Rhodopseudomonas palustris CGA009

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|39933093|ref|NP_945369.1| putative cation (heavy metal) transporting ATPase [Rhodopseudomonas palustris CGA009]
    MLQTRDFSHYVKDVDGRIAHLDLAVEGVHCASCMAKIERGLQSIPDVTLARVNLTDRRLAVEWNKGSTLEPGQFIDRLAE
    LGYKAYPYEPVRAEVEEAERTKFLLRCLGVAVFATMNVMMLSVPVWYGGDLSPEARDFFHWLSALVALPCAAYAGQPFFQ
    SAFRALKAKSVNMDVPITIGITLALGMSLVETINHAEHAYFDAAVMLIAFLLAGRFLDQKMRQKTRAVAGNLAALKAETA
    TKFVGPDEISEVPIAAVRAGDIVLLRPGERCAVDGTVIEGRSEIDQSLITGETLYVPAERGTQVYAGTLNISGTLRVRVD
    AAAEGTLLSEITRLLDHALQARSRYVRLADRASQLYAPVVHATALLTIIGWVLAGASWHDAIVIGIAVLIITCPCALGLA
    IPAVQTVASGAMFRAGVLLNAGDAIERAASVDTIVFDKTGTLTLPELDVVNAAGIPPEVFDLAGRLALASHHPVAAAVAR
    AAHAKSPLPNVVEEPGRGVRTVFGGQELRLGSPAFCGADAEANQILSEDPEVSVVAFSRGEQRVVFAVRQLLRPDAAKTI
    DALTNRGIAVELLSGDREPAVRHAAAALGVSAWRASVTPAEKIAHIEALKKQGRIVMMVGDGMNDAPSLAAAHVSMSPIS
    ATHLSQATADLVFLGKELAPVLAAVDYSRKAMAVMRENLGLAIGYNVLAVPIAIAGYATPLIAALAMSGSSLLVMLNAMR
    ARRVRRGAAPWK

    >gi|39933123|ref|NP_945399.1| glutathione S-transferase [Rhodopseudomonas palustris CGA009]
    MYTLFHHPFCPLSRFIRLALGEHGLDLRLVEERSWERRTAFLALNPAGTTPVLVAEGRPPIPGAGVIVEFLDEVHGVEMG
    DRRLLPQSTAERIEVRRLLSWFNDKFFEEASGPLMTERIYKRFMSEEDGGGPPAMDVIRAANANVRYHLAYIGWLARTRN
    FLAGDRMTYADLAAAAHLSAIDYLGDVPWIEDEAAKAWYARIKSRPSFRPLLSEWLAGVPASRTYVDLDF

    >gi|39933153|ref|NP_945429.1| thioredoxin [Rhodopseudomonas palustris CGA009]
    MAVGKVSDADFENEVLNAQGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVDESPVTASKYGVMSIPTLMIF
    KGGEMASRQVGAAPKAKLQQWISAAV

    >gi|39933166|ref|NP_945442.1| putative molybdenum cofactor biosynthesis protein [Rhodopseudomonas palustris CGA009]
    MLSAEELERYARHIVLRDVGGPGQAALKSARVLVVGAGGLGAPVLMYLAAAGVGTLDIVDDDIVTLSNLQRQVIHATPDI
    GARKADSAASRILALNPNVRVVQHRVRLDGSNALALIGGCDLVLDGSDNFATRYLVSDACYLAKKPLITAALGQFDGSLT
    TIRAHERNAAGEPNPTYRCLFPEPPPAGTVPS
    CEEAGVMGALAGVLGSMMALEAIREIVGFGEGLVGRLVMIDARAMRFE
    TLRYSRDPQNPLNGDAPTITDLSRHL

    >gi|39933262|ref|NP_945538.1| dihydrolipoamide dehydrogenase [Rhodopseudomonas palustris CGA009]
    MATYDLVVIGTGPGGYVCAIRAAQLGLKVAVVEKNATLGGTCLNVGCMPSKALLHASELFEEAGHSFAKMGIGVSAPKLD
    LPAMMNFKQQGIDGNVKGVEYLMKKNKIDVLVGKGKILGTGKVEVTGADGKATSVEAKSIVIASGSAVAQLKGIEIDEKR
    VVSSTGALSLDKVPGKLIVVGAGVIGLELGSVWRRLGAEVTVVEFLDRILPGMDGEVVKQFQRILEKQGFAFKLGAKVTG
    VDTSGAKLAVKVEAAAGGNPETLEADVVLVAIGRVPYTEGLGLKEAGVALDERGRVVIDDHFATSLKGVYAIGDVVRGPM
    LAHKAEDEGVAVAELIAGKAGHVNYDVIPGVVYTTPEVSSVGKTEEDLKQAGVAYTVGKFPFTANGRSKVNQTTDGFVKI
    LADAKTDRVLGVHIIGREAGEMIHEAAVLMEFGGSAEDLARTCHAHPTRSEAIKEAALTVGKRAIHM

