Rhodopseudomonas palustris BisB18 uid58443

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|90421537|ref|YP_529907.1| copper-translocating P-type ATPase [Rhodopseudomonas palustris BisB18]
    MTTTLLTRDFSHYVKDVDAEIAHLDLAVEGVSCAGCMAKIERGLSAMPDVTRARVNLTDRRLAIEWKKGALDPSQFIDRL
    AELGYKAYPFEPVRAELDEADRSKFLLTCLGVAAFAAMNVMMLSVAVWAGSDMTQDTRDFFHWLSALVVLPCAAYAGQPF
    FTSAFRALRARSVNMDVPICIGVTLALAMSVVETINHAEHAYFDAAIMLLTFLLAGRFLDQKMRQRTRAVAGNLAALKAE
    TATKFFGADEIREVPIAAIEPGDIVLLRPGQRCSVDGQVIEGRSELDQSLITGETLHAQAERGTQVYAGTLNISGTLRVR
    VAAAAEGTLLSEISRLLENALQARSHYVRLADRASRLYAPLVHAAALLTMLGWVAWGASWHDAIVTAIAVLIITCPCALG
    LAIPAVQTVAAGAMFRAGVLLNSGDSIERVAGIDTIVFDKTGTLTLPELDVVNAASVPDEVFSLAGQLALASHHPVAAAV
    ARAVGAKSPLAEVVEEPGQGVRGFVGGQELRLGSPAYCHAEALANEILSQDPEVSVVAFSRGSSEHYVFAVRQRLRPDAV
    SVIAALQKQGIAIEMLSGDREPAVRHAADTLGISIWQAGVKPADKIAHIEALKQQGRKVMMVGDGMNDAPSLAAASVSMS
    PISATHLSQATADLVFLGKELAPVLAAVDYSRKAMSLMRQNLALAIGYNVLAVPIAIAGLTTPLIAAIAMSGSSVLVMLN
    AIRARHAGRRDSLWK

    >gi|90421707|ref|YP_530077.1| dihydrolipoamide dehydrogenase [Rhodopseudomonas palustris BisB18]
    MASYDLVVIGTGPGGYVCAIRAAQLGLKVAVVEKRDTFGGTCLNIGCMPSKALLYASEMFEEAGHSFAKMGVVVPKPSLD
    LPAMMTFKQQGIDGNVKGVEFLLKKNKIDALRGSGRVLGTGKVEVTSADGKTQTVDAKSIVIASGSTYTPLKGVTVDEKR
    IVSSTGALSLDKVPGKLLVIGAGVIGLELGSVWRRLGAEVTVVEFLDRILPGMDGEVVKQFQRILEKQGFNFKLGSKVTA
    VDSSGATLKATIEPAAGGKPETLEADVVLVAIGRIPYTKGLGLAEAGITLDERGRIAIDAHFATSLKGVYAIGDVVAGPM
    LAHKAEDEGVAVAEIIAGKAGHVNYDVIPGVVYTTPEVSSVGKTEEELKQAGVAYTAGKFPFTANGRSKVNQTTDGFVKI
    LADAKTDRVLGVHIVGREAGELIHEAAVLMEFGGSAEDLARTCHAHPTRSEAVKEAALAVGKRAIHM

    >gi|90421727|ref|YP_530097.1| hypothetical protein RPC_0203 [Rhodopseudomonas palustris BisB18]
    MMAWSGLLNGPGALAACALLATICPAVAQPRAVVELFTSQGCSSCPAADKIIGDLASDPSVIALSMPIDYWDYLGWKDTL
    ADSRFSARQKAYSARRGDRDVYTPQMIVNGAMQVVGNDRARIDGAISDTEKTAGVMSVPVTVTLDGKQLKVAVAAGAADV
    APSQAEVWICSISKAVPIAITRGENRGREVTYHNVVRTWLKVGDWTGQADSWTVPIENVAGAGVDAAVVYVQSGSREQPG
    PMLGAALTALD

    >gi|90421733|ref|YP_530103.1| periplasmic protein thiol [Rhodopseudomonas palustris BisB18]
    MSDQPIQPAPSGRRSWLMALPLLGFTVLAGLFWLRLGADTTKIPSALIGRPAPQVALPALPGLARDGAAVPGLDPAAFKG
    KVSVVNVWASW
    CVPCHDEAPLLMDLAKDPRIQLVGINYKDAADNARRFLGRYGNPFSIVGVDPNGRGGIEWGVYGVPETF
    VVGRDGTIAYKLVGPVTPDNIDKVLKAQIDKALAAGS

    >gi|90421788|ref|YP_530158.1| thioredoxin-related [Rhodopseudomonas palustris BisB18]
    MTIIEQGNGAAPQATDLIKETSTQSFVKDVIEESKRQPVLIDFWAPWCTPCRQLTPLLEKAVRAANGKVKLVKMNIDEHP
    SIPGQMGIQSIPAVIAFVGGQPADGFMGAVPESQINAFIDKLTAGAGGGAPGVGELIEEAEAALAAGDAATAAAVYAEVL
    AVEADNLPALAGLARCYVETGAMEQAKQTLALVPDSKREDSAVKAVQAAIDLAEQAKALGPITELEQKVAANPLDHQARF
    ELAVALNAAGRRADATSQLLEIVKRDRKWDDDGARKQLVLLFEAWGPTDEATVDGRKRLSTILFS

