDPARAPFLRWLLFLAGAVYPMYTVGDFPERWVGGEAAQRELRTATVARILSCWRTLEQALDPAPLLPGPRLSGPW
    LLGAEPTLLDIYAATLSRWRPGRDRIRVVAPRVIAACERAEALPALAPVWARNFPEG

    >gi|209965932|ref|YP_002298847.1| glutaredoxin 3 [Rhodospirillum centenum SW]
    MPKVEIYTSPFCPYCVRAKRLLDAKGVAYEEIDVMEQPGRRAEMTRRAEGRTTVPQVFVDDRGLGGCDDIHALDREGRLD
    PLLGLAG

    >gi|209966075|ref|YP_002298990.1| hypothetical protein RC1_2806 [Rhodospirillum centenum SW]
    MADPANLLGQETSPYLLQHKDNPVHWMPWGPAAFARARAEGKPVLLSVGYAACHWCHVMAHESFEDPTIAAMMNDLFVNV
    KVDREERPDVDQIYQSALGLLGQQGGWPLTMFLTPEGEPFWGGTYFPPERRWGRPGFPDVLLGVSTTYRQEPDKVVRNTT
    ALKDALHRLAQNRPGAGVDVDLLDEVAARLVQEVDPVHGGIGSAPKFPQTGIVELLWRAWKRTGREDCRAAVVTTLTQMS
    QGGIYDHLGGGYARYSTDQEWLVPHFEKMLYDNAQLIDLLTTVWQDTRDPLFEARVRETVGWVLREMVSEPGRPVGGGFA
    ATLDADSEGEEGRFYVWTWAEVDRLLGDRAETFARAYDVTERGNWEGTTILNRLKRPEPGTPAEEGALAEMRAVLFQARG
    ARVRPGWDDKVLADWNGLMIAALARAGAVFDEPDWIAAARRAYDFVRTHMQDADGRLWHSWRAGTLRHRGTLDDQAAMAR
    AALALFEVTGDGTCVEQARRWAAVADAQFWDTESGGYFLTAADATDLIVRPRNAQDNAVPSGNGTMLGVLARLWLITGEE
    GWRRRADALVTAFGGEPGRNFFPLATFLNNVELLHRAVQVVVAGDPAAADTGALLRAVHGAGLPTLVLTPVTPGTALPDG
    HPAAGKGMVGGRAAAYVCRAMACSLPVTDPAALAALLREDRVTPPPAP

    >gi|209966105|ref|YP_002299020.1| thioredoxin [Rhodospirillum centenum SW]
    MSNATAVSDASFTTDVLEASGPVLVDFWAEWCGPCRMIAPALDEIAGELQGKLTVAKLNIDENPGTPTRYGVRGIPTLMI
    FKDGKVAATKIGALPKQQLRNWIEENL

    >gi|209966234|ref|YP_002299149.1| ADA regulatory protein, putative [Rhodospirillum centenum SW]
    MIDRPQPVSRSRMIPAADLPFAGSPLAAPVPEDDPAADRLVAAAIERLARDWQAPPDLDALAAEAGMSPGHFQRVFKRRA
    GISPKRFAQFVTLGHARRLLREGAAGGLLGASLDLGLSGPSRLHDLFVVAEAATPGEYKAGGAGVAIRYGFHDGPLGRVL
    LAATGRGLCFLGFVPEGEEARGLAELRQDWPGASLTEDPAATAPAAAAIFGPVHDGGLDGGRPDGGGRAGGPLTLHLRGT
    NFQIKVWQALLEIPFGRVATYADVARSIGHPTSARAVGNAVGANRVSFLIP
    CHRVIRGTGVLDNYRWGPVTKRALLAWEG
    ATTATGR

    >gi|209966285|ref|YP_002299200.1| cytochrome c biogenesis protein CcmG [Rhodospirillum centenum SW]
    MSRLLIALPLILFAALAGVFVYLLVLKPEITGQQHDPTLLPSMLIDRPMPALDLPPLYEGQPGVTTAELKGTPQLVNIFA
    SW
    CTPCRIEHPVLMRLSKEEGIVVRGIAYKDKPEDSRRFLEQFGNPFTTIGVDQDGRAGIELGVTGVPETFVLDGQGRIR
    YRHQGPLGPAVVDKEILPLLRDLSR