    >gi|39933278|ref|NP_945554.1| hypothetical protein RPA0201 [Rhodopseudomonas palustris CGA009]
    MAGERKAAYAKGRLFVLRLLDGWRRAAVPKHSAKAARQTTMNGVGGFSRWSGALGLCVTIATADFAAAEPRAVVELFTSQ
    G
    CSSCPPADKIIGELARDPSVIALSLPIDYWDYLGWKDTLADSRFTARQKAYSQVRGDRDVFTPQVVVNGSAHLVGSNRA
    GIDSAIKTTDKTDGVMTVPVSVAVEGKEIKVSVAAAPQGETAKSGEVWICAVSKAIPIEIGRGENRGRHVTYHNVVRNLL
    KVGDWTGAAEHWTVPLENVVGDGVDAAAVYVQNGSREKPGAMLGAAFTSLN

    >gi|39933283|ref|NP_945559.1| periplasmic protein thiol [Rhodopseudomonas palustris CGA009]
    MSDTFDPASPKRRSWLVVLPALLFAGLAVLFWFRLGDSDVSRIPSALIGRPAPQTPLPPLDGLSRDGSQVAGLDPAMFKG
    KVSVVNVWASW
    CVPCHDEAPLLMTLAQDTRIQLVGIDYKDKPDNARRFLGRYGNPFAAVGVDASGRAAIEWGVYGVPETF
    VIGRDGKIAYKLVGPITPDNIEKVLKPEISKALAAPQS

    >gi|39933344|ref|NP_945620.1| thioredoxin [Rhodopseudomonas palustris CGA009]
    MTILEQGSGAAPQAAADLIKDTTTQSFVRDVIEESKRQPVLIDFWAQWCGPCKQLTPILEKAVRAANGKVKLVKMNIDEH
    PSIPGQMGIQSIPAVIAFVDGRPADGFMGAVPESQVNAFIEKLTAGMPGGAPTAAELLQEAEAVLAEGDVQTAASIYAEV
    LRADGTNVAAIAGLARCYMQTGATEQAKKTLGLVPEAKREDAAVKAVQAMIDLAEQAQSLGPIAELEQKVAADPLDHQAR
    FDLAIALNAADRREDATTHLLDIVKRDRKWNDDGARKQLVQFFEAWGPTDDATVEGRKRLSTILFS

    >gi|39933418|ref|NP_945694.1| O6-methylguanine-DNA methyltransferase [Rhodopseudomonas palustris CGA009]
    MAARAAADNISGMMNLAIADHQLIKPGARDSALADYDCVRRAIAFISQKWKAQPTIEAIADAAGLTPDELHHLFRRWAGL
    TPKAFMQALTLDHAKSLLRDSASVLDAALASGLSGPGRLHDLFVTHEAMSPGEWKSGGAGLSLRYGFHPSPFGTAVIIAS
    DRGLAGLAFADPGEEQAAFVDLQQRWPRALCVPDQEATSPLAQRIFDPAQWRAEQPLRVVLIGTDFEVRVWETLLKIPLG
    KAVCYSDIAAKISLPKASRAVGAAVGKNPISFVVP
    CHRALGKGGALTGYHWGLTRKQAMIGWEAGQLRAE

    >gi|39933450|ref|NP_945726.1| thioredoxin [Rhodopseudomonas palustris CGA009]
    MSDHLVVCTHCGGVNRLPEQRPALDGKCGKCGHRLFEGHPADVSAELFDKQVSRSSVPVLVDVWAPWCGPCRAMAPAYEQ
    AARELEPNVRLIKLNSDNEQQVAGRLGIQGIPTMILFDNGRERARTSGAMPAGEIVRWVRQHLPA

    >gi|39933675|ref|NP_945951.1| glutaredoxin GrxC [Rhodopseudomonas palustris CGA009]
    MPAAIEIFTRPGCGYCSAAKSLLNRKKAAFTEYDVAVDPGFRVKMDERAGPGATYPQIFIGDLHVGGCDDLYALDREGKL
    DALLADEKAAS

    >gi|39933906|ref|NP_946182.1| organic hydroperoxide resistance protein [Rhodopseudomonas palustris CGA009]
    MSVEKVLYRATATATGGRDGRGVSSDGHLDVALTTPKELGGAGGAGTNPEQLFAVGYSACFLGAMKFVAGRDKLPIPKDV
    SVTGSVGIGPIPTGFGIEVELKISLPGMDPAQAQTLVDRAHIV
    CPYSNATRGNIDVTLTLV

    >gi|39934075|ref|NP_946351.1| nitrogenase-associated protein [Rhodopseudomonas palustris CGA009]
    MAKVVFYEKPGCVGNARQKALLTASGHELEVRNLLAEPWTRETLRPFFGDKPLIEWFNQSSPKVKAGAIDFAALGVEAAL
    ALMIEDPLLIRRPLMQSGDRREVGFDQATVHAWLGLQTGGPRVFDGCAMDD

    >gi|39934097|ref|NP_946373.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
    MMITRRSAVTAALALAPTLVAAKAWAAPTAPDAEDVLSTDAVLYDAEIPVAGNPKGDITIVEWSDYRCPYCKKVAPDLTQ
    VVKEDGNIRLVLKDWPIFGGVSVDAAKMVLASKYQGKFLQAHEALIGSTSKLTETTLTETLKAGGIDVDRATKDLDANRA
    TIEAILKRNDTQAKAFGFQGTPSFIVGRFRVPGVLDVALFKQAIKDAREAAKKTDKK

