Rhodopseudomonas palustris BisA53 uid58445

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|115522042|ref|YP_778953.1| copper-translocating P-type ATPase [Rhodopseudomonas palustris BisA53]
    MLMTRDFSHYVKDVDADIAHLDLAVEGVSCAGCMAKIERGLSAIPEVTRARVNLTDRRLAIEWKKGTINPALFIDRLAEL
    GYKAYPFEPVRAELEEAARAKWLLTCLGVAAFASMNVMMLSVPIWIGSDMDPETRSFFHWLSALVVLPCAAYAGQPFFKS
    AFNALRARSVNMDVPISIGVILALGMSLVETFNHAEHAYFDAAIMLLTFLLAGRFLDQKMRQRTRAVAGNLAALKAETAT
    KFVGPDEIREVPIAAVRTGDIVLLRAGERCAVDGVVVDGRSEIDQSLITGETRQVEALRGTQVYAGTLNMSGSLRIRVSA
    AAEGTLLAEIARLLENALQARSRYVQLADRASRLYAPLVHAAALLTMLGWVALGASWHDAIVTAIAVLIITCPCALGLAI
    PAVQTVASGAMFRAGVLLNSGDAIERVSDVDTVVFDKTGTLTLPELDVVNAGNVPSDVFALAGRLALASHHPVAAAVARA
    AEARSPLPDVSEQPGQGVRAMVGGQEVRLGSPAFCHAEAQANEILSGDPEVSVVAFSRGEEHHVFAVRQRLRPDAKDIIA
    ALHGRGIVVELLSGDREPAVRHAADTLGVDIWRAAVTPAEKIAHIQNLKKQGRKVMMVGDGMNDAPSLAAAHVSMSPISA
    THLSQATADLVFLGQELAPVLAAIDYSRKAMRLMRQNLGLAIGYNVLAVPIAIVGLATPLIAAAAMSGSSLLVMLNALRA
    RRVG

    >gi|115522183|ref|YP_779094.1| glutaredoxin GrxC [Rhodopseudomonas palustris BisA53]
    MTAAIEIFTRPGCGYCSAARSLLTRKNAAFIEYDVSVDPNFRLKMIDRVGAGATYPQIFIGKLHVGGCDELYALDREGRL
    DSLLAGETAAS

    >gi|115522271|ref|YP_779182.1| UBA/THIF-type NAD/FAD binding protein [Rhodopseudomonas palustris BisA53]
    MLSAIELERYARHIVLRDVGGPGQMKLQAASVLVIGAGGLGAPVLMYLAAAGIGRLGVVDDDIVSLSNLQRQIIHATPDI
    DRLKVDSAAERIHALNPHVAFVPHAERLEADNALHLIGGYDLVIDGSDNFATRYLVSDACYLAAKPLITGALGAFDGSLT
    TIRAHERNADGDFNPSYRCLFPEAPPPGTVPS
    CQEAGVLGALAGIIGSMMALEAIREIVGFGEGLVGRLLMIDARAMRFE
    TLRYKRDPHNPLNGDAPTISDLSGYR

    >gi|115522287|ref|YP_779198.1| OsmC family protein [Rhodopseudomonas palustris BisA53]
    MDAAQLRATQAPIKQRYQVDPQAALITLKAKGSIDTDGIACKLETGRALAMAGLHPATGGSGLELCSGDMLLEALVACAG
    VTLKSVSTAIEVPLKIGNVIAEGDLDFRGTLGVDKEAPVGFAEIRLRFEVDTDAPQDKLDLLLKLTERYCVVYQTIKNGP
    KLTVEMRRL

    >gi|115522318|ref|YP_779229.1| dihydrolipoamide dehydrogenase [Rhodopseudomonas palustris BisA53]
    MASYDLVVIGTGPGGYVCAIRAAQLGLKVAVVERRDTLGGTCLNIGCMPSKALLHASELFEEAGHSFAKMGIGVSKPTLD
    LPAMMEFKQQGIDGNVKGVEFLMKKNKIDVLRGTGKVLGSGKVQVTAADGKAESVEAKSIVIATGSTVAPLKGVTIDEKR
    IVSSTGALSLPKVPGKLLVIGAGVIGLELGSVWRRLGAEVTVVEFLDRILPGMDGEVVKQFQRLLEKQGFVFNLGSKVTG
    VDASGAKLKATVEPAAGGAAETIEADVVLVAIGRIPYTKHLGLEEAGIKMDSRGRIEIDDHFATAVQGVYAIGDAVRGPM
    LAHKAEDEGVAVAEIIAGKAGHVNYDVIPGVVYTTPEVACVGKTEEELKQAGVNYATGKFPFTANGRSKVNQTTDGFVKI
    LADAKTDRVLGVHIVGREAGELIHEAAVLMEFGGSAEDLARTCHAHPTRSEAVKEAALSVGKRAIHM

