Rhodopseudomonas palustris TIE 1 uid58995

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|192288447|ref|YP_001989052.1| copper-translocating P-type ATPase [Rhodopseudomonas palustris TIE-1]
    MLQTRDFSHYVKDVDGRIAHLDLAVEGVHCASCMAKIERGLQSIPDVTLARVNLTDRRLAVEWNKGSTLEPGQFIDRLAE
    LGYKAYPYEPVRAEVEEAERTKFLLRCLGVAVFATMNVMMLSVPVWYGGDLSPEARDFFHWLSALVALPCAAYAGQPFFQ
    SAFRALKAKSVNMDVPITIGITLALGMSLVETINHAEHAYFDAAVMLIAFLLAGRFLDQKMRQKTRAVAGNLAALKAETA
    TKFVGPDEISEVPIAAVRAGDIVLLRPGERCAVDGTVIEGRSEIDQSLITGETLYVPAERGTQVYAGTLNISGTLRVRVA
    AAAEGTLLSEITRLLDHALQARSRYVRLADRASQLYAPVVHATALLTIIGWVLAGASWHDAIVIGIAVLIITCPCALGLA
    IPAVQTVASGAMFRAGVLLNAGDAIERAASVDTIVFDKTGTLTLPELDVVNAAGIPLEVFDLAGRLALASHHPVAAAVAR
    AAHAKSPLPNVVEEPGRGVRTVFGGQELRLGSPAFCGADAEANQILSEDPEVSVVAFSRGEQRVVFAVRQLLRPDAAKTI
    DALTNRGIAVELLSGDREPAVRHAAAALGVSAWRASVTPAEKIAHIEALKKQGRIVMMVGDGMNDAPSLAAAHVSMSPIS
    ATHLSQATADLVFLGKELAPVLAAVDYSRKAMAVMRENLGLAIGYNVLAVPIAIAGYATPLIAALAMSGSSLLVMLNAMR
    ARRVRRGAASWK

    >gi|192288477|ref|YP_001989082.1| Glutathione S-transferase domain [Rhodopseudomonas palustris TIE-1]
    MYTLFHHPFCPLSRFIRLALGEHGLDLRLVEERSWERRTAFLALNPAGTTPVLVAEGRPPIPGAGVIVEFLDEVHGVEMG
    DRRLLPQSTAERIEVRRLLSWFNDKFFEEASGPLMTERIYKRFMSEEDGGGPPAMDVIRAANANVRYHLAYIGWLARTRN
    FLAGDRMTYADLAAAAHLSAIDYLGDVPWIEDEAAKAWYARIKSRPSFRPLLSEWLAGVPASRTYVDLDF

    >gi|192288509|ref|YP_001989114.1| thioredoxin [Rhodopseudomonas palustris TIE-1]
    MAVGKVSDADFENEVLNAQGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVDESPVTASKYGVMSIPTLMIF
    KGGEMASRQVGAAPKAKLQQWISAAV

    >gi|192288522|ref|YP_001989127.1| UBA/THIF-type NAD/FAD binding protein [Rhodopseudomonas palustris TIE-1]
    MLSAEELERYARHIVLRDVGGPGQAALKGARVLVVGAGGLGAPVLMYLAAAGIGTLDIVDDDIVTLSNLQRQVIHATPDI
    GARKADSAASRILALNPHVRVVQHRVRLDGSNALTLIGGCDLVLDGSDNFATRYLVSDACYLAKKPLITAALGQFDGSLT
    TIRAHECNAAGEPNPTYRCLFPEPPPAGTVPS
    CEEAGVMGALAGVLGSMMALEAIREIVGFGEGLVGRLVMIDARAMRFE
    TLRYSRDPQNPLNGDAPTITDLSRHL

    >gi|192288613|ref|YP_001989218.1| dihydrolipoamide dehydrogenase [Rhodopseudomonas palustris TIE-1]
    MATYDLVVIGTGPGGYVCAIRAAQLGLKVAVVEKNATLGGTCLNVGCMPSKALLHASELFEEAGHSFAKMGIGVPAPKLD
    LPAMMNFKQQGIDGNVKGVEYLMKKNKIDVLVGKGKILGTGKVEVTGADGKASSVDTKSIVIASGSAVAQLKGIEIDEKR
    VVSSTGALSLDKVPGKLIVVGAGVIGLELGSVWRRLGAEVTVVEFLDRILPGMDGEVVKQFQRILEKQGFAFKLGAKVTG
    VDTSGAKLAVKVEAAAGGNPETLEADVVLVAIGRVPYTEGLGLKEAGVALDERGRVVIDDHFATSLKGVYAIGDVVRGPM
    LAHKAEDEGVAVAELIAGKAGHVNYDVIPGVVYTTPEVSSVGKTEEDLKQAGVAYTVGKFPFTANGRSKVNQTTDGFVKI
    LADAKTDRVLGVHIIGREAGEMIHEAAVLMEFGGSAEDLARTCHAHPTRSEAIKEAALTVGKRAIHM