    >gi|39934167|ref|NP_946443.1| carboxymuconolactone decarboxylase [Rhodopseudomonas palustris CGA009]
    MHKNWIDLTGELSVALREVRTGAPDVMKGFSAIAQAALKANALDTKTKELIALAISVATRCDGCIGFHAEAAVKHGATRD
    EVMETMGMAIYMGAGPSVMYAAQAVEAYDQFVKKKAAAASPAE

    >gi|39934190|ref|NP_946466.1| hypothetical protein RPA1115 [Rhodopseudomonas palustris CGA009]
    MTPRLNPAAAAPDAYKAMVALEKYIQGSGLEPSLIELVKMRASQINGCAFCLDMHSKDARARGESEQRLYLLNAWQESPL
    YTDRERAALGWTEALTLVAQTHAPNQDYAAVKSHFSDAEQVNLTLLIGAINTWNRIAIGFRLLHPTPAVAHAKAS

    >gi|39934676|ref|NP_946952.1| hypothetical protein RPA1606 [Rhodopseudomonas palustris CGA009]
    MTVRPGRWWSAGRAAKGFAMSIEQFIDNEVKANDVVLFMKGTPQFPQCGFSGQVVQILDHIGVPYKGHNVLENAELRDGI
    KVYSNWPTIPQLYVKGEFVGGCDIVREMFQAGELQKLFTDKGIKAAA

    >gi|39934800|ref|NP_947076.1| OsmC-like protein [Rhodopseudomonas palustris CGA009]
    MPTERFQFAGSGGHQLAAALDLPDAQPLAYALFAHCFTCSKDNLAARRISAAMAARGIAVLRFDFTGLGASEGEFENATF
    SSNVADLVLAADHLRATHRAPTLLIGHSLGGAAVLAAAAQIPEAKAIATIAAPSDPSHVTGLFADDIETIRTEGRVNVSL
    AGRPFTIKREFLDDIAEHNLMAEIGKLHKALLILHAPTDDTVGIDNATKIFLAAKHPKSFVSLDHADHLLSDRRDANYAA
    GVIAAWAQRYIDAEPPAPTAGAPEVPRLVTVQETGDGKFQQQISVGPHRLVADEPASVGGRDSGPGPYDLLLSALGA
    CTS
    MTMRLYAERKALPLDRVTVTLSHAKIHAEDCAECETKVGLLDRIERVIGIEGDLSAEQRAKLIEIADKCPVHRTLTSEVS
    IITRSTD

    >gi|39935052|ref|NP_947328.1| glutathione reductase [Rhodopseudomonas palustris CGA009]
    MADFDADLFVIGGGSGGVRAARIAAGYGARVVVAEEYRFGGTCVIRGCVPKKLMVYASQVHEEIRDAAGFGWSIPTAEFN
    WSALIANKDKEIARLEQIYANNVEKAGARTIKARAVFDDPHTLLLSTGEKVRAKTILIATGGAPNHGKPIPGIEHVISSN
    EVFHLPQQPKRILIQGGGYIALEFACIFAGLGSDVTLVYRGDNILRGFDEDVRTHVRTEMERAGITIITGCTVTAVEKLG
    EEYTSHLSSGSSIASDQVMFAIGRHPAVASLGLEKAGVAINPDNGGIAVDDHCRTSVPHIYAVGDVTHRTNLTPVAIREG
    HAFADNVFGGKQIQVDYAYVPTAVFSQPQVGTVGLTEAQARAQYSVVDIYKTDFRPMKGTMSGSQSRVLMKLIVDGTTDR
    LLGCHIVGPDAAELVQVVAVAMKMKATKADFDGTMALHPTAAEELVTMRTRTARYQREAAE

    >gi|39935081|ref|NP_947357.1| rhodanese-like protein [Rhodopseudomonas palustris CGA009]
    MAGQVEDLTPQEVAKGIADGRYLLVDVREPNEVAVEAYPDAVVVPLSTFDPKAIPDPAGKEVVFACRSGKRSVTASMAAQ
    AAGLPYNRHLAGGILGWKAAGLPTKPGH

    >gi|39935326|ref|NP_947602.1| arsenate reductase pump modifier [Rhodopseudomonas palustris CGA009]
    MAVDIVIYHNPECGTSRNTLAMIRNAGIEPHVIEYLKTPPSRALLVELIDRAGITPRDLLREKGTPYAELGLGDTSLSDD
    ALVDAMMAHPVLINRPLVVSPLGVKLCRPSEAVLDLLPEAQQGAFAKEDGEKVVDALGQRIA

    >gi|39935341|ref|NP_947617.1| hypothetical protein RPA2272 [Rhodopseudomonas palustris CGA009]
    MPTTLYGIKNCDTMKKARTWLDGHGVSYAFHDYKTAGIDQEHLERWAKQAGWETLLNRAGTTFRKLPEADKEGLTEAKAI
    ALMLAQPSMIKRPVLEHGRKLLVGFRPEAYAEAFG