    >gi|90421861|ref|YP_530231.1| AraC family transcriptional regulator [Rhodopseudomonas palustris BisB18]
    MAAGIVPAYITTMMNLAVTDHRLAKPGPQDSALRDYDSVRRAIGFISERWRAQPAIESIADAAGVTPDELHLLFRRWAGL
    TPKAFMQALTLDHAKSLLRDSASVLDAALDSGLSGPGRLHDLFVTHEAMSPGEWKSGGTGMTLRYGFHPSPFGTAVVIES
    ARGLAGLAFADPGEELTALADMQRRWPRASYVEDAAGTAALAQRIFDTRQWRADQPLRVVLIGTDFEVRVWETLLKIPMG
    RAVSYSDIAGCISLPKASRAVGAAVGKNPVSFVVP
    CHRALGKSGALTGYHWGLTRKRAMLGWEAGQVGME

    >gi|90421888|ref|YP_530258.1| UBA/THIF-type NAD/FAD binding fold [Rhodopseudomonas palustris BisB18]
    MLSGDELERYARHIVLREVGGPGQAKLQAASVLVIGAGGLGAPSLMYLAAAGVGTLGVVDDDTVSLSNLQRQIIHATPDI
    GRSKVDSAEDRITALNPHVRFVRHPMRIDADNAMQLIGSYDMVLDGSDNFATRYLVSDACYLARKPLITGALGVFDGSLT
    TIRAHEKNADGELNPTYRCLFPEAPPPGTVPS
    CQEAGVLGALAGVLGSMMALEAIREIVGFGEGLVGRLLMIDARAMRFE
    TLRYNRDPANPLNGDRPSILDLSAHA

    >gi|90421912|ref|YP_530282.1| thioredoxin [Rhodopseudomonas palustris BisB18]
    MAVGKVSDADFESEVLNATGPVVVDFWAEWCGPCRMIAPALDEISSALGEKVKIVKLNVDENPQTASKYSVMSIPTLLIF
    KGGEMASRQVGAAPKQKLHQWISAAV

    >gi|90421963|ref|YP_530333.1| glutathione S-transferase-like [Rhodopseudomonas palustris BisB18]
    MYTLFHHPFCPLSRFVRLALGEHGLDLRLVEERPWERRAAFLALNPAGTTPVLIADARPAIPGAGVICEFLDESHGPALG
    DRRMLPTVMDDRIEVRRLVAWFNEKFFEEASGPLVTERIYKRFMNEEDGGGPPAMDVIRAATANVRYHLAYIGWLARTRN
    FLAGDQLSYADLAAAAHLSAIDYLGDVPWTEDEAAKAWYARVKSRPSFRPLLSEWLAGVPASRTYVDLDF

    >gi|90422043|ref|YP_530413.1| glutaredoxin GrxC [Rhodopseudomonas palustris BisB18]
    MMSMVRKPESLFGIMLQQPECDMSAAIEIFTRPGCGYCSAARSLLTRKKAAFTEYDVSLDPSFREQMTKRVGAGATYPQI
    FIGELHVGGCDDLYDLDRAGKLDSLLAGETAAS

    >gi|90422139|ref|YP_530509.1| arsenate reductase [Rhodopseudomonas palustris BisB18]
    MDVIIYHNPDCGTSRNTLALIRHAGIEPHVVEYLKTPPSRAMLQQLIARIGLGTRALLREKGTPYAELGLDSPALSDDEL
    LDAMLAHPILINRPIVVSPRGVKLCRPSEEVLEILPPITAGEFHKEDGELVIDASGRRVATA

    >gi|90422144|ref|YP_530514.1| twin-arginine translocation pathway signal [Rhodopseudomonas palustris BisB18]
    MTDGPDARPLPPAAKLDGTRRRVLGALGTGTLLLGMGLLLPDAALAAKSDDDNNVLSETAVLRDPEIPVAGNADGDISIV
    EFFDFQ
    CPYCRKVAPDLRALAKEDGKIRLVFKDWPVLGGASIYAARLTLASKFQDKYIVAHEALIGLTSRLSEAGIRDAL
    SAAGVDVARATADLAGKGKVIDAILARNNAQAKAFGFQGTPSFIVGKFRVPGVLTKEQFTLAIADARKAAAQK

    >gi|90422714|ref|YP_531084.1| rhodanese-like protein [Rhodopseudomonas palustris BisB18]
    MKTVQMMVAEADAEVPRISPDDAKTLLGRPDVLFLDVREPGEVATSGKVPGALAVPRGLVEFRADPTSPLHEAAFDRAKT
    VVTY
    CASGGRSALVGKTLKDMGYSNVRNLGGFKGWLDSGGEVEKA