    >gi|192288629|ref|YP_001989234.1| protein of unknown function DUF1223 [Rhodopseudomonas palustris TIE-1]
    MNGVGGFSRWSGALGLCVTIATADLAAAEPRAVVELFTSQGCSSCPPADRIIGELARDPSVIALSLPIDYWDYLGWKDTL
    ADSRFTARQKAYSQVRGDRDVFTPQVVVNGSAHLVGSNRAGIDSAIKTTDKTGGVMTVPVSVAVEGKEIKVSVAAAPQGE
    TAKSGEVWICAVSKAIPIEIGRGENRGRHVTYHNVVRNLLKVGDWTGAAEHWTVPLENVVGDGVDAAAVYVQNGSREKPG
    AMLGAAFTSLN

    >gi|192288635|ref|YP_001989240.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Rhodopseudomonas palustris TIE-1]
    MSDTFDPASPKRRSWLVVLPALLFAGLAVLFWFRLGDSDVSRIPSALIGRPAPQTPLPPLDGLSRDGSQVAGLDPAMFKG
    KVSVVNVWASW
    CVPCHDEAPLLMTLAQDTRIQLVGIDYKDKPDNARRFLGRYGNPFAAVGVDASGRAAIEWGVYGVPETF
    VIGRDGKIAYKLVGPITPDNIEKVLKPEISKALAAPQS

    >gi|192288699|ref|YP_001989304.1| thioredoxin [Rhodopseudomonas palustris TIE-1]
    MTILEQGSGAAPQAAADLIKDTTTQSFVRDVIEESKRQPVLIDFWAQWCGPCKQLTPILEKAVRAANGKVKLVKMNIDEH
    PSIPGQMGIQSIPAVIAFVDGRPADGFMGAVPESQVNAFIEKLTAGMPGGAPTAAELLQEAEAVLAEGDVQTAASIYAEV
    LRADGTNVAAIAGLARCYMQTGATEQAKKTLGLVPEAKREDAAVKAVQAMIDLAEQAQSLGPIAELEQKVAADPLDHQAR
    FDLAIALNAADRREDATTHLLDIVKRDRKWNDDGARKQLVQFFEAWGPTDDATVEGRKRLSTILFS

    >gi|192288775|ref|YP_001989380.1| transcriptional regulator, AraC family [Rhodopseudomonas palustris TIE-1]
    MAARAAADNISGMMNLAIADHQLIKPGARDSALADYDCVRRAIAFISQKWKAQPTIEAIADAAGLTPDELHHLFRRWAGL
    TPKAFMQALTLDHAKSLLRDSASVLDAALASGLSGPGRLHDLFVTHEAMSPGEWKSGGAGLSLRYGFHPSPFGTAVIIAS
    DRGLAGLAFADPDEEQAALVDLQQRWPRAVCTQDQDATAPLARRIFDPAQWRAEQPLRVVLIGTDFEVRVWETLLKIPLG
    KAVCYSDIAAKISLPKASRAVGAAVGKNPISFVVP
    CHRALGKGGALTGYHWGLTRKQAMIGWEAGQLRAE

    >gi|192288808|ref|YP_001989413.1| thioredoxin [Rhodopseudomonas palustris TIE-1]
    MSDHLVVCTHCGGVNRLPEQRPALDGKCGKCGHRLFEGHPADVSGDQFDKQVSRSSVPVLVDVWAPWCGPCRAMAPAYEQ
    AARELEPNVRLIKLNSDNEQQVAGRLGIQGIPTMILFDNGRERARTSGAMPAGEIVRWVRQHLPA

    >gi|192288987|ref|YP_001989592.1| Methyltransferase type 11 [Rhodopseudomonas palustris TIE-1]
    MSGFLLLLLPPALWIGWRMASRRTVLPCPSEIAWLVEMENPLARATRSEQVVAQLQPRPGDHAIDIGCGPGRVTLPLARA
    VGPNGQVTALDVQDGMLAKVAAKAAAEALTNIRLLRADVREASVPSGSLDAAVMVMALGEFPSGTEIFPSVHRMLRPGGR
    LLIAESVFDPHYVSRRHVRERVSAAGFRELR
    CVGNAFGYSVTFERT

    >gi|192289032|ref|YP_001989637.1| glutaredoxin 3 [Rhodopseudomonas palustris TIE-1]
    MPAAIEIFTRPGCGYCSAAKSLLNRKKAAFTEYDVAVDPGFRVKMDERAGPGATYPQIFIGDLHVGGCDDLYALDREGKL
    DALLADEKAAS

    >gi|192289325|ref|YP_001989930.1| OsmC family protein [Rhodopseudomonas palustris TIE-1]
    MSVEKVLYRATATATGGRDGRGVSSDGHLDVALTTPKELGGAGGAGTNPEQLFAVGYSACFLGAMKFVAGRDKLPIPKDV
    SVTGSVGIGPIPTGFGIEMELKISLPGMDPAQAQTLVDRAHIV
    CPYSNATRGNIDVTLTLV

    >gi|192289600|ref|YP_001990205.1| Rhodanese domain protein [Rhodopseudomonas palustris TIE-1]
    MAMSVKTISPIEAHRLVTGGRAVLVDVRERHEIAREHIDGAIELPLTGFKHGDLGAARGRKAIFFCHSGGRTRMYAGQIE
    AKASGVCEPYVLGGGILAWRKAGFPTVQGPKPPSLFQRLFGRKPAD