    >gi|39935508|ref|NP_947784.1| DSBA oxidoreductase [Rhodopseudomonas palustris CGA009]
    MLSFRPLATALLALAIVGAPAVASAQKFSDEQRSQIETIIKEYLVSHPEVLEEASEELGKRQAAAQAEKHQQAIKDNADI
    IYNSPRGVTVGNKNGDVTMVEFFDYN
    CGYCKRAMTDMMELMKDDPNLKVVLKEFPVLGPPSVEAAQVAIAVRMQDPTGKK
    YLDFHQKLLGGRGQADKARALAAAKDAGLDPAKIEKDMNSPEVRATIEESFKLAESMGMNGTPSYVIGKQVVVGAVGLDT
    LRQKINTARCGKDKC

    >gi|39935509|ref|NP_947785.1| antioxidant protein [Rhodopseudomonas palustris CGA009]
    MHDLVRRVTQHSTNVQETVPMSLHIGDIAPDFTADTTKGKISFHDFIGNSWVFFFSHPADFTPVCTTEMGKTAKLAQPFA
    SRNVKPIGLSTDTVDEHLKWIADVNDTQQTDLQFPIIADPELKVAKLYDMIHPNQSDTAAVRSVFIIDPNKKIRLTMTYP
    MNVGRNFDEILRVIDALQFADKHTVAAPADWRPGDKVIIPLSVKGEAATKAFPQGWEEPRPYLRLTTIK

    >gi|39935522|ref|NP_947798.1| bacterioferritin co-migratory protein [Rhodopseudomonas palustris CGA009]
    MPKPTPKKPSKKTAKPAVEKTSKVTTKAAAKTTAAKTTAVKKAAAKSPAAKTPAAKTAATKAAAKTSATKSSATKPAGLA
    EGSVAPDFKLPRDGGGEISRADFAGRKLVLFFYPKANTPG
    CTREAIDFTRLAADFKACGTAVLGVSADSVKAQDSFRDKH
    QLATPLLSDPTHAMLEAYGAWGEKSLYGRKLQGIIRTTVLIDADGCVARVWRNVKVDGHAHQVLAAAQS

    >gi|39935536|ref|NP_947812.1| hypothetical protein RPA2470 [Rhodopseudomonas palustris CGA009]
    MATARPRPQVMRLTDAAAGRVKELMVRADSEILGLRVGIKNGGCAGQSYTVEYAHDIKPNDEVIEDKGVKILVDPKAVLF
    LLGTEMDYKADRMQAQFVFNNPNQISACGCGESVELKPASIDG

    >gi|39935687|ref|NP_947963.1| hypothetical protein RPA2621 [Rhodopseudomonas palustris CGA009]
    MDALELRALQAPIKERYKTDPTTALITLKAKGAIDADGISCKVETGKALATAGLHPATGGSGLELCSGDMLLEALVACAG
    VTLKSVATAIELPLTRGDVFAEGDLDFRGTLGVDKDTPVGFREIRLRLEVGTDAPQDKLDLLLKLTERYCVVYQTIKNGP
    KVSVSLHRV

    >gi|39935755|ref|NP_948031.1| thiol-specific antioxidant related protein [Rhodopseudomonas palustris CGA009]
    MTKQPDLLKVDWSAIPAPDDDGAAAHLPGARIQPVALPATDGSSVTLSSLPGRTVLFIYPRTGVPGQISLVDDWDMIPGA
    RG
    CTPQTCSFRDLFTDLKTAGADAVFGLSTQSSAYQSEMATRLHLPFPVLSDESLELTRALNMPTMQVAGMTLLKRMALI
    IDDGRISHVFYPVFPPDRNAGDVLEWLKANPR

    >gi|39935921|ref|NP_948197.1| HesB/YadR/YfhF [Rhodopseudomonas palustris CGA009]
    MTESSVTISERAARRIGEILKGEGQGAMLRISVEGGGCSGFQYKFDVDRTKTDDDLVIAKEGAVVLVDSASVPFLAGSEV
    DFVDDLIGASFRVNNPNATASCGCGTSFSI

    >gi|39935928|ref|NP_948204.1| dihydrolipoamide dehydrogenase [Rhodopseudomonas palustris CGA009]
    MSETSFDVIIIGSGPGGYVAAIRAAQLGFKTAIVEKSYLGGICLNWGCIPTKALLRSAEIYHYMQHAKDYGLSADNISFD
    PKAIVQRSRGVSKRLNDGVGFLMKKNKISIIWGQATIDAPGKLTVAASKTDAPKGALPPGSYQAKHIIVATGARPRVLPG
    LEPDKKLVWTYFEAMVPEVMPKSLLVVGSGAIGIEFASFFHTMGAKVTVVEVLPQILPVEDAEIAALARKRFEKQGIKIL
    TGAKVTKLDKKADSVVATIDPGNGKPETAEFDRVISAVGVVGNVENLGLDKLGVKLDRGTIVTDGLGRTNVPGLYAIGDV
    AGPPMLAHKAEHEGVICVEAIKGLHPHPLDKSLIPGCTYCQPQVASVGLTEAKAKEQGREIRVGRFPFTANGKAIALGED
    QGLVKVIFDKKTGQLLGAHMIGAEVTELIQGYVVAMNLETTEEELMHTVFPHPTLSEMMKEAVLDAYGKVLNA