    >gi|115522337|ref|YP_779248.1| hypothetical protein RPE_0309 [Rhodopseudomonas palustris BisA53]
    MCVMRRQTSVDCYDPAWLAMTKRNGLGHWSGASLMGATLVLILPVVVAPATATAAGPRAVVELFTSQGCSSCPAADKIVG
    ELASDPSVIALSLPIDYWDYLGWKDTLADSRFTARQRAYSAKRGDREVYTPQVVVNGQAQVVGNDRAQIDHAISDTATTP
    GVMSVPVSVIREGKELKVSVPAAKDGASGEVWICSIARAVPIVIGKGENRGREITYHNVVRSWLKVGDWTGKAGRWTVPL
    ENLTSNGVDAAVVYVQDGNRDQPGPMLGAALTTLQ

    >gi|115522343|ref|YP_779254.1| periplasmic protein thiol [Rhodopseudomonas palustris BisA53]
    MSQSTTSPGAGKARRALLMLLPLFGFAVVAALFWVRLGGDPTKIPSALIGRPAPATTLPALQGLSRDGAPVPGLNPAAFK
    GKVSVVNVFASW
    CVPCHDEAALFMTLGQDKRLQMVGINYKDAPDNARRFLGRYGNPFDIVGVDGNGRASIEWGVYGVPET
    FVIGRDGNIAYKLVGPVTPDNIDTVLKPELEKALKAGS

    >gi|115522438|ref|YP_779349.1| thioredoxin domain-containing protein [Rhodopseudomonas palustris BisA53]
    MTIVEQGNGAAPQATDLIKETTTQTFVKDVIEESTRQPVLIDFWAPWCAPCRQLTPLLEKAVRAAGGRVKLVKMNIDEHQ
    SIPAQMGIKSIPAVIAFVDGRPADGFMGAIPESEVKAFIDKLAAGLPGDGGPTAAELLAEADAVLAEGDPATAASIFAEV
    LGTDGTSVPALAGMARCYVATGALERAKQTLAMIPEAQREDQAVKAVQAAIDLAEQASALGPIAELEQKVAADPLDHQAR
    FDLALAKNAAGQRDEATTHLLEIVKRDRKWNEDGARKQLVLLFDAWGPTDEATVEGRKRLSTILFS

    >gi|115522487|ref|YP_779398.1| thioredoxin [Rhodopseudomonas palustris BisA53]
    MAVGKVSDADFDSEVLNATGPVVVDFWAEWCGPCRMIAPALDEIAGAMGDKVKIVKLNVDESPKTASKYGVMSIPTLMIF
    KGGEMASRQVGAAPKAKLQQWISAAV

    >gi|115522514|ref|YP_779425.1| methylated-DNA--protein-cysteine methyltransferase [Rhodopseudomonas palustris BisA53]
    MMNLAITGPHLAKPGPQQAALRDYDSVRRAIAFMSHHWREQPAIEAVADAASLTPDELHLLFRRWAGLTPKAFMQALTLD
    HAKGLLRDSASVLDAALDSGLSGPGRLHDLFVTHEAMSPGEWKSGGEGLALRYGFHPSPFGTAVVIASERGLAGLAFADL
    GEEDAALADMQRRWPRARYLRDDAATAPLAQRVFDTRQWRAGEPLRVVLIGTDFEVRVWETLLKIPMGRAVCYSDIAGHI
    GAAKAARAVGAAVGKNPISFVVP
    CHRALGKSGALTGYHWGLTRKQAMLGWEAGQVGA

    >gi|115522531|ref|YP_779442.1| glutathione S-transferase [Rhodopseudomonas palustris BisA53]
    MYTLFHHPFCPLSRFARLAVGEHGLDLRLVEERPWERRAAFMTLNPAGTTPVLIAEATPAIPGAAVIAEFLDETHGPAMG
    ERRLLPVTMDDRIEVRRLTAWFNEKFFEEASGPLVTERIYKRFMAEEDGGGPPAMDVIRAATSNVRYHLAYIGWLARTRN
    YLAGDQLSFADLAAAAHLSAIDYLGDVPWSEDEAAKAWYARVKSRPSFRPLLSEWLAGVPASRTYVDLDF

    >gi|115522702|ref|YP_779613.1| glutathione S-transferase [Rhodopseudomonas palustris BisA53]
    MKLYYSPGACSLSPHIALCESGLPFELVKVDIRAKKLEDGSDYLAVNPKGSVPALALDDGGVLTEGPAIVQLIADKEGSG
    KLAPANGTAERYRLQEWLNFVSTDLHKSFGPLFSPALGDDAKQFFRDRINKYLGYADKQLEGKDYLMGASFSVADGYLFV
    ILTWCDRMKIDLAPYPNLAAFKARVAARPKVQQAMASEGLLQKA