    >gi|192289602|ref|YP_001990207.1| nitrogenase-associated protein [Rhodopseudomonas palustris TIE-1]
    MAKVVFYEKPGCVGNARQKALLTASGHELEVRNLLAEPWTRETLRPFFGDKPLIEWFNQSSPKVKAGAIDFAALGVEAAL
    ALMIEDPLLIRRPLMQSGGRREVGFDQATVHAWLGLQTGGPRVFDGCAMDD

    >gi|192289624|ref|YP_001990229.1| DSBA oxidoreductase [Rhodopseudomonas palustris TIE-1]
    MMITRRSAVTAALALAPTLVAAKAWAAPTAPDAEDVLSTDAVLYDAEIPVAGNPKGDITIVEWSDYRCPYCKKVAPDLTQ
    VVKEDGNIRLVLKDWPIFGGVSVDAAKMVLASKYQGKFLQAHEALIGSTSKLTETTLNETLKAGGIDVDRATKDLDANRA
    TIEAILKRNDTQAKAFGFQGTPSFIVGRFRVPGVLDVALFKQAIKDAREAAKKTDKK

    >gi|192289692|ref|YP_001990297.1| alkylhydroperoxidase like protein, AhpD family [Rhodopseudomonas palustris TIE-1]
    MHKNWIDLTGELSVALREVRTGAPDVMKGFSAIAQAALKANALDTKTKELIALAISVATRCDGCIGFHAEAAVKHGATRD
    EVMETMGMAIYMGAGPSVMYAAQAVEAYDQFVKKKAAATSPAE

    >gi|192289716|ref|YP_001990321.1| alkylhydroperoxidase like protein, AhpD family [Rhodopseudomonas palustris TIE-1]
    MTPRLNPAAAAPDAYKAMVALEKYIQGSGLEPSLIELVKMRASQINGCAFCLDMHSKDARARGESEQRLYLLNAWRESPL
    YTDRERAALGWTEALTLVAQTQAPDQDYAAVKSHFSDAEQVNLTLLIGAINTWNRIAIGFRMLHPIPAVAHAKAS

    >gi|192290193|ref|YP_001990798.1| glutaredoxin-like protein [Rhodopseudomonas palustris TIE-1]
    MSIEQFIDNEVKANDVVLFMKGTPQFPQCGFSGQVVQILDHIGVPYKGHNVLENAELRDGIKVYSNWPTIPQLYVKGEFV
    GGCDIVREMFQAGELQKLFTDKGIKAAA

    >gi|192290323|ref|YP_001990928.1| OsmC family protein [Rhodopseudomonas palustris TIE-1]
    MPTERFQFAGSGGHQLAAALDLPDAQPLAYALFAHCFTCSKDNLAARRIAAALAACGIAVLRFDFTGLGASEGEFENATF
    SSNVADLVLAADHLRATHRAPSLLIGHSLGGAAVLAAAAQIPEAKAIATIAAPSDPSHVTGLFADDIETIRTEGRVNVSL
    AGRPFTIKREFLDDIAEHNLMAEIGKLHKALLILHAPTDDTVGIDNATKIFLAAKHPKSFVSLDHADHLLSDRRDANYAA
    GVIAAWAQRYIDAEPPAPTAGAPEVPRLVTVQETGDGKFQQQISVGPHRLLADEPANVGGRDSGPGPYDLLLSALGA
    CTS
    MTMRLYAERKALPLDRVTVTLSHAKIHAEDCAECETKVGLLDRIERVIGIEGDLSAEQRAKLIEIADKCPVHRTLTSEVS
    IITRSTD

    >gi|192290587|ref|YP_001991192.1| glutathione-disulfide reductase [Rhodopseudomonas palustris TIE-1]
    MADFDADLFVIGGGSGGVRAARIAAGYGARVVVAEEYRFGGTCVIRGCVPKKLMVYASQVHEEIRDAAGFGWSIPTAEFN
    WSALIANKDKEIARLEQIYANNVEKAGARTIKARAVFDDPHTLLLSTGEKVRAKTILIATGGAPNHGKPIPGIEHVISSN
    EVFHLPQQPKRILIQGGGYIALEFACIFAGLGSDVTLVYRGDNILRGFDEDVRTHVRTEMERAGITIITGCTVTAVEKLG
    EEYTSHLSSGSSIASDQVMFAIGRHPAVANLGLEKAGVAINPDNGGIAVDDHCRTSVPHIYAVGDVTHRTNLTPVAIREG
    HAFADNVFGGKQIQVDYAYVPTAVFSQPQVGTVGLTEAQARAQYSVVDIYKTDFRPMKGTMSGSQSRVLMKLIVDGTTDR
    LLGCHIVGPDAAELVQVVAVAMKMKATKADFDGTMALHPTAAEELVTMRTRTARYQREAAE

    >gi|192290614|ref|YP_001991219.1| Rhodanese domain protein [Rhodopseudomonas palustris TIE-1]
    MAGQVEDLTPQEVAKGIADGRYLLVDVREPNEVAVEAYPDAVVVPLSTFDPKAIPDPAGKEVVFACRSGKRSVTASMAAQ
    AAGLPYNRHLAGGILGWKAAGLPTKPGH