    >gi|39936107|ref|NP_948383.1| hypothetical protein RPA3044 [Rhodopseudomonas palustris CGA009]
    MTAHFPFDNSYVALPPNFFARVAPTPVAAPRLIKLNRPLAVQLGLDPDLLETPEGAEILSGNQMPETAASIAMAYAGHQF
    GNFVPQLGDGRAILLGEVVDRNGVRRDIQLKGAGRTPFSRMGDGRAALGPVLREYIVSEAMAALGIPTTRSLAAVLTGET
    VLRDPIQPGAVLTRVASSHIRVGTFQYFAARGDLASVRALADHAIARHYPEAAQAPSPYLALLEGVIGRQAELVASWMMV
    GFIHGVMNTDNCSVAGETIDYGPCAFMDTFDPKTVYSSIDQFGRYAYGNQPPIALWNLTRLAECLVRLLADDDDKGIEIA
    QTALGGFAEQFNAAYLAKLAAKLGLFTSQPDDQQLSQEFLTALAKGEADFTLAFRRLSDAAVDPSDLGEVRALFADPAAF
    DEWAPRWRARIATEPQDATTRQAAMRRVNPAYIPRNHRIEAVIRAAVDRDDFAPFEEILTVLANPFEEKAEFARYAEPPQ
    PHEQVLETF
    CGT

    >gi|39936323|ref|NP_948599.1| putative cation-transporting P-type ATPase [Rhodopseudomonas palustris CGA009]
    MATDAYRIRVEGMDCASCALKIETAMQRLSGVADVRVSYSAGTLALRFDQDRISPSTIDDELCSLGFRPQAIASSPSSIA
    TERKRLPWWQDAKLQSVMIAAAVFALAFALSQLFPAFERWLYSAAAAICLIPIARRALIGARSGSPFSIETLMSVAAVGA
    VMIGEAEEAAVVIVLFGVGEWLETFAAGRARAGIESLIDVVPRTARRLRDGSDEVEEIPAADLMIGDVVVVRPGDRIPSD
    GKVIDGHSDVNEAPITGESVPVAKAVGDHVYAGSINANGELRIETTNAAADNTIARIIHLVEQAQETKAPTERMIDRLSR
    WYTPAAMLVALLVIIVPPLGFGEDWATWIYRGLATLLIACPCALVISTPAAIASGLAAGARKGLLIKGGAVLETLGKVKT
    VAFDKTGTLTLGQPQVTDVVSVIGQDDAVLARAAAVEGNTSHPIGQAIVRAAKARALQTPIVFGGSQAVPGKAISARLKD
    GFAFVGSPHFAAERTTIPPELATTISGLEHEGKTVVVLISGKTCEGVIALRDEPRPDAAGALRQLTSKGIAVVMLTGDNA
    RTAQAIAGQLGIEARAELLPDAKLAEIRRLKAVSPVAMVGDGINDAPALAAASVGIAMGGGTDVALETADAALLNDRAHG
    VAELIALSQATLGNIWQNISIALGLKAVFLATSLLGVTTLWMAILADTGATVLVTANALRLLRWRASAS

    >gi|39936616|ref|NP_948892.1| arsenate reductase [Rhodopseudomonas palustris CGA009]
    MDVVIYHNPACGTSRNTLGLIRNAGIEPHVIEYLKCPPTRALLKQLIARAGLTPRQALREKGTPYAELKLDDPALSDDDL
    LDAMIAHPILIQRPLVVTPNGVRICRPSEAVLDLLPPQRGEFVKEDGELVIDASGRRVATV

    >gi|39936619|ref|NP_948895.1| Thiol-disulfide isomerase and thioredoxins [Rhodopseudomonas palustris CGA009]
    MKDVKVLGSGCKRCIETAALVQGEADRLGVPIRLEKVTDYAEIAKFGIASTPGVVVDGKVVHAGGLPKAESIAAWLSS

    >gi|39936624|ref|NP_948900.1| arsenite S-adenosylmethyltransferase [Rhodopseudomonas palustris CGA009]
    MPTDMQDVKDIVREKYASAALKVATGGASCCGSSALPGASPITSNLYDAAQEQGLPAEAMLASLGCGNPTALAQLSPGET
    VLDLGSGGGIDVLLSARRVGPTGKAYGLDMTDEMLALARDNQRKAGLDNVEFLKGEIEAIPLPDHSVDVIISNCVINLSG
    DKDRVLREAFRVLKPGGRFAVSDVVTRGEIPEALRRDVLLWVG
    CLAGALDEADYVAKLAAAGFAQISIEPTRVYDIEDAR
    EFLTGKGIDVDALAPQMQDKFFSGFVRATKPGADGEVPARCCG

    >gi|39936675|ref|NP_948951.1| putative thiosulfate sulfurtransferase [Rhodopseudomonas palustris CGA009]
    MTAHTDPLVSTDWLAERLGDPSVKIIDASFKMPGVLPLPADDYLAAHIPGAVFFDVDAVSDHASSLPHMYPSADQFARDV
    EALGISSGDTVVAYDAGGWVAAPRAWWMFLSFGHANIRILDGGLKKWVAEGLPTEAGKPTIAPGRFSAKLDPSFIRSRDQ
    LVANLDSGAEQVIDARAAPRFEGSVAEPRPGLRAGHIPGSRNLPYNELFDAATGTMKPLAELRQAFERAGLDLGRPVVTS
    CGSGVSAAVLTLALYRLGVRGSALYDGSWSEWGLQDGPPVATGPAA