    >gi|90422856|ref|YP_531226.1| methylated-DNA--protein-cysteine methyltransferase [Rhodopseudomonas palustris BisB18]
    MTPSGFTLFDTAIGRCGVVWSAQGIVAVQLPQHTEEQTRARIDQRYPGLNEAAPPTQVGRAIDRIVALLAGRSVDLSDIA
    LDQAEVSEFQRRVYAIARAIPPGNTLSYGDIAKRLGDVALSREVGQALGRNPCPIIVP
    CHRVLAAGDKPGGFSANGGVAT
    KLKLLSIEGARVNYTPSLFD

    >gi|90422969|ref|YP_531339.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodopseudomonas palustris BisB18]
    MSEAIKTDVLIVGAGPCGLFAVFELGLLDVKVHLVDILDKIGGQCAELYPEKPIYDIPGIPMITGHGLTESLLEQIKPFN
    PTFHLNEMIETVEKIGDPGFRVTTDAGKVFECKVLVVAAGGGSFQPKRPPVPGIEAYEGGSVHYAVRKMEEFRDKDLMIV
    GGGDSALDWVLNLHPLAKRITLVHRRDDFRAAPHSVEQMRALVASGQMDLLIGQVTALDGEGKELSAATVKGNDGTTTKV
    ACNAMLPFFGLTMKLGPVANWGLHLENNLVPVDTGTFETNVPGIFAIGDINTYPGKLKLILSGFHEGALMAQKAVKYVYP
    DKRVVFQYTTSSSSLQKKLGVN

    >gi|90422991|ref|YP_531361.1| methionine sulfoxide reductase B [Rhodopseudomonas palustris BisB18]
    MMDRRLLLASVASLAALLGFRWLRPSEARAAEKFEIEKTPEQWKQQLTPMQYHILREEGTERPGSSPLLKEHRKGTFACA
    GCDLPLFASETKFESGTGWPSFYQPLPNAVGERKDSTLGMSRTEIHCRRCGGHLGHVFDDGPKPTGLRY
    CMDGFALVFHP
    ATAGAS

    >gi|90422994|ref|YP_531364.1| methionine sulfoxide reductase B [Rhodopseudomonas palustris BisB18]
    MPPEIRTRRLRVLRRVGEHPPAQVSDRRATRDGCQKRRSGCQYSPALAAWRGPSLQWLFLRWFPSGYSNRARGKPQSESQ
    IAKKSDSFYQPLPNAVGERKDSTLGMTRTEIHCRRCGGHLGHVFDDGPKPTGLRY
    CMDGFALVFHPATAGAS

    >gi|90423053|ref|YP_531423.1| DSBA oxidoreductase [Rhodopseudomonas palustris BisB18]
    MSAKPLQIDIVSDVVCPWCYIGKHRLEAALALVPEVAVETRWRPFFLNPGVPREGVDRDSYLTAKFGSVEAYKAIAGRVA
    EAAAAEGLAYRPELVRRQPNTIDCHRLIHWAELDPSGDKSAAMKQRLMELYFRDGGDLTDIEVLVKAAADCGLDGDAVRR
    RLASDEDVALIATQAKDAADKGISGVPTFVFAGKYAVSGAQPAEQLAGAIRQVAAELKADIAPA

    >gi|90423110|ref|YP_531480.1| glutaredoxin-like protein [Rhodopseudomonas palustris BisB18]
    MTRRRPVPQKDPIMSIEQFIESEVKSNDVVLFMKGTPQFPQCGFSGQVVQILDHVGVGYKGLNVLESADLRDGIKTYSNW
    PTIPQLYVKGEFVGGCDIVREMFQAGELQQLLADKGITVAASA

    >gi|90423182|ref|YP_531552.1| OsmC-like protein [Rhodopseudomonas palustris BisB18]
    MPIERFRFPGSDGVELSAALDLPDTAPRAYALLAHCFTCAKDGLAARRIALSLAAQGIAVLRFDFTGLGNSEGDFANATF
    SSNVADLVLAADHLRAEYQAPALLIGHSLGGAAVLAAAAKIPEAKAVVTIAAPSDPAHVTKLFAGELEAIRTSGAVEVSL
    AGRPFTITRQFLDDIAEHNLLASVATLRKALLILHAPADDTVGIDNATKIFVAAKHPKSFVSLEGADHLLTDRRDTSYVA
    DLIAAWAERYLDPVPQPAPSDEVMEPRRVVVRETRQGKFLQSIALGPHRITADEPKEAGGDDSGPGPYDLLLAALGA
    CTA
    MTIRLYADRKALPLDRVTVSLAHSRIHAEDCAACETKAGMLDRIERLIWFDGVLDAGQRDRLMQIADKCPVHRTLTSEIR
    IVTRAGERG

    >gi|90423426|ref|YP_531796.1| peroxidase [Rhodopseudomonas palustris BisB18]
    MSCTTTAIAVPAIPETPVPAAALAPAPVSAPMTSSLPRINAPAPHFAAKTTFGDRTLADYRGRWLVLFSHPADFTPVCTT
    EFIAFAKAADSFKAANCDLLGLSIDSVFSHLAWVGNIKEKFGVEIPFPIIEDLSMNVAKAYGMIHPGASDTSAVRATFII
    DPDGILRAMVYYPMTNGRSVAEILRLVQALQTSLSQGVATPEGWQPGEKIIVGPPMTVAEVATRMSEGLETVDWYFSKRA
    L