    >gi|192290897|ref|YP_001991502.1| arsenate reductase and related [Rhodopseudomonas palustris TIE-1]
    MPTTLYGIKNCDTMKKARTWLDGHGVSYAFHDYKTAGIDQEHLERWAKQAGWETLLNRAGTTFRKLPEADKEGLTEAKAI
    ALMLAQPSMIKRPVLEHGRKLLVGFRPEAYAEAFG

    >gi|192291099|ref|YP_001991704.1| DSBA oxidoreductase [Rhodopseudomonas palustris TIE-1]
    MLSFRPLATALLALAIVGAPAVASAQKFSDEQRSQIETIIKEYLVSHPEVLEEASEELGKRQAAAQAEKHQQAIKDNADI
    IYNSPRGVTVGNKNGDVTMVEFFDYN
    CGYCKRAMTDMMELMKDDPNLKVVLKEFPVLGPPSVEAAQVAIAVRMQDPTGKK
    YLDFHQKLLGGRGQADKARALAAAKDAGLDPAKIEKDMNSPEVRATIEESFKLAESMGMNGTPSYVIGKQVVVGAVGLDT
    LRQKINTARCGKDKC

    >gi|192291100|ref|YP_001991705.1| Peroxidase [Rhodopseudomonas palustris TIE-1]
    MSLHIGDIAPDFTADTTKGKISFHDFIGNSWVFFFSHPADFTPVCTTEMGKTAKLAQPFASRNVKPIGLSTDTVDEHLKW
    IADVNDTQQTDLQFPIIADPELKVAKLYDMIHPNQSDTAAVRSVFIIDPNKKIRLTMTYPMNVGRNFDEILRVIDALQFA
    DKHTVAAPADWRPGDKVIIPLSVKGEAATKAFPQGWEEPRPYLRLTTIK

    >gi|192291113|ref|YP_001991718.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodopseudomonas palustris TIE-1]
    MPKPTPKKPSKKTAKPAVEKTSKVTTKAAAKTTAAKTTAVKKAAAKSPAAKAPAAKTAATKAAAKPAAKSAAPKPSATKS
    SATKPAGLAEGSVAPDFKLPRDGGGEISRADFAGRKLVLFFYPKANTPG
    CTREAIDFTRLAADFKACGTAVLGVSADSVK
    AQNSFRDKHQLATPLLSDPTHAMLEAYGAWGEKSLYGRKFQGIIRTTVLIDADGRVARVWRNVKVDGHADQVLAAAQS

    >gi|192291127|ref|YP_001991732.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas palustris TIE-1]
    MATARPRPQVMRLTDAAAGRVKELMVRADSEILGLRVGIKNGGCAGQSYTVEYAHDIKPNDEVIEDKGVKILVDPKAVLF
    LLGTEMDYKADRMQAQFVFNNPNQISACGCGESVELKPASIDG

    >gi|192291270|ref|YP_001991875.1| OsmC family protein [Rhodopseudomonas palustris TIE-1]
    MDALELRALQAPIKERYKADPTTALITLKAKGAIDADGISCKVETGKALATAGLHPATGGSGLELCSGDMLLEALVACAG
    VTLKSVATAIELPLTRGDVVAEGDLDFRGTLGVDKDTPVGFREIRLRLEVGTDAPQDKLDLLLKLTERYCVVYQTIKNGP
    KVSVTLHRV

    >gi|192291342|ref|YP_001991947.1| Redoxin domain protein [Rhodopseudomonas palustris TIE-1]
    MTKQPDLLKVDWSAIPAPDDDGAAAHLPGATIQPVALPATDGGAVTLSSLPGRTVLFIYPRTGVPGQISLVDDWDMIPGA
    RG
    CTPQTCSFRDLFADLKTAGADAVFGLSTQSSAYQSEMATRLHLPFPVLSDESLELTRALNLPTMQVAGMTLLKRMALI
    IDDGRISHVFYPVFPPDRNAGDVLEWLKANPR

    >gi|192291569|ref|YP_001992174.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas palustris TIE-1]
    MTESSVTISERAARRIGEILKGEGQGAMLRIRVEGGGCSGFQYKFDVDRTKTDDDLVIAKEGAVVLVDSASVPFLAGSEV
    DFVDDLIGASFRVNNPNATASCGCGTSFSI

    >gi|192291578|ref|YP_001992183.1| dihydrolipoamide dehydrogenase [Rhodopseudomonas palustris TIE-1]
    MSDTSFDVIIIGSGPGGYVAAIRAAQLGFKTAIVEKSYLGGICLNWGCIPTKALLRSAEIYHYMQHAKDYGLSADNISFD
    PKAIVQRSRGVSKRLNDGVGFLMKKNKISIIWGAATIDAPGKLAVAASKTEAPKGALPPGSYQAKHIIVATGARPRVLPG
    LEPDKKLVWTYFEAMVPETMPKSLLVVGSGAIGIEFASFFHTMGAKVTVVEVLPQILPVEDAEIAALARKRFEKQGIKIL
    TGAKVTKLDKKADSVVATIDPGNGKPETAEFDRVISAVGVVGNVENLGLDKLGVKLDRGTIVTDGLGRTNVPGLYAIGDV
    AGPPMLAHKAEHEGVICVEAIKGLHPHPLDKSLIPGCTYCQPQVASVGLTEAKAKEQGREIRVGRFPFTANGKAIALGED
    QGLVKVIFDKKTGQLLGAHMIGAEVTELIQGYVVAMNLETTEEELMHTVFPHPTLSEMMKEAVLDAYGKVLNA