    >gi|39936676|ref|NP_948952.1| rhodanese-like protein [Rhodopseudomonas palustris CGA009]
    MPQTITRGIKAMLDEANSSIETLTTADAIALHKSGASDVVIVDIRDPREIERDGKIPGSFSCTRGMLEFWIDPQSPYAKP
    IFQEDKKFVFY
    CAGGLRSALAAKTAQDMGLKPVAHIEGGFGAWRDAGGPIEAWAPKKK

    >gi|39936689|ref|NP_948965.1| putative glutathione peroxidase [Rhodopseudomonas palustris CGA009]
    MASIYDFTAKSLVGKDVSLKQFEGKVLLIVNTASACGFTPQYKGLEALQEKYGPRGFSVLGFPCNQFGAQEPGDEAQIAQ
    FCSTNYGVTFPMFAKIDVNGAGAHPLYKFLKDEKGGLLGSAIKWNFTKFLVDRSGRVVSRHAPTTTPEALSKEIETLL

    >gi|39936929|ref|NP_949205.1| DSBA oxidoreductase [Rhodopseudomonas palustris CGA009]
    MSTLKPLTIDVVSDVVCPWCYIGKKRIEQAIALAPEVPVELTFRPFFLNPWVPREGISRDEYLTKKFGSPERYKEIAGRI
    AETAAQEGLEYHPERVQRQPNTIDCHRLIHWASAIGRGPAMKQRLMELYFRDGGDLTDPEVLVQAAVECGLDAADIRARL
    ATDQDVEEVSAQAQEAADKGISGVPTYVFMHQYAVSGAQDPTLIARAIRKLSAELNAEAAE

    >gi|39936998|ref|NP_949274.1| methionine sulfoxide reductase B [Rhodopseudomonas palustris CGA009]
    MIDRRMLLASAALAAVFGFRWLRPDAARAAEKFEIEKTPEEWRKQLTPMQYHILREEDTERPFSSPLLKEHRKGTFACAG
    CDLPLFSSDTKFDSGTGWPSFWQPLSNAVGERTDSTLGMTRTEVHCRRCGGHLGHVFDDGPKPTGLRY
    CMDGYALTFHPA
    TPNAS

    >gi|39937015|ref|NP_949291.1| thioredoxin reductase [Rhodopseudomonas palustris CGA009]
    MTETIKTDVLIVGAGPCGLFAVFELGLLDVKAHLVDILDKVGGQCAELYPEKPIYDIPGIPMVTGHGLTEALMEQIKPFN
    PTFHLSEMVENVEKIGDPGFRVTTNAGKVFECTVLVVAAGGGSFLPKRPPVPGVEAYEGTSVHYAVRKMEDFRGKDILIV
    GGGDSALDWTLNLNPIAKSMTLVHRRDDFRGAPHSVEQMRQLVASGKLDLKIGQITELQGDNGQLTGATVKLNDNTTSQI
    KCDAMLPFFGLTMKLGPVANWGLDLENNLIPVDTGTFETNVPGIFAIGDINTYPGKLKLILSGFHEGALMAQKAVKYVYP
    DKRVVFQYTTSSTNLQKKLGVN

    >gi|39937129|ref|NP_949405.1| methionine sulfoxide reductase B [Rhodopseudomonas palustris CGA009]
    MSDTKTTSPGKIEKSEAEWRKELTPMQYAVLREKATERPYTGEYEYETRPGTYVCAGCGQTLFESDTKFDSGCGWPSFTA
    PAQASSIDEERDVSHGMIRTEVLCSRCSGHLGHVFPDGPGPTGLRY
    CINSAALKLQPK

    >gi|161610769|ref|NP_949406.2| methionine sulfoxide reductase A [Rhodopseudomonas palustris CGA009]
    MRASFGRLALCAAAAGLLAWSALGPSRAAEEPVVIPPPQLDAKEAGGIQTAVFAGGCFWGVQGVFQHTAGVVNALSGYAG
    GSKASASYPLVSTGTTGHAEAVEVKYDPKRISYGKLLQIYFSVAHDPTQLDRQGPDTGPQYRSAIFTTSDEQKRIADAYI
    AQLDAAKVFGAPIVTKVGPLKGFYAAEAYHQDYLTLHPTQPYIAYNDLPKIEALKKLFPTEYLDKPTLVSSVKATN

    >gi|39937135|ref|NP_949411.1| thioredoxin reductase [Rhodopseudomonas palustris CGA009]
    MPSPVQAKVVIIGSGPAGYTAAIYASRAMLEPILIQGMQPGGQLTITTDVENYPGFADVIQGPWLMEQMEKQALHVGTRI
    KTDLVVDLDLSQQPFRLTCDSGDVYLADTLILATGAQARWLGIPSEQTYKGFGVSA
    CATCDGFFYRGKDVVVVGGGNTAV
    EEALFLTNFAASVTIVHRRDHFRAERILQDRLFKHPKIKVIWDVAVDEICGAENPTKVTHVRLKNVKSGTTSEVKADGVF
    IAIGHAPATELFKDQIKLKPSGYVEVAANSTATSVPGVFAAGDVADETYRQAVTAAGMGCMAALEAERFLALRAGDRQAA
    E