    >gi|90423440|ref|YP_531810.1| thiol-disulfide isomerase and thioredoxins [Rhodopseudomonas palustris BisB18]
    MKDIKILGPGCARCTTTAEMVQKEADRLGTEIQIEKVSDYAAIAGYGVVSTPGIVIDGKVVHAGGLPKADDIAKWLTA

    >gi|90423443|ref|YP_531813.1| rhodanese-like protein [Rhodopseudomonas palustris BisB18]
    MKLKTIDAKEADRLVAGGAALLDVRERHEIDREQIEGAVAVPLSRFAEADLEPFRGRKVIFFCHSGGRTRLYAAKLAARL
    QGIGEGYVLSGGIVAWRKAGLKTSLGPRPPGLLARLFGSK

    >gi|90423526|ref|YP_531896.1| UBA/THIF-type NAD/FAD binding fold [Rhodopseudomonas palustris BisB18]
    MLATSGGSDGGLSNEEVRRYARHITLPGVGREGQAKLKNAKVLIIGTGGLGSPISLYLAAAGVGVIGLVDFDVVEMSNLQ
    RQVVHGTNTIGMPKVNSAKARLNELNPAITVETYDTAFSVENALDLVGRYDVVVDGSDNFNCRYIVNDACTILKRPLVYG
    AIYRFEGQVSVFNHDGGPCYRCLFPQRPPAELSPS
    CNAGGVFGVLPGVIGAIQATEAVKLILGLGHSLSGRLVRYDALEM
    KFDEIRFSNRANCPDCGSRRSQMHPPDRSVDSMLAAPRAAELPQAMFISPTELAENLDRYVLLDVRDPNELEICAIPGSL
    NVPLADLVSRFDELPRDRAH
    CIICHSGARAKSAAARFLDAGVYDFRILEGGIKRWVRDVEPTMPIY

    >gi|90423581|ref|YP_531951.1| glutathione reductase [Rhodopseudomonas palustris BisB18]
    MSDFDVDLFVVGGGSGGVRAARIAAGHGARVMIAEEYRFGGTCVIRGCVPKKLLVYASHVQHELADAAGFGWTIPQASFD
    WPTLIANKDREIDRLESIYAANVEKSGAQTVKSRAVFEDPHTLRLATGETVRARYVLIATGGAPNHGTIIPGIEHVISSN
    EVFHLPELPKRILIQGGGYIALEFACIFAGLGCDVTVVYRGDNILRGFDEDVRAHVRAEMEKQGITILTGCTVTAVDKHG
    TEYTSHLSNGSSVGSDQVMFAIGRHPNVANLGLEKAGVAIDPVIGGIAVDGFSQTSVPHIYAIGDVTHRINLTPVAIREG
    HAFADTVFGNRPVQVDYNEIPTAVFSQPEVGTVGLTEAQARAAFTHVDIYKASFRPMKATLSGRDTRVLMKLVVDGNSNR
    VLGCHIVGDEAAELVQVIAIAVKMKATKADFDATMALHPTAAEELVTMRTPFARYVREAAE

    >gi|90423618|ref|YP_531988.1| hypothetical protein RPC_2115 [Rhodopseudomonas palustris BisB18]
    MPSPIAPRFPVPALDQLPDDIRQRILAVQEKSGFVPNVFLTLAYRPDEFRAFFAYHDALMEKDGGLTKAEREMIVVATSA
    ANQCHY
    CVIAHGAILRIRAKNPQIADQIAVNYRKADITARQRAMLDFAMKVSRAAETVSAQDIDELSRHGFSDDEIWDIT
    AIAAFFALSNRLANVTAMRPNDEFYLMGRLPK

    >gi|90423628|ref|YP_531998.1| rhodanese-like protein [Rhodopseudomonas palustris BisB18]
    MPQHITRGIKALLEEANAQIETLSAQQAIAAYQVGADNDVVIVDIRDPREIEREGRIPGAFACTRGMLEFWIDPDSPYAK
    PVFQGDKKFVFY
    CAGGMRSALAAKTAQDMGLHPVAHIEGGFAAWRDAGGAVEKVEPRKAKA

    >gi|90423630|ref|YP_532000.1| 3-mercaptopyruvate sulfurtransferase [Rhodopseudomonas palustris BisB18]
    MTSTHDPLVSPQWLADHIADPKLRLIDASYKMPAARPPSAREDYLARHLPGAAFYDVDAVADPGNSLPHMVPSPEQFARY
    VGALGVGADSQVVVYDSGSYLGAPRAWWSFKLYGFDNVRVLEGGLKAWVADGHATEIGEVVPRAQDFAPRFDAARLRRID
    QMVGNLTSKAEQVVDARSRERYQGAVVEPWPGRRPGRIPGSLNVPFTDLLNPDGTMKSPGALREVFAAAGVDLEQPIVTS
    CGSGVTAAVITLALTRLGVDRTALYDGSWAEWGLPDGPPVATGVS