    >gi|192291825|ref|YP_001992430.1| protein of unknown function UPF0061 [Rhodopseudomonas palustris TIE-1]
    MTAHFPFDNSYVALPPNFFARVAPTPVAAPRLIKLNRPLAVQLGLDPDLLETPEGAEILSGNQMPETAASIAMAYAGHQF
    GNFVPQLGDGRAILLGEVVDRNGVRRDIQLKGAGRTPFSRMGDGRAALGPVLREYIVSEAMAALGIPTTRSLAAVLTGET
    VLRDPIQPGAVLTRVASSHIRVGTFQYFAARGDLASVRALADHAIARHYPEAAQAPSPYLALLEGVIGRQAELVASWMMV
    GFIHGVMNTDNCSVAGETIDYGPCAFMDTFDPKTVYSSIDQFGRYAYGNQPPIALWNLTRLAECLVRLLADDDDKGIEIA
    QTALGGFAERFNAAYLAKLAAKLGLFTSQPDDQQLSQEFLTALAKGEADFTLAFRRLSDAAVDPSDLGEVRALFADPAAF
    DEWAPRWRARIAAEPQDATTRQAAMRRVNPAYTPRNHRIEAVIRAAVDRDDFAPFEEILTVLANPFEEKAEFARYAEPPQ
    PHEEVLETF
    CGT

    >gi|192292049|ref|YP_001992654.1| heavy metal translocating P-type ATPase [Rhodopseudomonas palustris TIE-1]
    MATDAYRIRVEGMDCASCALKIETAMQRLSGVADVRVSYSAGTLALRLDRDRISPSTIDEQLRSLGYRPLAVASSPSSIA
    TDRKRLPWWQDAKLQSVMIAAAVFALAFALSQLFPAFERWLYSAAAAICLIPIARRALIGTRSGSPFSIETLMSVAAIGA
    VMIGEAAEAAVVIVLFSVGEWLETFAAGRARSGIEALIDVVPRTARRLRDGSDEVEEIPAADLMIGDVVVVRPGDRIPSD
    GKVIDGDSDVNEAPITGESVPVAKAVGDHVYAGSINANGELRIETTNAAADNTIASIIHLVEEAQETKAPTERMIDRLSR
    WYTPAAMLVALLVIIVPPLGFGEDWATWIYRGLATLLIACPCALVISTPAAIASGLAAGARKGLLIKGGAVLETLGKVKT
    VAFDKTGTLTLGQPQVTDVVSVIGQDDAVLARAAAVEGNTSHPIGQAIVRAAKARALQTPVVFGGSQAVPGKAISARLKD
    GFAFVGSPRFAAERTTIPPELAATISGLEHEGKTVVVLISSKTCEGVIALRDEPRPDAAGALRQLTSKGIAVVMLTGDNV
    RTAQAIARQLGIEARAELLPDAKLAEICRLKEVSPVAMVGDGINDAPALAAASVGIAMGGGTDVALETADAALLNDRTRG
    VVELIALSQATLGNIWQNISIALGLKAVFLATSLLGVTTLWMAILADTGATVLVTANALRLLRWRASES

    >gi|192292438|ref|YP_001993043.1| arsenate reductase [Rhodopseudomonas palustris TIE-1]
    MDVVIYHNPACGTSRNTLGLIRNAGIEPHVIEYLKCPPTRALLKQLIARAGLTPRQALREKGTPYAELKLDDLALSDDDL
    LDAMIAHPILIQRPLVVTPNGVRICRPSEAVLDLLPPQRGEFVKEDGELVIDASGRRVATA

    >gi|192292441|ref|YP_001993046.1| thiol-disulfide isomerase and thioredoxin [Rhodopseudomonas palustris TIE-1]
    MKDVKVLGSGCKRCIETAALVQGEADRLGVPIRLEKVTDYAAIAKFGIASTPGVVVDGKVVHAGGLPKAESIAAWLSS

    >gi|192292446|ref|YP_001993051.1| Methyltransferase type 11 [Rhodopseudomonas palustris TIE-1]
    MPTDMQDVKDIVREKYASAALKVATGGASCCGSSALPGASPITSNLYDAAQEQGLPAEAMLASLGCGNPTALAQLSPGET
    VLDLGSGGGIDVLLSARRVGPTGKAYGLDMTDEMLALARDNQRKAGLDNVEFLKGEIEAIPLPDHSVDVIISNCVINLSG
    DKDRVLREAFRVLKPGGRFAVSDVVTRGEIPEALRRDVLLWVG
    CLAGALDEADYVARLAAAGFAQISIEPTRVYDIEDAR
    EFLTGKGIDVDALAPQMQDKFFSGFVRATKPGADGEAPARCCG

