Rhodopseudomonas palustris HaA2 uid58439

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|86747138|ref|YP_483634.1| heavy metal translocating P-type ATPase [Rhodopseudomonas palustris HaA2]
    MLMTRDFSHYVKDVDPQTAHLDLAVEGVSCAGCMAKIERGLSAIPDVTLARVNLTDRRLAVEWKKGAVEPALFIDRLAEL
    GYKAYPYEPVRAEVEETERSKFLLRCLGVAAFATMNVMMLSVPVWVGGDLSPEARDFFHWLSALVVLPCAAYAGQPFFQS
    AWRALKAKSVNMDVPITIGVVLALGMSLVETINHAEHTYFDAAIMLIAFLLAGRFLDQKMRQKTRAVAGNLAALKAETAT
    KFVGPDEISEVPIAAVRAGDLVLLRPGERCAVDGSVVEGRSEIDQSLITGETLYVKAERGTQVYAGTLNISGTLRVRVSA
    ASEGTLLAEITRLLDHALQARSRYVRLADRASQLYAPVVHATALLTVIGWVLAGASWHDAIVIGIAVLIITCPCALGLAI
    PAVQTVASGAMFRAGVLLNAGDAIERAAAVDTVVFDKTGTLTLPELDVVNGAGVPDEVFQLAGRLALASHHPVAAAVARA
    AQAKAPLPGVTEEPGRGVRALFEGEELRLGSPAFCGADAEANAILSADPEVSVVAFSRGDRHTVFAVRQLLRPDAARTID
    ALLNRGIAVELLSGDREPAVRHAADALGVSAWRAGVTPAEKIAHIEALKAQGRVVMMVGDGMNDAPSLAAAHVSMSPISA
    THLSQATADLVFLGKELAPVLAAIDYSRKAMAVMRENLTLAIGYNVLAVPIAIAGLATPLIAALAMSGSSILVMLNAMRA
    RRVRLGGASWK

    >gi|86747152|ref|YP_483648.1| glutaredoxin GrxC [Rhodopseudomonas palustris HaA2]
    MSAAIEIFTRPGCGYCSAAKSLLNRKKAAFTEYDVAVDPAHRKTMDARTYPGSTYPQIFIGGTHVGGCDDLYALDREGKL
    DALLAGEKATS

    >gi|86747158|ref|YP_483654.1| OsmC-like protein [Rhodopseudomonas palustris HaA2]
    MDAATLRATQAPLKERFKSDPAAALITLTAKGAVDGPGIACRLETGRGPAQAGLHPSAGGSGLDLCSGDMLLEALVACAG
    VTLKTVATAIELPLTDGRVTAEGDLDVRGALGIDKDAPVGFRDIRLRLEVATDAPQDQLDLLLKLTERYCVVYQTIKNGP
    KVSVSLERV

    >gi|86747400|ref|YP_483896.1| dihydrolipoamide dehydrogenase [Rhodopseudomonas palustris HaA2]
    MANYDLVIIGTGPGGYVCAIRAAQLGLKVAVVEKNPTLGGTCLNVGCMPSKALLHASELFEEAGHSFAKMGIGVPAPTLD
    LPTMMNFKQQGIDGNVKGVEYLMKKNKIDVLVGRGKVLGTGKVEVTGNDGKAQTVETKSIVIATGSDVAKLKGIEIDEKR
    IVSSTGALSLDKVPGKLIVVGAGVIGLELGSVWRRLGAQVTVVEFLDRILPGMDAEIVKQFQRILEKQGFAFKLGAKVTG
    VDSSGKQLKVSVEAAAGGNPETLEADVVLVAIGRVPFTEGLGLQEAGVALDERGRVAIDDHFATSVQGVYAIGDVVKGPM
    LAHKAEDEGVAVAEIIAGKAGHVNYDVIPGVVYTTPEVSSVGKTEEDLKQAGVAYTVGKFPFTANGRSKVNQTTDGLVKI
    LADAKTDRVLGVHIVGREAGEMIHEAAVLMEFGGSAEDLARTCHAHPTRSEAVKEAALAVGKRAIHM

    >gi|86747422|ref|YP_483918.1| thioredoxin [Rhodopseudomonas palustris HaA2]
    MTIIEQGSGAAPQAAPDLIKDTTTQTFVRDVIEESKLQPVLIDFWAPWCGPCRQLTPMLEKAVRAAGGKVKLVKMNIDEH
    PSIPGQMGIQSIPAVIAFVDGRPADGFMGAVPESQVAAFIEKLTAGVPGGAPTAAELLQEAEAVMAEGDLQTAGAIYAEV
    LRADAANVEAIVGLARCYMVSGAVDEAKATLAQVPEARREDAAVKAVQAMIDLAAQAEQVGPIAELEQKVAADPLDHQAR
    FDLATALNAAGRRDEATTHLLEIVRRDRKWNEDGARKQLVQLFEAWGPTDDATIEGRKRLSTILFS

    >gi|86747430|ref|YP_483926.1| hypothetical protein RPB_0304 [Rhodopseudomonas palustris HaA2]
    MTKAATAMTACLTPDSPVAMTGCLAPIDKAGLDELIAKGKADPTAVKTLKCKTVAEGRFRHLNFVRTLPPYIVDEPPGLL
    GDDTAPNPSEASLAALGS
    CLAVGIHANAVARGITVYTLEIELEGDLNITGVWGTGDLSEKPVGFTDVRAKVKFEADRPRE
    ELDALVAHARLWSPVANTFSRPVNLDVTMA