    >gi|115522815|ref|YP_779726.1| hypothetical protein RPE_0790 [Rhodopseudomonas palustris BisA53]
    MSDRTEHRLAFNEPTTRRHALGLIGAGGLLIGGLRHALAATDDDNVLTEAAVLRDPEIPVAGNPDGDITIVEFSDFQCPY
    CRKVAPDLRALLQEDGKIRMVFKDWPVLGGASVYAARLALACKFQDKYVAAHEALIGLTSRLTDDKSRSALAEAGIDVER
    ARRDLAAHAKTIDAILARNDAQAKAFGFRGTPSYIVGKFRVPGVLTKEQFAMAVADARKAKAAQ

    >gi|115523227|ref|YP_780138.1| rhodanese domain-containing protein [Rhodopseudomonas palustris BisA53]
    MTVKTISPLEAQRLVAAGAVLIDIRQPHEIEREQIDGAIAMPLTAFRDADLTPARDRKAIFFCHSGGRTMMYSGQIAAKS
    AGICDPYVMSGGILAWRRSGLPTVVGPRPPGLLARLFG

    >gi|115523276|ref|YP_780187.1| rhodanese domain-containing protein [Rhodopseudomonas palustris BisA53]
    MKTVQAMVAEADALVPRISAQDAKTMVGRPDVLFLDVREPGEVIASGKVPGALNVPRGLVEFRADPSSPLHDAAFDRARS
    IVAY
    CASGGRSALVGKVLMEMGYKNVQNLGGFKAWLDADGEVEKQNCP

    >gi|115523497|ref|YP_780408.1| thioredoxin-disulfide reductase [Rhodopseudomonas palustris BisA53]
    MSEAIKTDVLIVGAGPCGLFAVFELGLLDVKVHLVDILDKVGGQCAELYPEKPIYDIPGIPMITGHGLTESLMEQIKPFD
    PQFHLGEMIETVEQIGDPGFRVTTDAGTVFECKVLVVAAGGGSFQPKRPPVPGVEHYEGKSVHYAVRKMDEFRGKDILIV
    GGGDSALDWTLNLNPICKSMTLVHRRDDFRGAPHSVEQMRQLVASGKLDLKIGQITALQGENGQLEGATIKLNDNSTAQI
    KCDAMLPFFGLTMKLGPVANWGLHLENNLIPVDTGTFETNVPGIFAIGDINTYPGKLKLILSGFHEGALMAQKAVKYVYP
    DKRVVFQYTTSSTSLQKKLGVN

    >gi|115523519|ref|YP_780430.1| methionine sulfoxide reductase B [Rhodopseudomonas palustris BisA53]
    MDRRALLATTATLAALFGFRWLRGDEARAAETFEIQKTPEEWKKQLTPMQFHILREEGTERPGASPLLKEHRKGQFTCAG
    CDLPLFASETKFESGTGWPSFYQPLPDAVGERKDSTLGMVRTEVHCRRCGGHLGHVFDDGPKPTGLRY
    CMNGFALNFKPA
    TTGAS

    >gi|115523599|ref|YP_780510.1| DSBA oxidoreductase [Rhodopseudomonas palustris BisA53]
    MDVKPLQIEVVSDVVCPWCYIGKKRLERALALAAEVPVELRWRPYFLNPWVPREGIDRDSYLTTKFGSVEAYRKIAGRVV
    EEAVAEGLSYHPELVRRQPNTLDCHRLIHWAAQHSGGDKSAVMKQRLMELYFRDGGDLTDIEVLVQAAADCGLDPDATRR
    RLGSDADVELISAQAKDAADKGVSGVPTFVFAKKYAVAGAQPAEQLARAIRQVFEEVNAEADVG

    >gi|115523638|ref|YP_780549.1| glutaredoxin-like protein [Rhodopseudomonas palustris BisA53]
    MSIEQFIESEVKSNDVVLFMKGTPQFPQCGFSGQVVQILDHVGVAYKGHNVLESADLRDGIKAYSNWPTIPQLYVKGEFV
    GGCDIVREMFQAGELQQLFTDKGITVTASA

    >gi|115523705|ref|YP_780616.1| OsmC-like protein [Rhodopseudomonas palustris BisA53]
    MPLERFRFPGSDGVELSAALDLPDTAPKAFALLAHCFTCSKDNLAARRIARALTDHGIAVLRFDFTGLGLSDGEFANSTF
    SSNVDDLVRAADHLRQSHRAPALLIGHSLGGAAVLAAAARIPEAKAVVTIAAPSDPAHVTKMFAAHLDDIRTQGSVEVAL
    AGRPFTIKREFLDDVAEYNLLRAVATLHKALLILHSPADDTVGIDNATQIFVAAKHPKSFVSLAGADHLLTDRRDAAYVA
    GLIASWAERYLDSPPRPAVPDDVAAPRRVVVRETRNGKFQQSIALGPHRLVADEPLAAGGDDSGPGPYDLLLAALGA
    CTA
    MTLRLYADRKALPLDLVTVTLAHSKVHAQDCAECETKAGLIDQLERVITLDGALDTEQRGKLMEIADKCPVHRTLTSEIR
    IVTREADA