    >gi|192292499|ref|YP_001993104.1| Rhodanese domain protein [Rhodopseudomonas palustris TIE-1]
    MPAHTDPLVSTDWLAERLGDPSVKIIDASFKMPGVLPLPADDYLAAHIPGAVFFDVDAVSDHTSSLPHMYPSADQFARDV
    EALGISSGDTVVAYDAGGWVAAPRAWWMFLSFGHANIHILDGGLKKWVAEGRPTEAGKPTIAPGRFSAKFDPSFIRSRDQ
    LVANLDSGTEQVIDARAAPRFEGSVAEPRPGLRAGHIPGSRNLPYNELFDAATGTMKPLAELRQAFERAGLDLGRPVVTS
    CGSGVSAAVLTLALYRLGVRGSALYDGSWSEWGLQDGPPVATGPAA

    >gi|192292500|ref|YP_001993105.1| Rhodanese domain protein [Rhodopseudomonas palustris TIE-1]
    MPQTITRGIKAMLDEANSSIETLTTADAIALHKSGASDVVIVDIRDPREIERDGKIPGSFSCTRGMLEFWIDPQSPYAKP
    IFQEDKKFVFY
    CAGGLRSALAAKTAHDMGLKPVAHIEGGFGAWRDAGGPIEAWVPKKK

    >gi|192292514|ref|YP_001993119.1| Glutathione peroxidase [Rhodopseudomonas palustris TIE-1]
    MASIYDFTAKSLAGKDVALKEFEGKVLLIVNTASACGFTPQYKGLEALQETYGPRGFSVLGFPCNQFGAQEPGDEALIAQ
    FCSTNYGVTFPMFAKIDVNGAGAHPLYKFLKDEKGGLLGSAIKWNFTKFLVDRSGRVVSRHAPTTTPEALSKEIETLL

    >gi|192292755|ref|YP_001993360.1| DSBA oxidoreductase [Rhodopseudomonas palustris TIE-1]
    MSTLKPLTIDVVSDVVCPWCYIGKKRIEQAIALAPEVPVELIYRPFFLNPWVPREGISRDEYLTKKFGSPERYKEIAGRI
    AETAAQEGLEYHPERVQRQPNTIDCHRLIHWASAIGQGPAMKQRLMELYFRDGGDLTDPEVLVQAAVECGLDAADIRARL
    ATDQAVEEVSAQAQEAADKGISGVPTYVFMHQYAVSGAQDPTLIARAIRKLSAELNAEAAE

    >gi|192292825|ref|YP_001993430.1| methionine-R-sulfoxide reductase [Rhodopseudomonas palustris TIE-1]
    MIDRRMLLASAALAAVFGFRWLRPDAARAAEKFEIEKTPEEWRKQLTPMQYHILREEGTERPFSSPLLKEHRKGTFACAG
    CDLPLFSSDTKFDSGTGWPSFWQPLANAVGERTDSTLGMTRTEVHCRRCGGHLGHVFDDGPKPTGLRY
    CMDGYALTFHPA
    TPNAS

    >gi|192292841|ref|YP_001993446.1| Thioredoxin-disulfide reductase [Rhodopseudomonas palustris TIE-1]
    MTETIKTDVLIVGAGPCGLFAVFELGLLDVKAHLVDILDKVGGQCAELYPEKPIYDIPGIPMVTGHGLTEALMEQIKPFN
    PTFHLSEMVENVEKIGDPGFRVTTNAGKVFECTVLVVAAGGGSFLPKRPPVPGVEAYEGTSVHYAVRKMEDFRGKDILIV
    GGGDSALDWTLNLNPIAKSMTLVHRRDDFRGAPHSVEQMRQLVASGKLDLKIGQITELQGDNGQLTGATVKLNDNTTSQI
    KCDAMLPFFGLTMKLGPVANWGLDLENNLIPVDTGTFETNVPGIFAIGDINTYPGKLKLILSGFHEGALMAQKAVKYVYP
    DKRVVFQYTTSSTNLQKKLGVN

    >gi|192292964|ref|YP_001993569.1| methionine-R-sulfoxide reductase [Rhodopseudomonas palustris TIE-1]
    MSDTKTNSPGKIEKSEAEWRKELTPMQYAVLREKATERPYTGEYEYETRPGTYVCAGCGQTLFESDTKFDSGCGWPSFTA
    PAQASSIDEERDVSHGMIRTEVLCSRCSGHLGHVFPDGPGPTGLRY
    CINSAALKLQPK

    >gi|192292965|ref|YP_001993570.1| peptide methionine sulfoxide reductase [Rhodopseudomonas palustris TIE-1]
    MRASFGRLALCAAAAGLLAWSALGPSRAAEEPVVIPPPQLDAKEAGGIQTAVFAGGCFWGVQGVFQHTAGVVNALSGYAG
    GSKASASYPLVSTGTTGHAEAVEVKYDPKRISYGKLLQIYFSVAHDPTQLDRQGPDTGPQYRSAIFTTSDEQKRIADAYI
    AQLDAAKVFGAPIATKVGPLKGFYAAEAYHQDYLTLHPTQPYIAYNDLPKIEALKKLFPTEYLDKPTLVSSVKATN