    >gi|86747432|ref|YP_483928.1| rhodanese-like protein [Rhodopseudomonas palustris HaA2]
    MTEKVLVTPAELSEMLASPTTVVIDTRNPEAYAAGHVPGAVNIHEIFTYLATSTPEGVKEMSEKFAAAFGAAGLSGEETA
    VIYEQSMNTGFGQSCRGYVLLTYLGYPKVKILHGGYAAWTAAGLPSTTDVPTPTPKTFAVDPEAASILVDLESMKAAVAD
    QSKVKLDTRDVDEWIGESSSPYGKDFCPRKGRIPGAVWIEWYRMMKPSAAGPMFKSSAEILAECASVGITPDTPVVLY
    CF
    KGARASNTLVALKEAGIKDVSLYFGSWNEWSRDPSLPIEEGAPYAAPSLMAAE

    >gi|86747491|ref|YP_483987.1| periplasmic protein thiol [Rhodopseudomonas palustris HaA2]
    MSTPVTDTPSPTRRSLMVALPLLVFAGLAALFWIRLGDRDISKIPSALIGREVPQTELPALDALTRDGAAVPGLGPAQFK
    GKVSVVNVWASW
    CVPCHDEAPLLTALGDDKRFQIVGINYKDRPDNARRFLGRYGNPFAAVGVDASGRAAIEWGVYGVPET
    FVVGRDGKIAYKLVGPITPDNLDKVLKPEIEKALGKS

    >gi|86747563|ref|YP_484059.1| AraC family transcriptional regulator [Rhodopseudomonas palustris HaA2]
    MMNLALADHRLTKPGPRDTALADYDAVRRAIAFISQKWKTQPTVEAIADAAGLTPDELHHLFRRWAGLTPKAFMQALTLD
    HAKSLLRGSASVLDAALDSGLSGPGRLHDLFVTHEAMSPGEWKSGGAGLTLRYGYHPSPFGTAVVIASERGLAGLAFADP
    GGEEAAFMDLQQRWPRATCIADQAFTAPFAQRVFDPVQWRPEQPLRVVLIGTDFEVRVWETLLKIPMGRALCYSDIAHRI
    ASPKASRAVGAAIGKNPISFVVP
    CHRALGKTGALTGYHWGLTRKQAMIGWEAGRLGAG

    >gi|86747574|ref|YP_484070.1| thioredoxin [Rhodopseudomonas palustris HaA2]
    MSDRLVVCTQCGGVNRLPEQRSALEAKCGKCGAKIFDGHPADVGAEIFDKQIARSSVPVLVDVWAPWCGPCRAMAPAYEI
    AARELEPRVRLIKLNSDNEQQIAAKLGISGIPTMILFADGRERARTSGAMPASAIVRWVREHLPG

    >gi|86747743|ref|YP_484239.1| molybdenum cofactor biosynthesis protein [Rhodopseudomonas palustris HaA2]
    MLSAEELERYARHIVLREVGGPGQAALRRARVLVVGAGGLGAPVLMYLAAAGVGTLHIVDDDVVSLSNLQRQVIHATPDV
    GARKVDSAAARIHALNPHVQVVPHPTHLTSANALGLIGDCDLVLDGSDNFATRYLVSDACFIAKKPLITAALGQFDGSLT
    TIRAHEKNAQGEPNPTYRCLFPEAPPPGTVPA
    CEEAGVMGALAGLLGSMMALEAIREIVGFGEGLVGRLLMIDARAMRFE
    TLRYARDPANPLNGDMARIVDLSAH

    >gi|86747756|ref|YP_484252.1| thioredoxin [Rhodopseudomonas palustris HaA2]
    MAVGKVSDADFEAEVLKAQGPVVVDFWAEWCGPCRMIAPALDEISGAMGDTVKIVKLNVDESPVTASKYGVMSIPTLMIF
    KGGEMASRQVGAAPKAKLQQWISSAV

    >gi|86747788|ref|YP_484284.1| glutathione S-transferase-like protein [Rhodopseudomonas palustris HaA2]
    MYTLFHHPFCPQSRFVRLALGEHGLDLRLVEERAWERRTAFLALNPAGTTPVLVGEGYPPIPGAGVIAEFLDETHGAGLR
    DRRLLPQSTAERIEVRRLMAWFNDKFFEEASAPLVTERIYKRFMSEEDGGGPPAMDVIRAATANVRYHLAYIGWLARTRN
    FLAGDRMSFADLAAAAHLSAIDYLGDVPWIEDEAAKAWYARIKSRPSFRPLLSEWLAGVPASRTYVDLDF

    >gi|86747926|ref|YP_484422.1| methylated-DNA--protein-cysteine methyltransferase [Rhodopseudomonas palustris HaA2]
    MVEVAYTIFDTMMGRCGIAWGLDGVLVVQLAESREIDTRRRLLKQCPDAREARPTVGIDSAIEGVAAILRGAHWDFSDVR
    LDLGGLPAFDCRVYDILRDIPRGETATYAEIAKRAGSPGALHAVGHAIRSNPFAVIVP
    CHRALPVAGDTSGSSANGGAIT
    RRRLLAIEGALATRGPSLFDVLLTATPRQADR

    >gi|86747952|ref|YP_484448.1| thioredoxin-like protein [Rhodopseudomonas palustris HaA2]
    MTETPPDLTPPRRAGRRTIILAAIAVLVVAGAAGVYGIGGLQRNASGDPTCRPAVALAQQLKPLARGEVAAVTMASAPLK
    LPDLIFQDGAGQPKKLSDFRGKTLLVNLWATW
    CVPCRKEMPALDNLQAKLGSPQFEVVAINIDTRDPAKPKKFLDDEKLT
    RLNYFTDASARVFQDLKSVGRALGMPTSVLVDGQGCEIATIAGPAEWDSADALALVKGALPK

    >gi|86748086|ref|YP_484582.1| HesB/YadR/YfhF [Rhodopseudomonas palustris HaA2]
    MDLNLTPSAEKFIRRMVRLSGGAGGFRLAVTSGGCSGLSAAFDIEAVPQPGDQVVEHGDLRLFLPEGSCKLLDGVVVDFM
    ETPTSSGFIFHDPKPSSCQCSGGTVEAPRQNLHQLREF