    >gi|115523724|ref|YP_780635.1| redoxin domain-containing protein [Rhodopseudomonas palustris BisA53]
    MTIKVGDRLPQAQFRVMTEDGPQVKSTDDVFKGKKVAVFAVPGAYTGTCHKMHLPSIFLNAYALKDKGVDTIAIVSVNDA
    FVMGAWKRDTDQRDEAIFLADGNADFTKAIGMELDASGNGLGIRSHRYSALVEDGVVTKLNLEPNPGKVEVSGGDTLLGQ
    L

    >gi|115524002|ref|YP_780913.1| glutathione reductase [Rhodopseudomonas palustris BisA53]
    MSDFDVDLFVIGGGSGGVRAARIAAGHGARVMVAEEYRFGGTCVIRGCVPKKLLVYASHVHHELQDAAGFGWTIPQATFD
    WPTLIANKDREIARLEAIYAANVEKAGARTVKSRAVFEDPHTLRLSTGETVRAKYVLIATGGAPNHGAAIPGIEHVISSN
    EVFHLLTQPKRILIQGGGYIALEFACIFAGLGSDVTLVYRGDNILRGFDDDVRAHVRAEMEKAGITILTGCTVAQVDKHG
    EDYTSHLSNGSSVASDQVMFAIGRHPSVANLGLEKAGVAIDPLVGGIAVDAFSQTSVPHIYAIGDVTHRINLTPVAIREG
    HAFADTVFGNRPARVDYADIPTAVFSQPEVGTVGLTEAQARAAYTHVDIYKADFRPIKATLSGSQSRVLMKLIVDGSTDR
    VVGCHIVGPEAAELVQVIAIAVKMKATKADFDATMALHPTAAEELVTMRTPSARHVREAAE

    >gi|115524026|ref|YP_780937.1| rhodanese domain-containing protein [Rhodopseudomonas palustris BisA53]
    MIATAGEIRVAAQVQDLTPQEVSQGIAEGRYLLVDVREPNEIAAEAYPDAVVVPLSRFDARQIPDPNGKQVVFACRSGKR
    SVTASLAAQSVGLPYDKHLAGGILGWKAAGQPTKSGR

    >gi|115524039|ref|YP_780950.1| uncharacterized peroxidase-related enzyme [Rhodopseudomonas palustris BisA53]
    MTSPAVSRFPVPSLDQMPEDIRARILAVQEKSGFVPNVFLALAHRPDEFRAFFAYHDALMDKDGGLSKAEREMIVVATSA
    ANQCHY
    CVIAHGAILRIRAKNPLIADQIAVNYRKAEITPRQTAMLDFAMKVSRAAETVSAADFDVLHGHGFGDDEIWDIT
    AIAAFFALSNRMANVTSMRPNDEFYLMGRVPK

    >gi|115524047|ref|YP_780958.1| rhodanese domain-containing protein [Rhodopseudomonas palustris BisA53]
    MTNEYLFAIKKRPNNMPQTISRGIKALLDEANAQIETLSAAQAIALVGNDEVVIVDIRDPREIERDGRVPGSFACTRGML
    EFWIDPESPYAKPIFQQDKKFVLY
    CAGGLRSALAAKTAQDMGLTPVAHIEGGFAAWREAGGPVEAYVSKKPKG

    >gi|115524048|ref|YP_780959.1| 3-mercaptopyruvate sulfurtransferase [Rhodopseudomonas palustris BisA53]
    MTNSDDPLISTEWLAARLSDPKLKIIDASFKMPGVLPLPVDDYLAAHIPGAAFFDVDAVADQEVPLPHMYPDAAQFARDV
    EALGISSGDTVVAYDNGGWMAAPRAWWMFLSFGHADVRVLDGGLKQWIAEGRPTQSGEPSPQPGRFTATLDPGFVRSQQQ
    LVANLDSGAEQVVDARASNRFEGSVPEPRPGLRVGHIPGSRNLPYSELIDPATGTMKSLDALRLSFENAGVDLARPIVTS
    CGSGVSAAVLTLALVRLGVRGSALYDGSWSEWGLFNGPPVATGPA

    >gi|115524405|ref|YP_781316.1| glutathione peroxidase [Rhodopseudomonas palustris BisA53]
    MIDRRNFVAATLGAIASPAAIGLALAQPAASQMTAYGFSFPALSGDAIRLADFAGRPILVVNTASQCGYTPQYAGLQALW
    AEFKDRGLMIIAVPSNDFGGQEPGGVSEITETAQHQYGVGFPIAAKSVVKGPAAHPFYKWAAAARPNDTPRWNFHKYLVG
    RDGYLADSFATTIEPTDTRIKTALARQLSSA