    >gi|209966313|ref|YP_002299228.1| molybdopterin biosynthesis protein MoeB [Rhodospirillum centenum SW]
    MTPASPLSDDQIERYARHIMLKEVGGRGQERLLASSVLVVGAGGLGSPLLLYLAAAGVGRIGVIDHDSVDLSNLQRQVIH
    DGASVGRPKVESAAARIAALTPDVRVEAHAERLTPANVLGLVSRYDVVADGSDNFATRFLLNDACFFAGKTLVSAAMLRF
    DAQLSVFKAHLGEPHPCYRCIFREPPPPGTIPS
    CSEGGVLGALPGAMGSLQAIEVLKELLGIGESLSGRLLLVAALETSF
    RTVRVRRDPGCPLCGGDPVYRDLSHHLPPQGQAAHG

    >gi|209966416|ref|YP_002299331.1| thioredoxin reductase [Rhodospirillum centenum SW]
    MSPTIHKTDVVVIGAGPVGLFAVFECGMLKMRTHVVDALDMLGGQCTALYPEKPIYDIPGHPAIEAAELIDRLAAQAAPF
    APTYHLGQQVETLTRLEDGGWRVGTSRGVQIDCKAVIVAAGVGAFGPNKPPLDGLEAYEGRSIFYLVHRRQAFAGQRVVI
    AGGGDSAVDWAISLAEVAARVMVVHRRPKFRAAPESVGRMEALAAEGRIEMVIPYQLSGLEGTAGRLTGVRVADLEGVEK
    VLEADVLLPFFGLAMNLGPIAEWGMELEKGHIRVDPRTLATSQPGIHAVGDIAHYPGKLKLILCGFSEAAMAAHAVHPLV
    HPGEALSFQYSTSKGVPGAD

    >gi|209966648|ref|YP_002299563.1| transferase, putative [Rhodospirillum centenum SW]
    MGLLVDGIWHDEWYDTAKTGGRFVRSESQFRDRVTADGSSGFPAEAGRYHLFVSLACPWAHRTLVYRALKGLEEAITVSV
    VDPLMLEHGWAFGPPGSDARDPLTGARYLYEVYLAARPGLSGRVTVPVLWDKQRRTIVNNESGEIIRMLNREFDAVATRT
    VPDLYPPALAAEIDALNARIYDTVNNGVYKAGFATAQDAYEEAAEALFGTLDWLEQRLETRRYLLGDRPTEADWRLFTTL
    VRFDTVYYSHFKCNRRQIRDYPALWGYVRDLYQTRDVAGTVNLDHIKRHYYVSQRTINPSQVVPIGPEIDFGTPHGRERL
    AGG

    >gi|209966762|ref|YP_002299677.1| Sco1 [Rhodospirillum centenum SW]
    MTPSRVLRIAIGILAGLILAALVAFWTVRQDAGRAGGVPAGAIATPGVTIGGDFRLVDETGREVTSADYAGKYRLIFFGF
    TFCPDI
    CPTELQLIARALDALGPDAAAVQPLFVSIDPERDGPAQLAEYTDMFHPAIVGLTGTPEQVAAAARAFRVYYAKA
    PAADGSTYTMDHSTYTYLMGPDGGFLTVFPRGTGAGEIADAIRQYIRSASR

    >gi|209966808|ref|YP_002299723.1| thioredoxin reductase [Rhodospirillum centenum SW]
    MPGDVLDALVIGGGPAGLTAAIYLARYRRNFLVVDAANARCAWIPRSHNHPGFPDGINGVELIQRMRCQAERYGAAVQRG
    RIVRLDRTSDGFVAEAADGDVWRAPLVLLATGVIDIDPGLPDQYESVRKGLVRY
    CPICDGYEVTGERVAVVGSGEHAVRE
    AEFIRPYAGTLTLLTLGGRLTAGQHDRLVAAGIGLEQGRPLRVTVEAGRVEAFHFPGGRCLDFDSVYSAMGIAPRNELAR
    GLGADLAEDGRVRADPHQETSIPGLFAAGDIAPGLNQITIAQAQGAIAATAMHNRLREHPRGRLREHPRGR