    >gi|86748104|ref|YP_484600.1| HesB/YadR/YfhF [Rhodopseudomonas palustris HaA2]
    MIILTEQAGNAVKAAMSRAGKTEGGLRIMVEAGGCAGYKYLIGLDPAPRSDDAVVEAGGVKVFVDPDSQPLLNGMTIDFV
    ESLEGSGFTFDNPNAENKCGCGKSFG

    >gi|86748179|ref|YP_484675.1| nitrogenase-associated protein [Rhodopseudomonas palustris HaA2]
    MARLVFYEKPGCVGNARQKALLVASGHELDVRNLLSESWTPETLRPFFGSKPLAEWFNASSPKVKAGAIDFAALTDESAL
    ALMIADPLLIRRPLLQAGDRRESGFDQPTIDAWIGLKPTDIPVTDRCAMA

    >gi|86748193|ref|YP_484689.1| twin-arginine translocation pathway signal [Rhodopseudomonas palustris HaA2]
    MITRRTFTAALSLTGLAAVAGVSPFRLIGDAFAQSSAAATAADVAKPMSLPDMALGPKDAAVTITEYASMTCSHCATFNE
    EVFPKLKAAYIDTGKVRYVFREFPLDIKAAAGSMLSRCIAKDDSAKYFAVTDLLFKTQADWVMKDTTEQLKRIGKQAGLS
    AADVEACLKDQALLDKIAADQKYANEVLKVNSTPSFFVNGEMLRGETSLEEFAKRIDPLLQKKS

    >gi|86748285|ref|YP_484781.1| alkylhydroperoxidase [Rhodopseudomonas palustris HaA2]
    MHKNWIDLTGELSTALREVRGGAPDVMKGFSAIAQAALKANALDTKTKELIALAISVATRCDGCIGFHAEAAVRQGATRD
    EIMETMGMAIYMGAGPSVMYAAQAVEAYDQFVQKKAAAETANSAVR

    >gi|86748468|ref|YP_484964.1| peroxiredoxin-like protein [Rhodopseudomonas palustris HaA2]
    MTIKVGDRLPEATFRVMTADGVQSKTTDDIFKGKKVALFAVPGAYTGTCHKMHLPSIFLNAYAIKDKGVDTIAIVSVNDA
    FVMSAWKRDTDQRDEAIFLADGNSDFTKAIGMEMDGSGFGLGTRSLRYSMLVDDGVVTKLNLEPNPGKVEVSGGDTLLGQ
    L

    >gi|86748546|ref|YP_485042.1| OsmC-like protein [Rhodopseudomonas palustris HaA2]
    MSTTFGSAKWQGGIKDGKGAISTKSGALSDYPYGFASRFEGKPGSNPEELIGAAHAACFTMALSLILGEAKLTAEQMETK
    ADVTLEKQGDGFEITAVHLTLTAKIPGADDSTFQELAGKAKAG
    CPVSKLLNTKITLEAKLAG

    >gi|86748637|ref|YP_485133.1| thioredoxin reductase [Rhodopseudomonas palustris HaA2]
    MPSRVQAKVVIIGSGPAGYTAAIYAARAMLEPILIQGIQPGGQLTITTDVENYPGFADVIQGPWLMEQMERQARHVGTKI
    VTDLVVDLDLNQRPFRLTCDSGDVYIAETVILATGAQARWLGIPSEQTYKGFGVSA
    CATCDGFFYRGKDVVVVGGGNTAV
    EEALFLTNFAASVTIVHRRDHFRAERILQERLFKHPKIKVVWDSEVDEICGSDSPTKVTHVRLKNVKTGALSEVRADGVF
    IAIGHAPATELVKDQLRLKPSGYVEVAPNSTATSVPGVFAAGDVADEIYRQAVTAAGLGCMAALEAERFLALRASERQAA
    E

    >gi|86748642|ref|YP_485138.1| methionine sulfoxide reductase A [Rhodopseudomonas palustris HaA2]
    MRFISRLARSAAALSALALSASFTPSLAAEDAVVIPPPALDVSSADGTQTAVFAGGCFWGVQGVFQHTAGVLNAVSGYSG
    GSQATANYTAISTGATGHAEAVEIKYNPKQISYGQLLQIFFSVVHDPTQLNRQGPDVGTQYRSAIFTVNDEQKKVADAYI
    AQLDAARVYKKPIVTKVGPLDGFYAAEAYHQDYLTLHPTQPYIVYNDLPKIENLKKLFPKDYLTKPTLVSSARATN

    >gi|86748643|ref|YP_485139.1| methionine sulfoxide reductase B [Rhodopseudomonas palustris HaA2]
    MTDTKTIPGKVAKSEAEWRKELTPMQYAVLREKATERPFSGEYEYETTPGTYVCAGCGQTLFESDAKFDSGCGWPSFTAP
    ASDGHIDEERDVSHGMIRTEVLCARCNGHLGHVFPDGPGPTGLRY
    CINSAALKLKPR

    >gi|86748769|ref|YP_485265.1| thiol-disulfide isomerase and thioredoxins [Rhodopseudomonas palustris HaA2]
    MKDVKVLGPGCKRCVTTAEMVQGEADRLGVAVTIEKVTDYAAIAGYGIVSTPGIVIDGKVVHAGGLPKAEDIAHWLA

    >gi|86749020|ref|YP_485516.1| glutathione peroxidase [Rhodopseudomonas palustris HaA2]
    MASIYDFSARTLAGEELPLKRFEGQVLLIVNTASACGFTPQYKGLEALQQKYGARGFSVLGFPCNQFGAQESGSEAQIAQ
    FCSTHYGVSFPMFAKIDVNGAQAHPLYTFLKDEKGGLLGSAIKWNFTKFLVDRSGHVISRHAPTTTPESLAKDIETLL