    >gi|115524625|ref|YP_781536.1| dihydrolipoamide dehydrogenase [Rhodopseudomonas palustris BisA53]
    MPDTSFDVIIIGSGPGGYVAAIRAAQLGLKTAIVEKSYLGGICLNWGCIPTKALLRSAEIYHYLQHAKDFGLSADNIKYD
    PKAIVARSRGVSKRLNDGVGFLMKKNKVQIIWGAATIEAPGKISVKPAKAEAPKGALGEGAYQAKHIIIATGARPRVLPG
    LEPDPKLVWTYFEAMIPEKMPKSLLVVGSGAIGIEFASFYRTMGAEVTVVEVLPQILPVEDAEIAGLARKRFEKQGIKIL
    TDTKVTKLDKKADSVVATIDDGKGKPEAMEFERVISAVGVVGNVENLGLEKLGVKLDRGTIVTDGLGRTNVPGVYAIGDV
    AGPPMLAHKAEHEGVICVEAIKGLHPHPLDKSLIPGCTYCQPQIASVGLTEAKAKEQGRDIRVGRFPFAGNGKAIALGED
    QGLVKVIFDSKTGQLLGAHMIGAEVTELIQGYVVAMNLETTEQELMHTIFPHPTLSEMMKEAVLDAYGQVLNA

    >gi|115524635|ref|YP_781546.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisA53]
    MTDNVTLSERAARRIGEILKGEGNGAMLRISVEGGGCSGFQYKFDVDRHQNNDDLVIARDAAVVLVDSASVPFLSGAEVD
    FVDDLIGASFRVNNPNATASCGCGTSFSI

    >gi|115524968|ref|YP_781879.1| iron-sulfur cluster assembly accessory protein [Rhodopseudomonas palustris BisA53]
    MTDMMPATPTAPTKRPRPQVMRLTDAAAERVRDLVGRADSTILGLRVGIKNGGCAGQSYTVDYAHDIQPTDEVVEDKGVK
    ILVDPKAVLFLLGTEMDYKVDKMSATFVFNNPNQTSACGCGESVQLTPATFES

    >gi|115524980|ref|YP_781891.1| redoxin domain-containing protein [Rhodopseudomonas palustris BisA53]
    MSKQIRKKSSKPAASQAAGSGAATVAEKSSKTRFGAKSPPATNAARGRKPTPLLDESSHKPAAKPLSAATGKSPTSAPAV
    KPGGLSEGSKAPAFTLPRDGGDSVTLKSFAGRQLVIFFYPRAGTPG
    CTREAIDFTRLLPEFEQAGVSVLGVSADAPAQQE
    KFRDKYQLKIPLASDEPHAMLEAYGAWGEKSLYGKTFWGIVRTTVLIGADGRVKRVWRKVKVEGHADAVLAAAKER

    >gi|115524989|ref|YP_781900.1| DSBA oxidoreductase [Rhodopseudomonas palustris BisA53]
    MPSPRFVASALFALALAGAPALATAQAFTDEQRGQIETIVRSYLLSHPEVLEEVSTELNRRQALAEAEKHKAAIVENAEK
    IFNSPRGVIVGNKDGDVPFVEFFDYN
    CGYCKRAMLDMMELMKSDPKLKIVLKEFPVLGPSSVEAAQVAVAVRMQDPTGKK
    YLDFHQKMLNGRGQADKARSMAAAKDAGLDMARLEKDMSGPEVRATIEENFKLAEAMGMNGTPSYVIGKQVVVGAVGLEA
    LREKINTARCGKTAC

    >gi|115525064|ref|YP_781975.1| hypothetical protein RPE_3058 [Rhodopseudomonas palustris BisA53]
    MAATLYGIKNCDTMKKARVWLDAHGIDYAFHDYKAAGIDSATLNRWSKQVGWETLLNRAGTTFRKLPEADKAELSEAKAV
    ALMASQPSMIKRPVLELSGKILVGFRPELYADALR

    >gi|115525085|ref|YP_781996.1| thioredoxin-related protein [Rhodopseudomonas palustris BisA53]
    MGARHVNRRQALAALGVAALGLRAAPVHAKPALGDDGLYHFDWYLQSFLDLPEDLSGATDKNKRFAIMWGLKGCPACKRM
    HEVHLSDPAIEGYIRDNFEILHLNHIGARSVTDFDGRKLSEKALGESYGVRFTPTIQFFPEQARGLAALSGQAREVARMP
    GLLDPPEFLAMFRYVREEGYKTAPFLEWLKKQA

    >gi|115525089|ref|YP_782000.1| protein of unknown function DUF395, YeeE/YedE [Rhodopseudomonas palustris BisA53]
    MQSLSAWLLALVGFAVGAAAGFFVRHARLCSFSAIEDAWMGGDTRRLRIFGLALGLAMLGTQSLVLAGLLDPALTTYTPT
    AVPLVAILIGSTIFGIGMAMVGT
    CGFGSLVRLGTGDLRSLVVVLVLGATAFAMLRGVFSGFRITALEGLAVAMPEGTRAD
    LPSLMQQWFGLDLRGVIAVIGGVGLSLLALADRRLWRTPRLLMAGVALGALTVAGWAATSLIGDEFAGPFRPQSLTFVST
    IGKAVYAGLLNVANFADFGVGSVFGVVAGAWLAAQRADELRWEAFDDDHEMRRHLGGAVLMGIGGILAGG
    CTIGQGITAG
    SMLALSWPLAVGGMMLGARLGIAVLVDGSPADIIRRGWSRFRDRRPAE