    >gi|192292970|ref|YP_001993575.1| thioredoxin reductase [Rhodopseudomonas palustris TIE-1]
    MPSPVQAKVVIIGSGPAGYTAAIYASRAMLEPILIQGMQPGGQLTITTDVENYPGFADVIQGPWLMEQMEKQALHVGTRI
    KTDLVVDLDLSQQPFRLTCDSGDVYLADTLILATGAQARWLGIPSEQTYKGFGVSA
    CATCDGFFYRGKDVVVVGGGNTAV
    EEALFLTNFAASVTIVHRRDHFRAERILQDRLFKHPKIKVIWDVAVDEICGAENPTKVTHVRLKNVKSGTTSEVKADGVF
    IAIGHAPATELFKDQIKLKPSGYVEVAANSTATSVPGVFAAGDVADETYRQAVTAAGMGCMAALEAERFLALRAGDRQAA
    E

    >gi|192293035|ref|YP_001993640.1| OsmC family protein [Rhodopseudomonas palustris TIE-1]
    MSTTSGSAKWQGGIKDGKGAISTKSGALSDYPYGFASRFEGKPGSNPEELIGAAHAACFTMALSLILGEAKLTAEQMETK
    ADVMLEKQGDGFAITAVHLTLTAKIPGADDATFQDCAAKAKAG
    CPVSKLLNTNITLDAKLVS

    >gi|192293108|ref|YP_001993713.1| Redoxin domain protein [Rhodopseudomonas palustris TIE-1]
    MTIKVGDRLPDAQFRVMTEDGVQVKTTDDIFKGKKVALFAVPGAYTGTCHKMHLPSIFLNAYAMKDKGVDTIAIVSVNDA
    FVMSAWKRDTDQRNEAIFLGDGNADFTKAIGMEMDGSGFGLGTRSLRYSMLVEDGVVKTLNLEPNPGKVEVSGGDTLLGQ
    L

    >gi|192293273|ref|YP_001993878.1| methylated-DNA/protein-cysteine methyltransferase [Rhodopseudomonas palustris TIE-1]
    MMPLSQHSHTLFDTAIGRCGIVWGSRGIVAVQLPQPTEAQTRARITQRHPNSVEAAPTADVQRAIDGIVALLEGAATDFA
    DIPLDLDGTSAFQRRVYDIARGIPAGKTLTYGDIAKQLGGVELAREVGQALGRNPCPIIVP
    CHRVLAAGDKPGGFSANGG
    VATKLKLLAIEGAAVNYTPSLFD

    >gi|192293309|ref|YP_001993914.1| Rhodanese domain protein [Rhodopseudomonas palustris TIE-1]
    MTTLKQMMEAANAAVPRVSVDDARHLIEQGALVIDVRDAPEVGNTGKIAGAVNISRGMLEFRADPDSPLHDKHLAKDRPV
    IVY
    CASGGRSALAGKVLKDLGYEKVFNLGAFKDWAEAGGAVEQPIERGM

    >gi|192293314|ref|YP_001993919.1| protein of unknown function DUF395 YeeE/YedE [Rhodopseudomonas palustris TIE-1]
    MDLDLLIERFGETTLLTAGGLLVGLVFGATAERSKFCLRSAVIEFSESSFGPKLAVWLLTFAAAVAATQVAITSGVLDVS
    EARQLAATGSLSGAIIGGLMFGAGMILSRG
    CASRLLVLSGTGNLRALVTGLILTIVAQASLRGVLSPVREFLTSLWTLPG
    GASRNLLTVVHAGPVIGAAFGFALLVWALWLGWRNRIGIITGIAAIGVGLAVTGGWLVTYILAQHSFAPTQIKSVSFTGP
    SADTLMGLINSPSVPLGFDIGLVPGVFAGSLLAALIGRDWKLQGFHDGLSMGRYAAGAFLMGFGGMLAGGCAVGAGVTGG
    SIFAVTAWLALASMWLGALATHTLLDAKAAAKADAAPAIEPALSAKQTGN

    >gi|192293323|ref|YP_001993928.1| putative thioredoxin [Rhodopseudomonas palustris TIE-1]
    MTKTGISRRGAIAALGLGALGALSLWPAPAMAAEPVLGDDGLYQLDWYLQSFLDLKEDLEGATAKGKRFAILWSLKGCPY
    CKKLHDVHMRDPAIESYIRDNFEIVHLNHIGAREVTDFDGSKLSEKAFAQAYGIRFTPSLQFFPESADGLAAKKPQDREV
    ARMPGLLEPPEFLAMFKYVREKGYQSMSFTDWLKRPV

    >gi|192293327|ref|YP_001993932.1| protein of unknown function DUF395 YeeE/YedE [Rhodopseudomonas palustris TIE-1]
    MQDASAWMLALAGLCVGVTAGFFVRLARLCSFGAVEDALMGGDTRRLRIFGLALGIALLGTQALVIAGQLDPGQSNYTAP
    ALPLISIAIGSVLFGIGMAFVGT
    CGFGALVRLGGGDLRSFVVILVLGGAAYATLRGMFSGFRITVLERFAITMPEGVNTD
    LAALTQHLSGMDLRAVIAALGGGALCLIALGDKRLRRTPRLLAAGVALGLLTVVGWLATTKLADPFAGPVHPQSLTFVST
    VGKAVYAGLLNVANFADFGVGTVFGVVAGAFIAAWYTDELRWEAFDDDHEMRRHVAGAALMGFGGILTGGCTIGQGITAG
    SVMALSWPVAIVGMMFGARIGIAVLVDGSPRELIRRRFDAWRELLQRRRAPALTAANKPSRRPAAPSDAPHPTAPHSLAE