    >gi|86749037|ref|YP_485533.1| rhodanese-like protein [Rhodopseudomonas palustris HaA2]
    MPQTITRGIKALLDEANAQIETIGIADAVALHKAGPASDVVIVDIRDPREIERDGRIPGSFACTRGMLEFWIDPESPYAK
    PVFQGDKKFVFY
    CAGGLRSALAAKTAQDMGLKPVAHIEGGFAAWRDAGGPVEAWVPKKPKG

    >gi|86749038|ref|YP_485534.1| 3-mercaptopyruvate sulfurtransferase [Rhodopseudomonas palustris HaA2]
    MTAIEDPLVSTDWLAAHLGDPQVKVLDASFKMPGVLPRPGDDYLAAHIPGAVYFDVEEVCDRADARPHMYPDAAQFARDV
    AAMGVSSGDTVVVYDAGGWVAAPRAWWMFLSFGHADVRILEGGLKKWQAEDRPTESGKPSPKPGVFTATLDPTYLRSKEQ
    LVANFDSGAEQVIDARAADRFEGRVPEPRPGLRAGHIPGSRNLPYNELFDAATGLMKSRDELRKAFVRAGVDLDGPIVTS
    CGSGVSALVLTLALYRLGVRGTALYDGSWSEWGMPDGPPIATGPA

    >gi|86749091|ref|YP_485587.1| arsenite S-adenosylmethyltransferase [Rhodopseudomonas palustris HaA2]
    MSTTEITEIVREKYAAAATRAGSCCGAPALDHVSPITSNLYDAAQAEGLPAEAMLASLGCGNPTALAELKPGETVLDLGS
    GGGIDVLLSARRVGPTGKAYGLDMTDEMLALARDNQRKAGADNVEFLKGQIEAIPLPDNSVDVIISNCVINLSGDKDRVL
    REAFRVLKPGGRFAVSDVVTRGEIPEQLRSDVLLWVG
    CLAGALDEADYTAKLAAVGFRDVSIEPTRIYKVDDARDFLEGR
    GLDVDAIAPQIDGKFFSGFVRATKPGATAGGCCSSS

    >gi|86749094|ref|YP_485590.1| arsenate reductase [Rhodopseudomonas palustris HaA2]
    MRGPKMDVVIYHNPACGTSRNTLGLIRNTGIEPHVIEYLKCPPSRAMLEQLMVRAGLTLRQLIREKGTPYHELKLDDPEL
    SYDQLMDAVTAHPILINRPLVVTPKGVRLCRPSETVLDLLPPQRGEFRKENGELVVTATGRRMATV

    >gi|86749615|ref|YP_486111.1| hypothetical protein RPB_2495 [Rhodopseudomonas palustris HaA2]
    MTVHFPFDNSYAALPENFFARVAPTPVAAPRLIKLNRPLAQRLGLDPDRLDSPEGAEILAGTRVPEGAASIAMAYAGHQF
    GNFVPQLGDGRAILLGEVIDRDGVRRDIQLKGSGRTPFSRMGDGRAALGPVLREYIVSEAMAALGVPTTRSLAAVLTGER
    VLRDPIQPGAVLTRIASSHIRVGTFQFFASRGDRDAVRALADHVIARHYPEAAEADSPYLALLEGVIARQADLIARWMMI
    GFIHGVMNTDNTSIAGETIDYGPCAYMDTFDPKTVFSSIDHMGRYAFGNQPPIALWNLTRLAECLVPLLSDDDDKGVEIA
    QRALGGFADRFNAAYLAGLAAKLGLATTQPEDTQLAQDFLAAMAKGRADFTLAFRRLSDAAIDPVDLGAVRALFDDPTAF
    DEWAPRWRSRISLEEQNNTARQTEMREVNPIYIPRNHRVEAVIRAAVDHDDFAPFEEILAVLSNPFREQAKFARYAEPPQ
    LHERVLETF
    CGT

    >gi|86749869|ref|YP_486365.1| HesB/YadR/YfhF [Rhodopseudomonas palustris HaA2]
    MTDSSVTISERAARRIGEILKGEGDGAMLRISVEGGGCSGFQYKFDVDRARTDDDVVIARDGAVVLVDSASAPFLAGSEV
    DFVDDLIGASFRVNNPNATASCGCGTSFSI

    >gi|86749883|ref|YP_486379.1| dihydrolipoamide dehydrogenase [Rhodopseudomonas palustris HaA2]
    MTDTSFDVIIIGSGPGGYVAAIRAAQLGFKTAIVEKSYLGGICLNWGCIPTKALLRSAEVYHLMQHAKDYGLSADNISYD
    PKAVVARSRGVSKRLNDGVGFLMKKNKISIIWGAATVDAPGKLTVAASKTEAPKGALGQGSYQAKHIIVATGARPRVLPG
    LEPDRKLVWTYFEAMVPETMPKSLLVVGSGAIGIEFASFFHTMGAEVTVVEVLPQILPVEDAEIAGLARKRFEKQGIKIL
    TGAKVTKLDKKADSVVATIDPGTGKAETQEFDRVISAVGVVGNVENLGLEKLGVKLDRGTIVTDGLGQTSVPGIYAIGDV
    AGPPMLAHKAEHEGVVCVEAIKGLHPHPLDKSLIPGCTYCHPQIASVGVTEAKAKEQGREVRIGRFPFTANGKAIALGED
    QGLVKVIFDKKTGQLLGAHMIGAEVTELIQGYVVAMNLETTEEELMHTIFPHPTLSEMMKEAVLDAYGRVLNA

    >gi|86750105|ref|YP_486601.1| HesB/YadR/YfhF [Rhodopseudomonas palustris HaA2]
    MTETTPATTPTKPARRPRPQVMRLTEAAATRVKDLMSRADGEIVGLRVGIKNGGCAGQSYTVEYARDLQATDEVIEDKGV
    KILIDPKAVLFLLGTEMDYKADKMQAQFVFNNPNQISACGCGESVELVPANVDG