    >gi|90423837|ref|YP_532207.1| hypothetical protein RPC_2335 [Rhodopseudomonas palustris BisB18]
    MAVHFPFDNSYAALPEGFFARVAPTPVATPRLIKLNRPLARELGLDPDRLDSPEGAEILAGKRIPEGADPIAMAYAGHQF
    GNFVPQLGDGRAILLGEVIDQNGVRRDIQLKGSGPTPYSRRGDGRAALGPVLREYIVSEAMAALDIPTTRSLAAVITGET
    VARETLLPGAVLTRIATSHIRVGTFQFFAARRNQDAVKALADHVIARHYPNAINTKQPYLTLLQEVIRRQAELVARWLLV
    GFIHGVMNTDNCSVAGETIDYGPCAFMDGYDPTKVFSSIDHTGRYAYGNQPRIALWNLTRLAECLVPLISDDQDAAIADA
    EAALGQFSEQFGQAYHAGLRAKLGLFTAQDGDRELIGDLLGAMIEQAADFTLTFRGLSDLAGNAETDSVRNLFAEPAAFD
    GWLGRWRQRTAAEPQDAATRRAAMQAVNPAFIPRNHRIQAVIEAAVERDDFAPFEELLAVLAHPYRDQPGFAGYAQPPQP
    HEQVLQTF
    CGT

    >gi|90423993|ref|YP_532363.1| dihydrolipoamide dehydrogenase [Rhodopseudomonas palustris BisB18]
    MSDTSFDVIIIGSGPGGYVAAIRAAQLGLKTAIVEKSYLGGICLNWGCIPTKALLRSAEIYHYMQHAKDFGLSADNISYD
    PKAVVQRSRGVSKRLADGVGFLMKKNKISIIWGAATIDAPGKITVKAAKSEPPKGALGEGAYQAKHIIIATGARPRVLPG
    LEPDKKLVWTYFEAMVPDAIPKSLLVVGSGAIGIEFASFFHTMGSKVTVVEVLPQVLPVEDAEIAGLARKRFEKQGIKIL
    TGTKVSKLEKKADSVIATIDDGKTTEAIEFDRVISAVGVVGNIENLGLEKLGVKTERGCVVIDGYGKTNIPGIYAIGDVA
    GPPMLAHKAEHEGVICVEAIKGLHPHPMDKLLIPGCTYCNPQIASVGLTEAKAKEGGREIRVGRFPFAGNGKAIALGEDQ
    GLVKVIFDKTTGQLLGAHMIGAEVTELIQGYVVAMNLETTEAELMHTVFPHPTLSEMMKEAVLDAYGQVLNA

    >gi|90424006|ref|YP_532376.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB18]
    MTASVTISERAARRIGEILSKEGTGAMLRISVEGGGCSGFQYKFDVERNQNNDDTVIARDSAVVLVDSASVPFLEGAELD
    FVDDLIGASFRVNNPNATASCGCGTSFSI

    >gi|90424332|ref|YP_532702.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB18]
    MSDMTTASATPAAKPRPRPQVMRLTDAAAARVRELTERADSEIIGLRVGIKNGGCAGQSYTVDYAHDVRPSDEVVEDKGV
    KILVEPKAVLFLLGTEMDYKVDKMSATFVFNNPNQISACGCGESVQLSPAKIDG

    >gi|90424345|ref|YP_532715.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodopseudomonas palustris BisB18]
    MEAAGAKPVVAAPVVEAPPRSSKGVLAEGHAAPAFELPRDGGGMVSSHSFAGRKLVVFFYPRASTPGCTKEAIDFTRLAD
    AFATAGIGVLGISADNLKAQDAFRDKYQLTTPLLSDETHQILEAYGVWGEKSMYGKIFQGILRTTVLIGKDGRVGKIWRN
    VKVDGHADEVLAAAIELE

    >gi|90424359|ref|YP_532729.1| DSBA oxidoreductase [Rhodopseudomonas palustris BisB18]
    MPPFRLFASALFGLALAAMPSLASAQAFTDDQRGQIETIVRSYLLAHPEVLEEVSAELSKRQAIAEAEKHKAAIAQNAQT
    IFNSPRGVTLGNKDGDVSFVEFFDYN
    CGYCKRAMIDMLELMKDDPKLKVVLKEFPVLGPGSVEAAQVAVAVRMQDPTGKK
    YLDFHQKLLNGRGQADKARSMAAAKDAGLDMARLEKDIASPEVRATIEENFKLAEAMGMNGTPSYVIGKQVVVGAVGLEA
    LKEKIGIARCGKATC

    >gi|90424451|ref|YP_532821.1| hypothetical protein RPC_2957 [Rhodopseudomonas palustris BisB18]
    MRLRGRPWHAKRQTRVPAHGSRPMSITLYGIKNCDTMKKARGWLDASGVAYQFHDYKTAGIDRAELTRWVKQVGWELLLN
    RAGTTFRKLPDADKDGLTEAKAIALMVSQPSMIKRPVLDLGSKLLVGFKPELYASALA