    >gi|192293329|ref|YP_001993934.1| protein of unknown function DUF395 YeeE/YedE [Rhodopseudomonas palustris TIE-1]
    MQMPELVIVLGFAIGAAFGVAGLLSGFCLTSGLRDYWTKDDGRKLRSYAVALAVAIIGTQLIAGLGYVDIGKSLYLQPSF
    SAPLIFLGGLMFGLGMVLANG
    CASRALVLLGKGNLRSLLVVGIIAVAAQMTLKGLIAPARLAFLQWTQVSPPHVSVPSLI
    GVLGLGEAFAQIAAVLIAAGALLVFAFSDRSFRRATGQITAGVVIGLLVVAGWLATGYFGTDEFNPIPATSLSFVAPLAD
    TLQYAMFSTGLTLSFGVALAVGVFAGSAATALLTGRFELEGFTSAPHMLRSTVGAALMGAGGAMAYGCSVGQGLTGLSTL
    ALPSFIAVAGIVGGAALGIRRFAPVAALATR

    >gi|192293339|ref|YP_001993944.1| DSBA oxidoreductase [Rhodopseudomonas palustris TIE-1]
    MITRRTFTAALSLTGVFAVAGVSPFRLIDSAFAQSKEAAAAADVAKPMSLPDMALGPKDATVTITEYASLTCSHCAAFNE
    QVYPQIKKAYIDTGKIRYVFREFPLDIKAAAGSMLSRCIAKDDSAKYFAVTDVLFRSQTEWVLKDTTEQLKRIGKQAGLS
    GEEVEACLKDQKLLDKIAADQKYANEVLKVNATPTFFINGEMLRGENSFDEFAKRIDALLAKKS

    >gi|192293450|ref|YP_001994055.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas palustris TIE-1]
    MIILTEQAGTAVKAAMSRAGKLDAGLRVMVEAGGCAGYKYLIGLDAEPRVDDAVVEAGGVKVFIDPDSQPLLSGMTIDFV
    ESLEGSGFTFDNPNAGTKCGCGKSFG

    >gi|192293468|ref|YP_001994073.1| HesB/YadR/YfhF-family protein [Rhodopseudomonas palustris TIE-1]
    MDMSFTPSAEKFIRRMLRFSGGTGGFRLVVSAGGCSGLSAQFDIAGAPHTGDAVVDRGDYKLFLPESSLKLLEGVVIDFM
    ETPTSSGFMFHDPKGSNCQCASDSGPKPAAGLHQLREL

    >gi|192293493|ref|YP_001994098.1| uncharacterized peroxidase-related enzyme [Rhodopseudomonas palustris TIE-1]
    MTKPAISRFPVPEIASLPEDIRTRILAVQEKSGFVPNVFLTLAHRPDEFRAFFAYHDALMDKPGPITKAEREMIVVATSN
    ANQCQY
    CVIAHGAILRIRAKNPLLADQIAVNYRKADITPRQRAMLDFAMKVSAQAYEVGDADIEALKRHDFSEEDIWDIA
    AIAAFFGMSNRLANVTSMRPNDEFYAMGR

    >gi|192293584|ref|YP_001994189.1| Redoxin domain protein [Rhodopseudomonas palustris TIE-1]
    MTESQPNSVPPRRAGRLTILLATIAVLVVAGAAGIYGIGGLQRNAGGDPVCRPAVALAQQLKPLVRGEVAALTPAAAPLR
    LPDLAFTDDAGQPKKLSDFRGRTVLVNLWATW
    CVPCRKEMPALDNLQAKLGSSDFEVVAINIDTRDPAKPKKFLDDEKLT
    HLSVFTDASAKVFQDLKAVGRALGMPTSVLVDREGCEIATINGPAEWDSNDATTLIKAAVKPAPARKP

    >gi|192293604|ref|YP_001994209.1| methylated-DNA/protein-cysteine methyltransferase [Rhodopseudomonas palustris TIE-1]
    MLLTMAGTAYTIFDTMMGRCGIAWGGGGVLAVQLAESREIDTRRRLLRLCPDARESRAEAWIEPVIDGLSAALRGEPWDF
    SDVPLDLGGIPGFDCRVYAALRAIPRGETLTFAEIAKQLRSSGAVHAVGQAIRRNPFALIVP
    CHRALAAPGDTSGICANG
    GTITRRRLLSLEGALATSGPSLLDVLLPFAPPRQADR

    >gi|192293677|ref|YP_001994282.1| peptide methionine sulfoxide reductase [Rhodopseudomonas palustris TIE-1]
    MFFMRKSTAMPSAAEALPGRPTPIPTARTHFVSGNRLQPPFPEGLQQAVFGLGCFWGAERKFWQLGDGVYSTAVGYAGGF
    TPNPTYEEVCSGRTGHTEVVLVVFDPARISYEALLKTFWESHDPTQGMRQGNDVGSQYRSAIYTFGDDQKRAAEASRVTY
    GDALKAKGYGPITTEIAASGPFYYAEDYHQQYLAKNPGGYCGLGGTGVSCPVGVRVTA