    >gi|86750119|ref|YP_486615.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodopseudomonas palustris HaA2]
    MSKQTRKNPSKSESLKTPAAKSAAAAGMAAKSSPTKKSSPTKTTKAKAKPASPAKAKTPAAKPAAPAVAGLAEGAQAPAF
    TLTRDGGETVTLASFSGKKLVLFFYPRANTPG
    CTKEAIDFTRLKPAFETCGAAVVGVSADSVKAQDSFRDKHGLATPLLS
    DPTHAMLEAYGAWGEKSLYGRKFEGIVRSTVLIGRDGKIARVWRNVKVDGHADQVLAAAQLL

    >gi|86750132|ref|YP_486628.1| peroxidase [Rhodopseudomonas palustris HaA2]
    MSLHIGDTAPDFTADTTQGPISFHDFIGDSWVFFFSHPADFTPVCTTEMGRTSKLAQQFAARNVKPIGLSTDTVDEHLKW
    IADVNDTQQTDLQFPIVADKELKVAKLYDMIHPNQSNTAAVRSVFIIDPNKKVRLTMTYPMNVGRNFDEILRVIDALQMA
    DKYTVAAPADWRPGDKVIIPLSLQGEDAVKAFPQGWDAPRPYLRLTTVK

    >gi|86750133|ref|YP_486629.1| DSBA oxidoreductase [Rhodopseudomonas palustris HaA2]
    MPSFRPFAAALLALLLVGAPVAAAAQKFSDEQRSQIEQIIKDYLVSHPEVLEEASDELGKRQANAAAEKHQAAIKDNAEA
    IFNSPRGITLGNKDGDVTFVEFFDYN
    CGYCKRAMTDMIALMKEDPKLKIVLKEFPVLGPPSVEAAQVAIAVRMQTPDGKK
    YLDFHQKLMGGRGQADKARAMAAAKEAGFDMARLEKDMASPEVRATIEESFKLAEAMGMNGTPSYVIGKQVVVGAVGLDT
    LRQKVALARCGKEKC

    >gi|86750279|ref|YP_486775.1| hypothetical protein RPB_3168 [Rhodopseudomonas palustris HaA2]
    MSVIIFGIKNCDTMKKARAWLDGHGVAYAFHDYKAAGIDKAHLARWIKQVGWEALLNRAGTTFRKLPEADKAELTEAKAM
    ALMLAQPSMIKRPVLQTDTTLLVGFRPESYAEAFK

    >gi|86750460|ref|YP_486956.1| alkylhydroperoxidase [Rhodopseudomonas palustris HaA2]
    MSRLAEPSMTSAAVSRFPVPALADMPDDIRARILGVQEKSGFVPNVFLSLAGRPDEFRAFFAYHDALMEKDSGLSKAERE
    MIVVATSAANQCQY
    CVIAHGAILRIRAKNPLIADQIATNYRKADITPRQKAMLDFAMKVSRDAERVGDADFDALEGHGFG
    DDDIWDIAAVAAFFALSNRMANVTGMRPNDEFYLMGRLPKS

    >gi|86750473|ref|YP_486969.1| rhodanese-like protein [Rhodopseudomonas palustris HaA2]
    MVGQVEDLTPQDVAKGVAEGRYLLVDVREPNEVAAEAYPDAVVVPLSSFDPRQIPDPSGKQVVFACRSGKRSVTASQAAQ
    MSGLAYNKHLAGGILGWKAAGLPTKPGG

    >gi|86750495|ref|YP_486991.1| glutathione reductase [Rhodopseudomonas palustris HaA2]
    MTEFDTDLFVIGGGSGGVRAARIAAGHGARVIVAEEYRFGGTCVIRGCVPKKLMVYASHFHHDFRDAAGFGWTVAEAQFD
    WPTLIANKDKEIARLESIYATNVEKSGARTVKARAVFEDPHTLRLSTGETVRAKYVLIATGGAPNHGTMIPGIEHVISSN
    EVFHLPELPKRILIQGGGYIALEFACIFAGLGSDVTLVYRGDNILRGFDEDVRSHVRTEMERAGISILTGCTVAKVEKLG
    DEYTSHLSSGSSIASDQVMFAIGRHPNVANLGLEKTGVAINPDNGGIAVNEYCQTSVPHIYAIGDVTHRINLTPVAIREG
    HAFADTVFGNRPGQVDYTNIPTAVFSQPEVGTVGLTESQARALYDRVDIYKADFRPMKATLSGSQVRTLMKLIVDADSDR
    VLGCHIVGPEAGELVQVIAIAVKMKATKADFDSTMALHPTAAEELVTMRTPTARYVRDAAE

    >gi|86750743|ref|YP_487239.1| OsmC-like protein [Rhodopseudomonas palustris HaA2]
    MPIERFEFPGSGGHRLAAALELPGSAPLAFALFAHCFTCGKDNLAARRIAAGLAARGIAVLRFDFTGLGASEGDFANATF
    SSNVADLVLAADHLRKVHRAPSLLIGHSLGGAAVLAAAAQIPEAKAIATIAAPSDPSHVAGLFAEHVDAIREQGSVEVSL
    AGRPFTIKREFLDDAGEHNLMAQVTKLRKALLVMHAPTDATVNIDNATRIFLAARHPKSFVSLDHADHLLSDRRDANYAA
    DVIAAWAERYLDARQPAAAGAPEVLRAVIVQETGESKFQQRISVGPHQLLADEPVAVGGADSGLGPYDLLLSALGA
    CTSM
    TMRLYAERKKLPLDRVTVTLSHAKIHAEDCVECETKVGLLDRIDRVIAIDGDLDTDQRARLIEIADKCPVHRTLTSEVKI
    VTRAAE