    >gi|115525279|ref|YP_782190.1| hypothetical protein RPE_3277 [Rhodopseudomonas palustris BisA53]
    MRKMRASFATNPEHDAITGASRRLPPPRRLPIWRPMSAHFPFDNSYTRLPDSFFARVAPTAVSAPRLIKLNRPLALELGL
    DPDRLDSPEGAEIFAGRRLPEGADPIAMAYAGHQFGQFVPQLGDGRAILLGELIDQNGVRRDIQLKGSGPTPYSRRGDGR
    AALGPVLREYIVSEAMAALGIPTTRSLAAVITGDSVVRETMLPGAVLTRVASSHIRVGTFQFFASRGDRDGVKALADHVI
    ARHYPSIANEERPYLALLDQVIQRQAELIARWLLVGFIHGVMNTDNCSISGETIDYGPCAFMDAYDPATVFSSIDQMGRY
    AYGNQPQIGLWNLTRLAECLVPLIAEQQDQAIADAEASLGKFSALFNGAYEAGLRRKLGLFTTRDDDKPLIRDLFTAMAA
    DAADFTLTFRAMSEAAGDATADATGHHFADPLAYETWALRWRARLALEPQDRATRQSAMRAVNPAFIPRNHRIQAVIDAA
    VSDDFAPFEELLTVLATPYEDQPRFAPYADPPKPHERVLQTF
    CGT

    >gi|115525642|ref|YP_782553.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodopseudomonas palustris BisA53]
    MSDALDCLVIGGGPAGLTAAIYLARYHRNVVVFDAGHSRAKLIPESHNYPGFPGGISGQGLLKALAAQAGDYGVKIVAST
    VTSLTPTQPGFRVSADDRVVQARYVLLAAGIVDKHPQMNGLDRAIADGLVRY
    CPVCDAYEATDKRIAVFGAGADAASKAK
    FLRGYSASVTWLRPRDDRPVATMEADAGIAIVDGVSELKRSGSEIHAIANGKIHRFDIVYPALGCDVRATIATELGAATA
    ESGCLKVDEHQRTSIEGLYAAGDVVSDLHQISVATGHAAIAATHIHKSLPALSRASRGGVNAHAPDRNPAHAKALGEHGR
    R

    >gi|115525657|ref|YP_782568.1| arsenate reductase [Rhodopseudomonas palustris BisA53]
    MDVVIYHNPGCGTSRNTLGLIRNAGIEPHVIEYLKSPPSRALLQQLIARAGLTPRQLLRQKGTPYQALMLDDPALTDDDL
    LGHMMADPILIERPLVISPKGVRLCRPSETVLDLLPPQQGEFRKEDGELVIDAAGRPVATV

    >gi|115525660|ref|YP_782571.1| thiol-disulfide isomerase and thioredoxins [Rhodopseudomonas palustris BisA53]
    MKDVKVLGPGCKRCVTTAEMVQAEADKLGVAIAIEKVTDYAAIAGYGIVSTPGIVVDGKVVHAGGLPKSEEIALWLA

    >gi|115525701|ref|YP_782612.1| glutathione peroxidase [Rhodopseudomonas palustris BisA53]
    MSTVYDFSAKTLAGTELALKQFQGQVLLIVNTASACGFTPQYRGLEMLQQTYGARGFAVLGFPCDQFGHQEPGDAAQIEQ
    FCSRNYGVSFPMFDKIEVNGEGAHPLYRHLKGEKSGLLGAAVKWNFTKFLVDRAGQVVKRYAPTSSPESLKKDIEALL