    >gi|90424813|ref|YP_533183.1| hypothetical protein RPC_3322 [Rhodopseudomonas palustris BisB18]
    MAVTRNEQPGFAADDDVPIPYMARTRDYYAAIGYTEPYRWAHHVGAPFQPLRKPLAQARLAIVTTAAPFDPAKGDQGPGA
    PYNGGAKFYQVYDGDSALPHDLRISHIAYDRIHTTAEDGNCWFPLPQLLRFAADGRIGEVAPRFFGAPTNRSHRVTIETD
    APAILARCRADRVDAVVLVPN
    CPVCHQTVSLVARHLEANGISTVVMGCAKDIVEHAAVPRFLFSDFPLGNSAGKPRDPTS
    QAFTLELALRLLDSAPGPQTTVQSPLRWRDDASWKRDYNNVAAMSPEELARRRRDFDAQKQRARAIRDGAA

    >gi|90425078|ref|YP_533448.1| OsmC-like protein [Rhodopseudomonas palustris BisB18]
    MSALYSTKVTAIGGRAGSVRSDDGLLSLSLALPKALGGKGDATNPEQLFAAGYAACFENAVIHVARAKSVKVADADIEVV
    AEVGLAPNGSGGFVLSVALNVTIAGLEQSVAEAIVAAAHAT
    CPYSNAVRGNIDVVIAVTTR

    >gi|90425149|ref|YP_533519.1| glutathione peroxidase [Rhodopseudomonas palustris BisB18]
    MTSVYDFSAKTLAGQQLPLQQFEGKVLLIVNTASACGFTPQYKGLEELQQAYGGRGFAVLGFPCNQFGHQEPGDAAAIGQ
    FCQKNYGVSFPMFDKVEVNGSDAHPLFRYLKAEKSGLLGAAIKWNFTKFLVDRTGRVVARHAPTTTPQSLTKEIEALL

    >gi|90425301|ref|YP_533671.1| heavy metal translocating P-type ATPase [Rhodopseudomonas palustris BisB18]
    MTKTNDGANEQTRSCCGGMAKADRPNAASRPDLVQLTDLTQHPRATAAKAIDPVCGMSVDTSAGKPQFDYQGTTYHFCCK
    GCRSKFATDPESYLAKQRDAKTAAMSSCCGGTDDHVGHGHAHHDHAQHAPAAALAIDPVCGMNVDTSAGKPQFDYHGTTY
    HFC
    CNGCRSKFAADPESYLDKSKAKPQPAAPEGTIYTCPMDPQIRQVGPGSCPICGMALEPELVTLDAAPNAELIDMTRR
    FWIGLLLSLPVVVLEMGGHLAGEHNWVDPTLSNWIQFALASPVVLWAGWPFFVRGVQSLITRNLNMFTLVAMGTGVAYLY
    SLVGTLLPQAFPSAFRSHGGAVPVYFEAAAVITVLVLLGQVLELRARDATSGAIRALLGLAPRTARRIDDAGADHEVEID
    ALVVGDKVRVRPGEKVPVDGVILEGRATLDESLVTGESLPATREIGDQVIAGTLSQSGGFVMRAEQVGRDTVLSRIVQMV
    AQAQRSRAPIQRVADQVAGWFVPAVIAVAITAFFAWSAFGPEPRLTYALVAAVSVLIIACPCALGLATPMSIMVGVGRGA
    QAGVLIRNAEALERMEKVDTLVVDKTGTLTEGKPSVVAIVAADGFDETTILRLAASVERASEHPLADAVLRAAKERQIEL
    SKVEEFDAPSGKGATGKVDGKTVLLGNAVLLSSAGVDSRALDDRAEQLRGDGATVINIAIDGRLAGLFAIADPVKASTPD
    ALKAMAAEGIKVIMLTGDNRTTAEAVARRLGIAEVEAEVLPAQKSAVVEKLRRAGRIVAMAGDGVNDAPALAAADVGIAM
    GTGTDVAMESAGITLVKGDLGGIVRARKLSQATMRNIRQNLFFAFVYNGAGIPIAAGILYPTFGLLLSPIIAAAAMSLSS
    VSVIGNALRLRATRL

    >gi|90425316|ref|YP_533686.1| methionine sulfoxide reductase B [Rhodopseudomonas palustris BisB18]
    MSETTTKSAKVVKPDAEWRKQLTPMQYAVLREKATERPFSGDYEHDNTKGTYVCAGCGQTLFESDAKFDSGCGWPSFTAP
    AAPDHVDEERDVSHGMVRTEVLCSQCSGHLGHVFEDGPGPNGLRY
    CINSAALKLQPK

    >gi|90425317|ref|YP_533687.1| methionine sulfoxide reductase A [Rhodopseudomonas palustris BisB18]
    MRSPFTRLMLGAAAGAVALWSFGFAQASEDAVVIPPPAVDVPSSDGVQTAVIAGGCFWGVQGVFQHTAGVLNAVSGYAGG
    AKLTANYTAVSSGMTGHAEAVEIKYDPKQISYGQILQIFFSVAHDPTQLNRQGPDSGTQYRSAIFTANDEQKKVAEAYIA
    QLGAAKLFKKPIVTTVGALDGFYAAEAYHQDYLTLHPNQPYIAFNDLPKVENLKKLFAQRYIEKPTLVRNAKVTN