    >gi|86750814|ref|YP_487310.1| glutaredoxin-like protein [Rhodopseudomonas palustris HaA2]
    MSIRPGRWWSAGRAAKGSAMSIEQFIDNEVKANDVVLFMKGTPQFPQCGFSGQVVQILDHIGVAYKGHNVLENAELRDGI
    KQFSNWPTIPQLYVKGEFVGGCDIVREMFQAGELQKLFTDKGIKAAA

    >gi|86750865|ref|YP_487361.1| DSBA oxidoreductase [Rhodopseudomonas palustris HaA2]
    MSAIKPLKIDVVSDVVCPWCYIGKRRIEQALALVPDVPVELNYRPFFLNPWVPREGIARDEYLTKKFGSPERYKEIAARV
    VDAAAQEGLAYHPDRVQRQPNTIDCHRLIHWAEAIGQGPAMKQRLMELYFCDGGDLTDIDVLVQAAADIGLDAGDVRTRL
    AGDEDVALISGQAEEAAEKGISGVPTFVFAQTYAVSGAQDPAQLAKAIRHISAEINAEAAE

    >gi|86750930|ref|YP_487426.1| methionine sulfoxide reductase B [Rhodopseudomonas palustris HaA2]
    MIDRRILLASAALAAVFGFRWLRPDDARAAEKFEIEKTPEEWRKQLTPMQYHILREEGTERPFSSPLLKEHRKGTFACAG
    CDLPLFSSETKYDSGTGWPSFWQPLPNAVGERKDSTLGMVRTEIHCRRCGGHLGHVFDDGPKPTGLRY
    CMDGFALTFKPE
    TSKPS

    >gi|86750949|ref|YP_487445.1| thioredoxin reductase [Rhodopseudomonas palustris HaA2]
    MTETIKTDVLIVGAGPCGLFAVFELGLLDIKTHLVDILDKVGGQCAELYPEKPIYDIPGVPMITGHGLTEALMEQIKPFN
    PTIHLNEMIESVEKIGDPEFRVTTNAGTVFECKVLVVAAGGGSFQPKRPPVPGVEAYEGKSVHYAVRKMEEFRGKDIVIV
    GGGDSALDWTLNLNPICKSMTLVHRRDDFRGAPHSVEQMRQLVASGKLDLKIGQITELQGEDGQLSGATIKLNGNSIAQI
    KCDAMLPFFGLTMKLGPVANWGLQLENNLIPVDTGTFETNVPGIFAIGDINTYPGKLKLILSGFHEGALMAQKAVKYVYP
    DKRVVFQYTTSSTNLQKKLGVN

    >gi|86750979|ref|YP_487475.1| heavy metal translocating P-type ATPase [Rhodopseudomonas palustris HaA2]
    MHDTEHTGGSTAVKDAGCGCSAEAAVPAPPAASSCCGRHASDQPISPASAKAIDPVCGMTVDPASSKHRFDHAGTTYHFC
    CAGCRTKFAADPEGILAKAARPTAAPKPAAQLHQLTDFAAPSSCCGGHDHAAHHHDHGATAAADGKVIDPVCGMKVDPAT
    TPHRFDYQGQTYFFCAASCRGKFAADPVSYLDKSKAKPAPVVPEGTIYTCPMDPQIRQVGPGS
    CPICGMALEPELVSLDA
    PPNAELIDMTRRFWIGLALALPAVVLEMGGHLVGGHGLIDPALSNWIQLACATPVVLWAGWPFFVRGWQSLVTRNLNMFT
    LVAMGTGVAYVYSLVATLAPQLFPPAFQSHGGSVPVYFEAAAVITVLVLLGQVLELRAREATSGAIKALLTLAPKSARRI
    AADGTDHEVEIDSLAVGDKLRVRPGEKVPVDGIILEGRSTLDESLVTGESMPVTREAGGKVVAGTLNQAGGFVMRAEQVG
    RDTVLSQIVQMVAQAQRSRAPIQRVADLVAGWFVPAVVLAALVAFAAWATFGPEPRLTFALVAAVSVLIIACPCALGLAT
    PMSIMVGVGRGAQAGVLIRNAEALERMEKVDTLVIDKTGTLTEGKPKVVAIATASGFDEAELLRLAAGVERASEHPLAHA
    IVTAASDRSLDLAPVDGFEAPTGKGATGRVAGRSVVIGNVDYLASLGIDTAPLADIAEHHRADGATVVSVGIDGRFAGLI
    AIADPVKASTPDALRALAAEGLRVIMLTGDNRTTAQAVARKLGIADVEAEVLPDQKSAVVEKLRKQGRIVAMAGDGVNDA
    PALAAADVGIAMGTGTDVAMESAGITLLKGDLGGIVRARKLSQATMRNIRQNLFFAFIYNSAGIPIAAGILYPSFGLLLS
    PIIAAAAMSLSSVSVIGNALRLRATSLD

    >gi|86751059|ref|YP_487555.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodopseudomonas palustris HaA2]
    MQHDVIVIGGSYAGMAAALQLLRARRSVLVIDAGERRNRFAAHSHGFLGQDGADPAAIAASARRQIETYKTLRWIDGVAD
    AASGCKDDFTVTTRDGAQHRGRRLLFATGVSDRLPAIEGLQPRWGVSVFL
    CPYCHGYELDQGRIAVIATGPMSLHQAQLL
    PEWGEVTLFTNAAVAPDAAARADLTARGVTIEDSPIARVDGHADIVLSDGRRLAFAGIFTTSHNAPASPVAESLGCALSE
    TPFGTQIATDEAKQTSVPGAFACGDAARVPHSLSLAVADGAWAGASLHRSLVWPDA