    >gi|115525936|ref|YP_782847.1| heavy metal translocating P-type ATPase [Rhodopseudomonas palustris BisA53]
    MTSSDPTATAGCCGDSKAESDGGGKSAAARPELVQLTDLSDIHRKAAPSSCCGGKPDHDGPAAATPSPAKAIDPVCGMSV
    DTTAGKPQFDYHGTTYHFCCNGCRTKFEADPESYLAKQRAAEDAPSSCCGGATAKAEPEQKAAAASCCGGHDHAGHDHAH
    PAATAGAVIDPVCGMSVDPATSKHRFDYQGQTYHFCAASCRSKFAADPVSYLDPSKKKPAPVVPEGTIYTCPMDPQIRQI
    GPGS
    CPICGMALEPETVSLDDAPNHELIDMTRRFWIGLVLALPVVVLEMGAHLVGAHDWVDPTLSNWIQFAFATPVVLWA
    GWPFFVRGVQSVRTLNLNMFTLVAMGTGVAFVYSLVATLAPQVFPPTFRGHGGAVPVYFEAAAVITVLVLLGQVLELRAR
    DATSGAIKALLGLAPRTARRVDGDGVDHEVEIDALTPGDRVRVRPGEKVPVDGVILEGRATLDESLVTGESLPVSRESGD
    KVIAGTLSQSGGFVMRADQVGRDTMLSRIVQMVAQAQRSRAPIQRVADQVAGWFVPTVITVAMAAFVAWASFGPEPRLTF
    ALVAAVSVLIIACPCALGLATPMSIMVGVGRGAQAGVLIRNAEALERLEKVDTLVVDKTGTLTEGKPHVVAIVPASGFDD
    ATLLKLAASVERASEHPLADAIVRAAKDRNIALGEVTNFAAPTGKGARGEVDGRAVLIGNAAFLTSAGVDTTALDARADE
    LRHDGATVIAMAIDTKLAGLFAIADPVKASTPAALQAIAAEGIKVIMLTGDNRTTALAVARRLGIADVEAEVLPDQKSAV
    VAKLRREGRIVAMAGDGVNDAPALAAADVGIAMGTGTDVAMESAGVTLVKGDLGGIVRARKLSQAVMRNIRQNLFFAFIY
    NGAGIPIAAGILYPSFGLLLSPIIAAAAMSLSSVSVIGNALRLRATRL

    >gi|115525953|ref|YP_782864.1| methionine sulfoxide reductase B [Rhodopseudomonas palustris BisA53]
    MSDTTTKAGKIDKSDSEWRQQLTPMQYAVLREKATERPYSGEYEHEKAQGTYVCAGCGQVLFESDAKFDSGCGWPSFTAP
    AAEGHVEEERDVSHGMVRTEVLCARCSGHLGHVFPDGPGPTGLRY
    CINSAALKLEKK

    >gi|115525954|ref|YP_782865.1| methionine sulfoxide reductase A [Rhodopseudomonas palustris BisA53]
    MGRTSLRIALGAAVGALAIWGLPIRAVQASEEAVVIPAPAVDVAAKDGLQTAVLAGGCFWGVQGVFQHTAGVVNAVSGYA
    GGSKLTANYTAVSTGVTSHAEAVEITYDPKQISYGKLLQIYFSVAHDPTQLNRQGPDSGTQYRSEIFTVTDEQKRVAEAY
    IAQLDAAKAYKKPIVTKIGPLQGFYAAEDYHQDYLTLHPNQPYIAFNDRPKIDNLKKIFTQDFRDKPTLVSSQKATN

    >gi|115525959|ref|YP_782870.1| thioredoxin reductase [Rhodopseudomonas palustris BisA53]
    MAQPIHSKVVIIGSGPAGYTAAIYASRAMLEPILLQGMQPGGQLTITTDVENYPGFADVIQGPWLMEQMEKQATHVGTRI
    VTDLVTDLDVSQRPFRLTCDSGDVYLADTLILATGAQARWLGIASEQTYQGFGVSA
    CATCDGFFYRGKEVVVVGGGNTAV
    EEALFLTNFASKVTIVHRRDHFRAERILQDRLFKHPKIEVVWDVAVEEICGADNPTRVTHVRLKNVKTGTLSDVAADGVF
    IAIGHAPATELVKGKIKLKPSGYVEVAPNSTATSIPGLFAAGDVADETYRQAVTAAGMGCMAALEAERFLAAQASERAAA
    E

    >gi|115525976|ref|YP_782887.1| peroxidase [Rhodopseudomonas palustris BisA53]
    MSCSNTAVAATSAAAAEVVVPALAPVLTASSAAPSMPRINAPAPHFAAKTTFGDRTLADYRGRWLVLFSHPADFTPVCTT
    EFIAFAKAADAFKAANCDLLGLSIDSIYSHLAWVGNIKEKFGVEIPFPIIEDLSMNVAKAYGMIHPGASDTSAVRATFII
    DPDGILRAMVYYPMTNGRSVAEILRLVQGLQTSLSNGVATPEGWQPGEKIIVGPPKTVAEVATRMSEGLETVDWYFSKRA
    L

    >gi|115526107|ref|YP_783018.1| OsmC-like protein [Rhodopseudomonas palustris BisA53]
    MSTTFGSAKWQGGIKDGKGAISTKSGALSDYPYGFASRFEGKPGSNPEELIGAAHAACFTMALSLILGEAKLTAEQMETK
    ADVTLDKVDDGFAITAVHLTLSAKIPGADDATFQDLAGKAKAG
    CPVSKLLNTNITLDAKLVS

    >gi|115526321|ref|YP_783232.1| methylated-DNA--protein-cysteine methyltransferase [Rhodopseudomonas palustris BisA53]
    MNPLGFALFDTTIGRCGVAWSERGIVAVQLPQPSDAQTRARLRQRHGDLPEAPPTQAVDYAIERMVALLEGRPTDLADIL
    LDLADVSDFQRSVYAIAREIPAGRTLTYGDVARQLGDVALSREVGQALGRNPCPIIVP
    CHRVLAAGDRPGGFSANGGVET
    KLKILAIEGAVVNYTPDLFG