    >gi|39937161|ref|NP_949437.1| putative organic hydroperoxide resistance protein [Rhodopseudomonas palustris CGA009]
    MSALYSTKVTAIGGRAGSVRSDDGLLSLSLALPKALGGKGDATNPEQLFAAGYAACFENAVIHVARAKSVKVADADIEVV
    AEVGLAPNGSGGFVLSVALNVTIAGLEQSVAEAIVAAAHAT
    CPYSNAVRGNIDVVIAVTTR

    >gi|39937254|ref|NP_949530.1| OsmC-like protein [Rhodopseudomonas palustris CGA009]
    MSTTSGSAKWQGGIKDGKGAISTKSGALSDYPYGFASRFEGKPGSNPEELIGAAHAACFTMALSLILGEAKLTAEQMETK
    ADVTLEKQGDGFAITAVHLTLTAKIPGADDATFQDCAAKAKAG
    CPVSKLLNTNITLDAKLVS

    >gi|39937328|ref|NP_949604.1| peroxiredoxin-like protein [Rhodopseudomonas palustris CGA009]
    MTIKVGDRLPDAQFRVMTEDGVQVKTTDDIFKGKKVALFAVPGAYTGTCHKMHLPSIFLNAYAMKDKGVDTIAIVSVNDA
    FVMSAWKRDTDQRNEAIFLGDGNADFTKAIGMEMDGSGFGLGTRSLRYSMVVEDGVVKTLNLEPNPGKVEVSGGDTLLGQ
    L

    >gi|39937487|ref|NP_949763.1| methylated-DNA--protein-cysteine methyltransferase [Rhodopseudomonas palustris CGA009]
    MPLSQHSHVLFDTAIGRCGIVWGVRGIVAVQLPQPTETQTRARITQRHPDSVEAAPTADVQRAIDGIVALLEGAATDFAD
    IPLDLDGTSAFQRRVYDIARGIPAGKTLTYGDIAKQLGGVELSREVGQALGRNPCPIIVP
    CHRVLAAGDKPGGFSANGGV
    ATKLKLLAIEGAAVNYTPSLFD

    >gi|39937517|ref|NP_949793.1| putative sulfide dehydrogenase [Rhodopseudomonas palustris CGA009]
    MTTLKQMMEAANAAVPRVSVDDARHLIEQGALVIDVRDAPEVGNTGKIAGAVNISRGMLEFRADPDSPLHDKHLGKDRPV
    IVY
    CASGGRSALAGKVLKDLGYEKVFNLGAFKDWAEAGGAVEQPIERGM

    >gi|39937522|ref|NP_949798.1| Lipocalin-related protein and Bos/Can/Equ allergen [Rhodopseudomonas palustris CGA009]
    MPQRRGTLLLDLDLLIERFGETTLLTAGGLLVGLVFGATAERSKFCLRAAVIEFSESSFGPKLAVWLLTFAAAVAATQVA
    ITSGVLDVSEARQLAATGSLSGAIIGGLMFGAGMILSRG
    CASRLLVLSGTGNLRALVTGLILTIVAQASLRGVLSPVREF
    LTSLWTLPGGASRNLLTVVHAGPVIGAAFGFALLVWALWLGWRNRIGIITGIAAIGVGLAVTGGWLVTYLLAQHSFAPTQ
    IKSVSFTGPSADTLMGLINSPSVPLGFDIGLVPGVFAGSLLAALIGRDWKLQGFHDGLSMGRYAAGAFLMGFGGMLAGGC
    AVGAGVTGGSIFAVTAWLALASMWLGALATHTLLDAKAAAKADAAPAVEPALSAKQTGN

    >gi|39937531|ref|NP_949807.1| hypothetical protein RPA4471 [Rhodopseudomonas palustris CGA009]
    MTDNGISRRGAIAALGLGALGALSLRPAPAMAAEPVLGDDGLYQLDWYLQSFLDLKEDLEGATAKGKRFAILWGLKGCPY
    CKKLHDVHMRDPAIESYIRDNFEIVHLNHIGAREVTDFDGSKLSEKAFAQAYGIRFTPSLQFFPESADGLAAKKPQDREV
    ARMPGLLEPPEFLAMFKYVREKGYQSMPFTDWLKRPV

    >gi|39937535|ref|NP_949811.1| hypothetical protein RPA4475 [Rhodopseudomonas palustris CGA009]
    MQDASAWMLALAGLCVGVTAGFFVRLARLCSFGAVEDALMGGDTRRLRIFGLALGIALLGTQALVIAGQLDPGQSNYTAP
    ALPLISIAIGSVLFGIGMAFVGT
    CGFGSLVRLGGGDLRSFVVILVLGGAAYATLRGMFSGFRITVLERFAITMPEGVNTD
    LAALTQHLSGIDLRAVIAALGGGLLCLIALGDKRLRRTPRLLAAGVALGLLTVVGWLATTKLADPFAGPVHPQSLTFVST
    VGKAVYAGLLNVANFADFGVGTVFGVIAGAFIAAWHTDELRWEAFDDDHEMRRHVAGAALMGFGGILTGG
    CTIGQGITAG
    SVMALSWPIAIVGMMFGARIGIAVLVDGSPRELIRRRFDAWRELLQRRRAPALTAANRPNHRPAAPSDAPRPTAPHSLAE