    >gi|86751342|ref|YP_487838.1| methylated-DNA--protein-cysteine methyltransferase [Rhodopseudomonas palustris HaA2]
    MTAYNYAMFDTALGRCGIAWGDRGVVAVQLPQPSEAQTRARIAQRQGAIDEAAPPAPVQDAIDGIVALLAGQPIDLTHIA
    LDLDGVSEFQRGVYAIARTIPPGHTLSYGDIAKRLGGVELAREVGQALGRNPVPVIVP
    CHRVLAAGGKPGGFSANGGVAT
    KLKLLSIEGAAVNYTPSLFD

    >gi|86751366|ref|YP_487862.1| glutathione S-transferase-like protein [Rhodopseudomonas palustris HaA2]
    MDLYFSPLACSMATRIALYEAGGSAVFHEIDSATKTVLADGSDFRKLNPLGLVPVLRTETGVVLTENAAILQYIADRYPS
    SPIGAGSGIERAKLQQWLNFIATELHRGLFALLLKAPPDVKAFAVEVGVSRLDYLNDHLQGRDYLLDRFSVADAYLATVL
    NWSRATPQIDLAKWPAIKAYAEFLHQRPSVARALSEELPLFQAEMARHKKAA

    >gi|86751393|ref|YP_487889.1| rhodanese-like protein [Rhodopseudomonas palustris HaA2]
    MTTNVKQMMEAANAAVPRVTPDQAREMMGKGAVVIDVRDAPEVENSGKVEGSLHISRGMLEFRADPDTAFHDKRLAKDRP
    VIVY
    CASGGRSALAGKVLKDMGYAEVYNLGAFKDWTDAGGPIEKPIDRGM

    >gi|86751401|ref|YP_487897.1| twin-arginine translocation pathway signal [Rhodopseudomonas palustris HaA2]
    MELEPMMITRRSALMTALSLAPALAASKAWAAPAAPASDDNVLSTEAVLRDPDIPVAGNPDGDITIVEWSDYRCPYCKKV
    APDLRQVVKDDGKVRLVLKDWPIFGGISVDAAKMVLASKYQGKFFEAHDALIGSTAKLTSAGLTELLGAGGVDVARATRD
    LDTNGAAIEAILARNDAQAKAFGFQGTPAFIVGRFRVPGVLDVAMFKQAIKDARAAAAQQKK

    >gi|86751410|ref|YP_487906.1| hypothetical protein RPB_4308 [Rhodopseudomonas palustris HaA2]
    MMPSFLDKAWSPYVAGVVIGLLQIPAFLMIQTALGASSSFVTVGDALASWIDPSLLQIKYAASHVAPTAKNLWQVALVGG
    IAIGAFLSMKLSGARRQPISPIWSRALGSSSATLRYAVAFVAGFLMLFGARIADG
    CTSGHGVSGVAQLSVGSTVAVAAMF
    VGGIVTATLLLRRI

    >gi|86751462|ref|YP_487958.1| thiol:disulfide interchange protein [Rhodopseudomonas palustris HaA2]
    MTDRLFRALILLVAIAAGVHGALAAGPAQAAPFELSVQPGADGVDLTWRIAPDDYLYRDKIVVTTADGARVALRTPAGEI
    KDDPNFGMTEIYHRSLTATIPADAVNGASRLTVSYQGCAERGICYPPVTASVDLGTYQVSIAGGATPSASPAWPSDMPAL
    PDLAAPAETPAPFAASVLPSMTQGWLPLLLAFAGFGLLLAFTPCVLPMMPIVAGMLTRSGPNLSPARGFALASIYTLAMA
    AAYATLGVAAAWSGQNLQSALQAPLALAVMAAIYVALALSSFGLFELQLPARFGGDLAGRLHGRAGPLLGAAALGFTSAL
    IVGPCVTPPLAAALLYVAQTGDMLRGAAALFALGLGMGFPLILVGLFGAGVLPRSGPWLVTIRQLFGFAFLGLAVALIAR
    VLPGSVALLLWAGLAIGLAAFLGAFDRLAPQGGATRRFGKAAGVAVFVYGATLIVGAAGGSDDPLRPLAVFGADQPAAAA
    MFAAPVTSIRALDQAISDGRARGKPIMIDFSADW
    CTSCKTMEREVFGDPAIRQRLQDLTLIRADVTRSDAETAALMKRFD
    VVGPPTVVFLDRRDGREITAARTVGEVTADSFVKTLQRVGAAS

    >gi|86751463|ref|YP_487959.1| DSBA oxidoreductase [Rhodopseudomonas palustris HaA2]
    MNRRQSLMILGALATVPLVKFFGAPSAWAEGVDVKAILNDPDAPETGNPKGNLTIVTYFDYNCPFCKKSEPDLEKVVRDD
    GKIRLVYKDWPILSEASVYGAQMALGAKYQGKYQAAHDALMAIPGRGISKDQMRDAVAAAGVDMARLQGDLGTHGDAITA
    LLRRTLSQADAMGLQGTPVYLIGPYKVAAALDAAAFKKVVDQARARPPAK

    >gi|86751468|ref|YP_487964.1| hypothetical protein RPB_4366 [Rhodopseudomonas palustris HaA2]
    MNLEQFIERFGETAALTAGGLAVGIAFGACAERSKFCLRAAVIEFSEGSLGPKLAVWLLTFSAAVAATQAAIATGLLDVS
    EARQLAATGSLSGAAIGGLMFGAGMILSRG
    CASRLLVLSGTGNLRALVTGLILTIVAQASLRGVLSPAREFLSQLWTLPG
    GAARNLLSVAHVGSVVGASLGVFGLAVAFWLAWRNRIGIVNGVAAIGVGLAVTAGWLVTYTLSLYAFEPTTVKSVSFTGP
    SADTLMGLINSPSVPLGFDIGLVPGVFVGSLVAALIGREWKLQGFHDGLSMGRYAAGAFLMGFGGMLAGGCAVGAGVTGG
    SIFAVTAWLALAAMWLGALVTHTLIDAKAAALAPALTTNQTGK