    >gi|115526351|ref|YP_783262.1| alkylhydroperoxidase [Rhodopseudomonas palustris BisA53]
    MHKNWIDMTADLSVALKEVRGGAPDVMKGFSAIAQAALKANALDTKTKELIALAIAVATRCDGCIGFHAEAAVKHGASRD
    EVMETMGMAIYMGAGPSVMYAAQAVEAYDQFVQKKSAGG

    >gi|115526362|ref|YP_783273.1| nitrogenase-associated protein [Rhodopseudomonas palustris BisA53]
    MARVIFYEKPGCAGNARQKSLLIASGHDVDTRNLLTTPWDATMLRPFFGEKPIAQWFNASSPRIKNGELRPAELKPEVAI
    AMMIEDPLLIRRPLLQVGERRESGFDQARIADWIGLKPTPRPVTDSCPKDGDTAHAAACKAAGEN

    >gi|115526429|ref|YP_783340.1| twin-arginine translocation pathway signal [Rhodopseudomonas palustris BisA53]
    MIITRRAFTTALSLTGLAAFAGLSPLRLIDPALAQAAGAVSAADVAKPGALPDMAIGKLDAPVTIVEYASLTCGHCAHFH
    EKVFSKIKTDYIDTNKIKYVFREFPLDIKAAAGSMLSRCIANGDAGKYFAVTDLLFRQQEDWVMKDTTATLKRIGKQAGL
    GEQAVETCLKDQALLDKIAADQKYANEVLQVNSTPTFFINGEMLKGDNSFDEFDKRIKALLKS

    >gi|115526502|ref|YP_783413.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodopseudomonas palustris BisA53]
    MLGIGDRLPSFEIVGVKPGFHLQEEKGQSAFETLTETSFPGKWKIIFFYPKDFTFVCPTEIAEFAKLSKDFADRDAIVLG
    GSTDNEFCKLAWRRDHKDLHHLPIWQFADSKGSLVDGLGVRSPAGVAYRYTFIVDPDNVIQHVYATNLNVGRAPKDTLRV
    LDALQTDELCPCNREVGGETLKVA

    >gi|115526512|ref|YP_783423.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisA53]
    MINLTDEAGAAVRAAMERSGKAAGGLRVMVETGGCAGYKYLIGLDAEPRDDDAVVEAGGVRVFLDPDSQPLLSGMTIGFV
    ESLEGSGFTFDNPNAAAKCGCGKSFC

    >gi|115526528|ref|YP_783439.1| HesB/YadR/YfhF [Rhodopseudomonas palustris BisA53]
    MAFKLTPSADKFIRRMLRFSPGAGGFRLVVTEGGCAGYSTQFDVETAPRPDDEVVVVDELRLFIPKASLALLDGVVVDFM
    ETPTSSGFMIHDPKKSGCGCADETIKPTHTLHQLREI

    >gi|115526831|ref|YP_783742.1| redoxin domain-containing protein [Rhodopseudomonas palustris BisA53]
    MNDDPQIQAAPRRRAGRRLALIVTAIVVGGAIGWGGVYGIGALKRNVPGDPACLPALDLARAVAPLAKGEVAALTPAATA
    LRLPDLAFDDASGQPRKLSDWRGRTVLVNLWATW
    CVPCRKEMPALDRLQAKLGSDKFEVVAINIDTRDAEKPKTFLKEAG
    LHRLGYFADPKAKVFQDLKAIGRALGMPTTVLVDGAGCEIATMAGPAEWDGEEAVALLKAALRE

    >gi|115526857|ref|YP_783768.1| methylated-DNA--protein-cysteine methyltransferase [Rhodopseudomonas palustris BisA53]
    MVGRAYSVFDTALGRCGIAWGTGGIVGVQLAGLREIETRGQLLRRFPEARETRPSVDVELAIDAIATLLRGQACEFSDVE
    LDMQGVPPFNRRVYDILRGIPRGETITFSEIGTRLGASGATHAVSEAVMRNPFPILVP
    CHRAVETRGDTAGAPGFGGAIT
    RYRLLSLEGALAGRGPSLFDVLLPFAPPRSPS

    >gi|115526906|ref|YP_783817.1| methionine sulfoxide reductase A [Rhodopseudomonas palustris BisA53]
    MFFMRKSVSLPSAADALPGRATPLPTAKRHFVNGHGLQPPYPEGMERAVFGLGCFWGAERKFWELGDGVYVTAVGYAGGH
    TPNPTYEEACSGRTGHTEAVLVVFDPTQMPYERLLKTFWESHDPTQGMRQGNDIGTQYRSAIYTSNETQLRAAEASKAAY
    AKALAARGLGAITTEIRPETAFYFAEDYHQQYLAKNPGGYCGLGGTGVACPIGVGVSA