    >gi|90425321|ref|YP_533691.1| thioredoxin reductase [Rhodopseudomonas palustris BisB18]
    MADPVHAKVVIIGSGPAGYTAAIYAARAMLEPILLQGMQPGGQLTITTDVENYPGFADVIQGPWLMEQMEKQATHVGTRI
    VTDLVTDLDLSQRPFRLSCDSGDVYLAETVILATGAQARWLGIPSEEKFKGFGVSA
    CATCDGFFYRGKQVVVVGGGNTAV
    EEALFLTNFATKVTLVHRRDHFRAERILQERLFKNPKIEVVWDVAVDEICGDESPTKVTHVRLKNVKTGALTECAADGVF
    IAIGHAPATELVKGKIRLKPSGYVEVAPNSTATSVPGLFAAGDVADETYRQAVTAAGLGCMAALEAERFLAASASERVAA
    E

    >gi|90425461|ref|YP_533831.1| OsmC-like protein [Rhodopseudomonas palustris BisB18]
    MDMSTTYGSAKWQGGIKDGKGAISTKSGALSDYPYGFASRFEGKPGSNPEELIGAAHAACFTMALSLILGEAKLTAEQME
    TKADVTLDKDGDGFSITAVHLTLSAKIPGADDATFQELAGKAKAG
    CPVSKLLNTKITLDAKLG

    >gi|90425550|ref|YP_533920.1| peroxiredoxin-like protein [Rhodopseudomonas palustris BisB18]
    MTIKVGDQLPEAKFRVMSEEGPQVKTTEDIFKGKKVAVFAVPGAYTGTCHKMHLPSIFLNAYAIKDKGVDTIAIVSVNDA
    FVMGAWKRDTDLRNEATFLADGNAEFTKAIGMELDASGNGLGIRSHRYSMLVEDGVVKTLNLEPNPGKVEVSGGDTLLEQ
    L

    >gi|90425773|ref|YP_534143.1| alkylhydroperoxidase AhpD core [Rhodopseudomonas palustris BisB18]
    MHKNWIDVTGELSVALKEVRGGAPEVMKGFAAIAQAALKANALDTKTKELIALAIAVATRCDGCIGFHAEAAVKHGASRD
    EVMETMGMAIYMGAGPSVMYAAQAVEAFDQFAQRKAAAAE

    >gi|90425787|ref|YP_534157.1| nitrogenase-associated protein [Rhodopseudomonas palustris BisB18]
    MAKVTFYEKPGCGGNAKQKALLLASGHDVEVRNLLTQPWDAASLRPFFGEKPVADWFNASSPRVKSGEIRPNEIRPDVAI
    AMMIEDPLLIRRPLMQVGEHRQSGFDQAAVDAWIGLRPTETEVTDRCLKEGDAAHAAACRAAAEP

    >gi|90425844|ref|YP_534214.1| twin-arginine translocation pathway signal [Rhodopseudomonas palustris BisB18]
    MRRAPPNWESFDVIITRRAFTAALSLTGLAALAGFSPLRLIGEAFAQDAPSAADVAKPGALPDMALGAPNAPVTIIEYAS
    MT
    CSHCANFNETVFPKLKAEYIDTSKVKYVFREFPLDIKAAAGSMLARCIAKDDAGKYFAVNDMLFKQQTDWVLKNTTET
    LKRIGKQAGLSGDAVEACLKDQALLDKIAADQKFANEVLKVNSTPTFFINGEMLRGEASFEEFGKKIKALLKS

    >gi|90425915|ref|YP_534285.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodopseudomonas palustris BisB18]
    MLGIGDHLPSFEVVGVKPGFHVQEENGQSAFETLTETSFPGKWKVIFFYPKDFTFVCPTEIAEFARLSKDFADRDAVVLG
    GSTDNEFCKLAWRRDHKDLHKLAIWQFGDSKGSLVDGLGVRSPDGVAYRYTFIVDPDNVIQHVYGNNLNVGRSPKDTLRV
    LDALQTDELCPCNREVGGETLKVA

    >gi|90425925|ref|YP_534295.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB18]
    MITLSEEAGNAVKAAMSRAGKSDGGLRVMVETGGCAGFKYLIGLDTEPRADDAVIDAGGVKVFLDPDSQPLLTGLKIGFV
    ESLEGSGFTFDNPNAGTKCGCGKSFG

    >gi|90425942|ref|YP_534312.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisB18]
    MSFTLTPSAEKFIRRMLRFSPGAGGFRLNVSAGGCAGLSAEFDVEPAVRPGEVVETIGDISFYLPVASQKLLDGVVVDFV
    ETPTSSGFVFHDPKRSACGCATDSTPQPTVTLHQLREI