    >gi|86751477|ref|YP_487973.1| twin-arginine translocation pathway signal [Rhodopseudomonas palustris HaA2]
    MIDRPMSRRHALAALGAGALGLRMMPAFAKPVLGDDGLYQLDWYLQSFLDLKDDLDGATAKGKRFAILWGLKGCPSCKKM
    HEVHLSDPAIAGYIRDHFEILHLNHIGAREVTDFDGGRLGEKAFAQAYGIRFTPTLQFFPDSSEGLAARKPQDREVARMP
    GLLEPPEFLAMFRYVREKGYQSAPFTEWLKKPA

    >gi|86751481|ref|YP_487977.1| hypothetical protein RPB_4379 [Rhodopseudomonas palustris HaA2]
    MQDTSAWLLALTGLGIGTAAGFFVRLARLCSFGAVEDALMGGDTRRLRIFGLALGIALIGTQALVIAGVLDPGQTNYTAP
    ALPLVSIMLGSVLFGIGMAMVGT
    CGFGSLVRLGTGDLRSFVVILVLGGAAYATLRGVFSGVRITGLEQLSVAMPEGVSTD
    LASLTRHLFGMDLRAAIAALGGGALCLLAFGDKRLRRTPRLLTAGIALGLLTIAGWLATTRLADEFAGPVHPQSLTFVST
    IGKAIYAGLLNAANFADFGVGTVFGVVLGSFIAAWRADELRWEAFDDDHEMRRHLGGAALMGVGGILMGGCTIGQGITAG
    SMMALSWPIAIGGMMLGARMGIAVLVDGSPAELIGRSWGRLRGALRRRPPMPLRASDSSSRLPAVPSDAPRPTAPRSPAE


    >gi|86751688|ref|YP_488184.1| OsmC-like protein [Rhodopseudomonas palustris HaA2]
    MSVDKVLYRATATATGGRDGRGVSSDGQLDLALTTPKELGGPGGAGTNPEQLFAVGYSACFLGAMKFVAGRDKLPIPKDV
    SVTGTVGIGPSATGFGIEAELKISLPGMDRAQAQTLVDAAHAV
    CPYSNATRGNIDVTLTLV

    >gi|86751693|ref|YP_488189.1| thioredoxin-related [Rhodopseudomonas palustris HaA2]
    MFQAQLTRKTFTRAVLATALTAMMPLASAFANPVTPYTPSAFKAAQAAGAPILIAIHADWCPTCKAQTPIIDRLAGDPKF
    AKLKIFRVDFDGQKPVVKEFGANMQSTLIVFKGTAEQGRSVGDTKEASIATLLGKAL

    >gi|86751699|ref|YP_488195.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodopseudomonas palustris HaA2]
    MTDFATPAPQLNAPAPAFNAPTTHGPKTLADYAGKWLILFSHPADFTPVCTTEFIAFAKKHDAFAARGAELLGLSIDSHY
    SHIAWMLNIKEKFGVEIRFPIIADLSMTVARAYGMIQPGASDTSAVRATFLIDPEGKLRAMVYYPMIAGRSVDEIYRLLV
    ALQTADANKCAMPESWQPGDAVIVPPPATAAAALARAGEGYDTVDWYYSTRAL

    >gi|86751701|ref|YP_488197.1| glutathione S-transferase-like protein [Rhodopseudomonas palustris HaA2]
    MKLYYSPGACSLSPHIALSESGLPFELVKVDLRAKKLENGDDYTQINPKGSVPALGLDDGSVLTEGPAIVQMIADKIGGG
    KLAPENGTPERYRLQEWLNFISTDLHKSFGPLFSPVLGDDAKQFFKDRIAKYFAYADKQLAGKDYLMGSSFTVADGYLFV
    ILSWAERMKIDTSAFPNLVAFKARVGARPQVQAALQSEGLMQKA

    >gi|86751807|ref|YP_488303.1| methionine sulfoxide reductase A [Rhodopseudomonas palustris HaA2]
    MFFTRKSAAMPSASEALPGRATPIPTARSHFVNGARIQPPYPEGLQQAVFGLGCFWGAERKFWELGDGVYTTAVGYAGGH
    TPNPTYEETCSGRTGHTEAVLVVFDPTKISYEALLKTFWESHDPTQGMRQGNDVGSQYRSAIYTFGDAQARAAEASREAY
    QQALGARRFGPITTEIAPAGAFYFAEDYHQQYLAKNPGGYCGLGGTGVSCPVGIGVTA

    >gi|86747416|ref|YP_483912.1| hypothetical protein RPB_0290 [Rhodopseudomonas palustris HaA2]
    MGRLFVLRRSRTTVEAVVTCSHAKAMMIGVDGFSRWSGALGLCALIAMVRPSAADPRAVVELFTSQGCSSCPPADRIIGE
    LARDPSIIALSMPIDYWDYLGWKDTLADSRFSARQKAYSQMRGDRDVYTPQVIVNGQTHLVGSNRVGIDGAIKSTDQIPG
    TMTVPVRMAVNGKEIKVSVAAAPPGERVAQGEVWICSVSKAVPIAIARGENRGREVVYHNVVRNLLKVGDWNGAAGSWSV
    PLENIAHDGIDAAAVYVQDGNRDRPGAMLGAAFTSLH

    >gi|86748930|ref|YP_485426.1| alkylhydroperoxidase [Rhodopseudomonas palustris HaA2]
    MKPRLNPAAAAPDAYKAMIALETTIKASGLEPSLIELVKMRASQINGCAFCLDMHSKDARAHGETEQRLYLLNAWRESPA
    YTDRERAALAWAEALTLVAQTHAPDADYELLTQHFSAAEQANLTILIGAINTWNRIAIGFRLIHPVAPALHAKAS