    >gi|39937537|ref|NP_949813.1| hypothetical protein RPA4477 [Rhodopseudomonas palustris CGA009]
    MQMPELVIVLGFAIGAAFGVAGLLSGFCLTSGLRDYWTKDDGRKLRSYAVALAVAIIGTQLIAGLGYVDIGKSLYLQPSF
    SAPLIFLGGLMFGLGMVLANG
    CASRALVLLGKGNLRSLLVVGIIAVAAQMTLKGLIAPARLAFLQWTQVSPPHVSVPSLI
    GVLGLGEAFAQIAAVLIAAGALLVFAFSDRSFRRATGQIAAGLVIGLLVVGGWLATGYFGADEFNPIPATSLSFVAPLAD
    TLQYAMFSTGLTLSFGVALAVGVFAGSAATALLTGRFELEGFTSAPHMLRSTVGAALMGAGGAMAYGCSVGQGLTGLSTL
    ALPSFIAVAGIVGGAALGIRRLAPVAALAAR

    >gi|39937547|ref|NP_949823.1| twin-arginine translocation pathway signal [Rhodopseudomonas palustris CGA009]
    MITRRTFTAALSLTGVFAVAGVSPFRLIDSAFAQSKEAAAAADVAKPMSLPDMALGPKDATVTITEYASLTCSHCAAFNE
    QVYPQIKKAYIDTGKIRYVFREFPLDIKAAAGSMLSRCIAKDDSAKYFAVTDVLFRSQTEWVLKDTTEQLKRIGKQAGLS
    GEEVEACLKDQKLLDKIAADQKYANEVLKVNATPTFFINGEMLRGENSFDEFAKRIDALLAKKS

    >gi|39937668|ref|NP_949944.1| HesB/YadR/YfhF [Rhodopseudomonas palustris CGA009]
    MIILTEQAGTAVKAAMSRAGKLDAGLRVMVEAGGCAGYKYLIGLDAEPRVDDAVVEAGGVKVFIDPDSQPLLSGMTIDFV
    ESLEGSGFTFDNPNAGTKCGCGKSFG

    >gi|39937686|ref|NP_949962.1| HesB/YadR/YfhF [Rhodopseudomonas palustris CGA009]
    MDMSFTPSAEKFIRRMLRFSGGTGGFRLVVSAGGCSGLSAQFDIAGAPHTGDAVVDRGDYKLFLPESSLKLLEGVVIDFM
    ETPTSSGFMFHDPKGSNCQCASDSGPKPAAGLHQLREL

    >gi|39937712|ref|NP_949988.1| hypothetical protein RPA4654 [Rhodopseudomonas palustris CGA009]
    MTKPAISRFPVPEIASLPDDIRTRILAVQEKSGFVPNVFLTLAHRPDEFRAFFAYHDALMDKPGPITKAEREMIVVATSN
    ANQCQY
    CVIAHGAILRIRAKNPLLADQIAVNYRKADITPRQRAMLDFAMKVSAQAYEVGDADIEALTRHDFSEEDIWDIA
    AIAAFFGMSNRLANVTSMRPNDEFYAMGR

    >gi|39937802|ref|NP_950078.1| thioredoxin-like protein [Rhodopseudomonas palustris CGA009]
    MTESQPNSVPPRRAGRLTILLATIAVLVVAGAAGIYGIGGLQRNAGGDPVCRPAVALAQQLKPLVRGEVAALTPAAAPLR
    LPDLTFADDGGQPKKLSDFRGRTVLVNLWATW
    CVPCRKEMPALDNLQAKLGSSDFEVVAINIDTRDPAKPKKFLDDEKLT
    HLSVFTDASAKVFQDLKAVGRALGMPTSVLIDREGCEIATINGPAEWDSNDATTLIKAAVKPVAGSSK

    >gi|39937820|ref|NP_950096.1| methylated-DNA--protein-cysteine methyltransferase [Rhodopseudomonas palustris CGA009]
    MLLTMAGTAYTIFDTMMGRCGIAWGSGGVLAVQLAESREIDTRRRLLRLCPDTRESRAEAWIEPVIDGLSAALRGEPWDF
    SDVPLDLGGIPGFDCRVYAALRAIPRGETLTFAEIAKQLRSSGAVHAVGQAIRRNPFTLIVP
    CHRALAAAGDTSGICANG
    GTITRRRLLSLEGALATSGPSLLDVLLPFAPPRQADR

    >gi|39937892|ref|NP_950168.1| methionine sulfoxide reductase A [Rhodopseudomonas palustris CGA009]
    MFFMRKSTAMPSAAEALPGRPTPIPTARTHFVSGNRLQPPFPEGLQQAVFGLGCFWGAERKFWQLGDGVYSTAVGYAGGF
    TPNPTYEEVCSGRTGHTEVVLVVFDPARISYEALLKTFWESHDPTQGMRQGNDVGSQYRSAIYTFGDDQKRAAEASRVTY
    GDALKAKGYGPITTEIAASGPFYYAEDYHQQYLAKNPGGYCGLGGTGVSCPVGVRVTA