    >gi|90426067|ref|YP_534437.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodopseudomonas palustris BisB18]
    MTAAAPDHVDCLIVGGGPAGLTAAIYLARYRRNIVVVDDGCSRAALIPESHNYPGFPDGVSGRGLLANLRRQAEHYRVPI
    IAERVSDLARDGDGFVARTPGRRIAARIVLLATGIVDDGPELPGLDDAVLEGSVRY
    CPVCDGYEVTDQRIAVLGHGNDAA
    AKAKFLRSYSKDVTLLTIDGKAASEQCRVELDAAGIAVAGPLIGLERDQGRIRARLADRALPSFDVVYPALGCEVRSDLA
    AALGAATNPVGCLKVDDHQRTTVPGIYAAGDVVSDLHQIAVGTGHAAIAATHIHKTLDHNFR

    >gi|90426347|ref|YP_534717.1| thioredoxin-like [Rhodopseudomonas palustris BisB18]
    MTDDSPKSPAPRRSASRRIPIILAAMLIGTAAGFAGVYGIGALKRNPPGDPACRPAVDLAQKIAPLAKGEVAALTMATAP
    LRIPQLAFSDAAGQPKTLADWRGKTILVNLWATW
    CVPCRKEMPALDNLQAKLGSDRFEVVAINIDTRDPAKPKAFLTEGG
    LTRLGYFADPNAKVFQDLKAVGRALGMPTSVLMDGAGCEIGTIAGPAEWDSDDALKLINAAMAP

    >gi|90426369|ref|YP_534739.1| methylated-DNA--protein-cysteine methyltransferase [Rhodopseudomonas palustris BisB18]
    MGGRAYTVFDTVVGRCAIAWSAAGIAGVQLAEAREIETRRQLLRRCPDARESRPNPDVEAAIDGLKALLRGEPADLSNAA
    LDMAEATPFHRRVYELVRTIPRGETLTFAEIATRLGASGAIHSVGQALSKNPFALLVP
    CHRALPARGETGGTPSCGGMVS
    RYRLLSIEGALTGRGPTLFDALLSAPPRSTG

    >gi|90426378|ref|YP_534748.1| cytochrome c biogenesis protein, transmembrane region [Rhodopseudomonas palustris BisB18]
    MAVRLFRMLILLVAIVAGGATVHAGPARTAPFQLNAQHGADGVELTWRIAAGDYLYRDKIAVTTAEGGRVALQTPAGEVK
    DDPNFGITEVYHHSLTATIPADAVKGASRLTVSYQGCAERGICYPPVTARVDLGTYQVSIAGGAAPSADPAWPSDVPALP
    ELAEPAATSASMPASVLPSMTQGWLPLLLAFAGFGLLLAFTPCVLPMVPIVAGMLTRSGPDLSPVRGFALAAIYTLAMAS
    AYAALGVAAAWSGQNLQSALQAPLALAVMASIYVALALSSFGLFELQLPARFGDNLAGRLHGRAGPLLGAAALGFTSALI
    VGPCVTPPLAAALLYVAQTGDTLRGAAALFALGLGMGFPLILVGLFGAGVLPRSGPWLVTIRKLFGFAFLGLAVALISRV
    LPGAVALLLWSGLAIGLAAFLGAFDRLDRSGGAVRRFGKAAGLAVFVYGATLIIGAVGGSEDPLRPLAVFGADQPAATAI
    FARTVTSIPALDQAIVDGRARGKPIMIDFSADW
    CTSCKTMERDVFGDPTVRRRLNDVTLIRADVTRSNAETAALMKRFDV
    VGPPTVVFLDQHDGHEITSARTVGEVPADSFVQTLQRIGASS

    >gi|90426379|ref|YP_534749.1| DSBA oxidoreductase [Rhodopseudomonas palustris BisB18]
    MNRRQSLLILGALAAVPLSKVFSAPAAWAEGIDVKAILNDPDAPETGNPKGSLTIVTYFDYNCPFCKKAEPDLEQVVRDD
    GKIRLVYKDWPILTEASVYGAQMALGAKYQGKYQAAHDALMAIPGRGISKDQMRDAVAAASVDMTRLQSDLGAHGDAITA
    LLRRTLSQADAMGLQGTPVYLIGPYKVAAALDAAAFKKVVDQARARPLAK

    >gi|90426412|ref|YP_534782.1| methionine sulfoxide reductase A [Rhodopseudomonas palustris BisB18]
    MFFMRKTTALPSAAEALPGRATALPTASTHFVNGHRLQPPYPAGLQQAVFGLGCFWGAERKFWALGDGVYVTAVGYAGGH
    TPNPTYEEVCSGRTGHTEAVLVVFDPARLSFEALLKVFWESHNPTQGMRQGNDVGTQYRSAIYTFGDAQDKAAESSKAAY
    GRALAAKGLGAITTEIAPADIFYFAEDYHQQYLAKNPAGYCGLGGTGVSCPIGAGVNA

    >gi|90425916|ref|YP_534286.1| alkylhydroperoxidase [Rhodopseudomonas palustris BisB18]
    MSIDALKERIPDFAKDVRLNLSSMASDETLAPQTKYGLFVAAAVATRNPDVIAAMQAVARDNVAPAVIAAAKSAAAIMAM
    NNVYYRFVHLASNKDYATMPARLRMNVIANPGVDKADFELWSLAVSAINGCGM
    CIDSHEKVLLAAGVSTAAIQTAVRFAA
    IIQSVAVSIEAGAADLAMAAE