    >gi|209966815|ref|YP_002299730.1| thioredoxin 2 [Rhodospirillum centenum SW]
    MSDNHPAPHPPRADRLHLVCPSCGTTNRLPRDRLDSGGHCGSCKAPLFQGRPVDLTAAALVHHLKVDDIPLLLDVWAPWC
    GP
    CRAMAPDFARAAAELEPHVRLGKLDSDAEPAAAQQLGIRSIPTLVLFHGGRELARSSGALPAAHLIAWTRQELSRAGV
    TL

    >gi|209966892|ref|YP_002299807.1| peroxiredoxin, putative [Rhodospirillum centenum SW]
    MSIKVGERIPSVTLKHLTESGMQEIGTDEIFAGRKVVLFAVPGAFTPTCSAKHLPGFVEQAEAIRAKGVDQIVCMAVNDP
    FVMHAWAKANNVNGRILMLPDGNGTLTRALGLEMDGTAYNLGLRCQRFALVAEDGVVTALNVEKPGAFEVSSAEAVLKLL


    >gi|209966946|ref|YP_002299861.1| arsenate reductase, putative [Rhodospirillum centenum SW]
    MAVVIHHNPACGTSRNVLTMLRAAGYEPVVIEYLKTGWTEPQLRGLFAAAGLTAREALRSRGTPAEQLGLLDPTVSEEEL
    IAAMVRHPVLVERPIVCTPKGVRLCRPSETVLDLLDRLPPGPLAKEDGELVIDGAGRRIR

    >gi|209967092|ref|YP_002300007.1| rhodanese-related sulfurtransferase, putative [Rhodospirillum centenum SW]
    MPQIESFGMAELANYTPEEVRAALEAGQITLIDVRTPHEYALEHIQGALLSPMPFLEPRYLPVAEGARPIVFHCGSGMRS
    RIVAQRCIDSGFTRVAHMVGGMAAWKQAGLPYIATDLATGGPVWKPEAAKA

    >gi|209967093|ref|YP_002300008.1| OsmC-like protein [Rhodospirillum centenum SW]
    MQALPHIYLTKATGTAQGNVRLEAEADVPALDTAAPPQFGGPNGFWSPETLFVGAVADCYILTFRAIARASKLEWESLEV
    DVEGVLDRVEGVNRFTRFTVKPRLLVKAAADAERATTLLEKAERT
    CLITNSLTAEIHLEPSVGVAA

    >gi|209967281|ref|YP_002300196.1| glutathione peroxidase, putative [Rhodospirillum centenum SW]
    MSEFHSLHARSLRGQDVPLSRFAGQVALVVNTASKCGFTPQYAGLEALYRKYADQGFVVLGFPCNQFGNQEPGDAATIEG
    SCLVNYGVSFPMFEKVDVNGPQAHPVFRWLTTRLPGLFGQGIRWNFTKFLIGRDGRPLRRFAPMTKPEGIEAHVRAALGQ


    >gi|209967340|ref|YP_002300255.1| Thiol:disulfide interchange protein TlpA [Rhodospirillum centenum SW]
    MAILRRPAMPVLALAAILLLAACGEQDQGGSRTAGETTGQAAGQAAAGGGTLAESLAPFTVTGTPQPAPDIAFTDRDGRP
    VTLAAFRGKVVLLNLWAVW
    CPPCVKEMPSLDRLQAALGGDDFQVVALSQDRGGAAQVLPFYEKAGIAHLPVYLDPQTAAM
    AALKARGLPTTYLIDREGRLLGRLEGEAAWDAPAALDLIRHVIAGRY