Bacillus cereus AH820 uid58751

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218901465|ref|YP_002449299.1| protein disulfide isomerase [Bacillus cereus AH820]
    MKIEVWSDFVCPFCYIGKRRLEVALEQFPHKKDVEVEFKSFELDQNAPIYSGTSINEVLASKYGISIEEAKRNNVQLGNH
    AASMGLSFNFDEMKPTNTFDAHRLAKFAKDQGKEKEVTEKLLFAYFTESRNLSDVDTLATIAEASGLDKQEALKVINDKS
    AYANDVRVDEAIAQQYQISGVPYFIINQKYAISGAQPLETFVGALQQVWEEENPVPKLQELSSEGGSDMSCTDESCSVPS
    KEQ

    >gi|218901534|ref|YP_002449368.1| alkyl hydroperoxide reductase, F subunit [Bacillus cereus AH820]
    MILDADIKTQLSQYLQLMENDILLKVSAGDDAVSKDMLALVDELSTMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGI
    PLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHFESYISLS
    CHNCPDVVQALNVMSVLNSGITHTMIDGAAFKE
    EVESKDIMAVPTVFLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRN
    VGVPGEAEFKNKGVAY
    CPHCDGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTV
    LKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
    NNPYKQIIISMGSGANAALGAFDYLIRN

    >gi|218901535|ref|YP_002449369.1| peroxiredoxin [Bacillus cereus AH820]
    MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTFVCPTELEDLQNQYATLKELGVEVYSVSTDTHFTHK
    AWHDSSETIGKIEYIMIGDPTRTITTNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRN
    NPGEVCPAKWQEGSATLKPSLDLVGKI

    >gi|218901588|ref|YP_002449422.1| hypothetical protein BCAH820_0430 [Bacillus cereus AH820]
    MKKFETIEELATYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLENYDYVEKIEILLQDMQEVAGRYAVFTGPTILLFHNG
    KEILRESRFISLENLERTIQLFEE

    >gi|218901677|ref|YP_002449511.1| bacterioferritin comigratory protein [Bacillus cereus AH820]
    MVTVGEMAPEFTLEGSNGEQVRLADFRGKNVVLYFYPKDMTPGCTTEACDFRDSYGLFQEKDTVILGVSPDPANRHLKFI
    EKHELPFTLLVDEDHKVAELYDVWKLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEDVLSYIN

    >gi|218901684|ref|YP_002449518.1| hypothetical protein BCAH820_0544 [Bacillus cereus AH820]
    MKSSNKLMALGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRL
    KEEYIAKGKVQLYFINFPFIGKDSDLGAAAGEAIYKQDQDSFWIFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKIDVE
    QFKKDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYVNGNLANPDFDSLKKAIDKELKK

    >gi|218901791|ref|YP_002449625.1| heavy metal-transporting ATPase [Bacillus cereus AH820]
    MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKTMVLETAQNKESEVVTEAKQLVTKLEPHIKVQEEKN
    TKVAKEVFILEGLD
    CANCAMKIENKVKEMPTVSAATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVVREEKG
    GHDHGHSHDHGEANVKKMVGRLVVGGILTAIAALAGLPQMVTIPLFVLAYLLIGGDIVWRAVRNITRGQVFDENFLMAIA
    TVGAFAIQQYSEAVAVMLFYQVGELFQSIAVNRSRKSITSLMDIRPDYANVKVGNETKQVSPEDVQIGDYIIVKPGEKVP
    LDGKVIEGTSMVDTSALTGESVPREVEVGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITKF
    ARYYTPVVVITAAIMAFIPPLILEGATFSDWIYRALVFLVISCPCALVVSIPLGFFGGIGGASKSGVLVKGSNYLEALND
    VKYIVFDKTGTLTKGVFKVTKMEPSEGTTSEELLEYAAFAEVYSNHPIAQSIRKAYGKSIDEKIIDDYNEISGHGTVVKV
    QGKEIFAGNAKLMRKENITFKQPETVGTLVHVAVDGRYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAKPVGEA
    VGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKIAFVGDGINDTPVLARADVGIAMGGLGSDAAIEAADIVIMTDEPS
    KIATAVKIAKRTRSIVWQNIIFALGVKGIVLLLGAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL

    >gi|218901840|ref|YP_002449674.1| hypothetical protein BCAH820_0701 [Bacillus cereus AH820]
    MKLTIKHDDIEADLSYGPLAIGKENGYSPLQLLVSSIAGCSAIVFQTILEKKRIPYDTFTIETEIGRSEALSKPVESVHL
    HYKIKAQNITEEQLDKALQLAVKN
    CTIVQSVKDSIKVTETIELIK

    >gi|218901928|ref|YP_002449762.1| hesA/moeB/thiF family protein [Bacillus cereus AH820]
    MNNRYSRQELFSPIGEEGQQKIREKHVLIIGAGALGSANAEMFVRAGVGTVTIVDRDYVDWSNLQRQQLYEESDVKNNLP
    KAVAAKKRLEEINSEVRVKALVQDVTAEELEELVTNVNVMIDATDNFETRFIVNDIAQKYSIPWIYGACVGSYGLSYTIL
    PSKTPCLSCLLQSIPLGGAT
    CDTAGIISPAVSLVVSHQVTEALKLLVEDYESLRDGLVSFDVWKNEYSCMNVQKLRKHNC
    PSCGENALYPYLNKENTSKTAVLCGRNTVQIRPPYKEEMDFERYKELLNDRVNDLNVNPYLLSFSVEEKRLVAFKDGRVL
    VHGTKDISEAKTVYHRYFG

    >gi|218901946|ref|YP_002449780.1| putative thioredoxin [Bacillus cereus AH820]
    MKKMLIFGGIIIVLFAAIFAVTQMEKKNASTDEKGYYSNKISLEDLNKNIEDKKEQTIYFYQTSCVHCQKVSPIVVPLAK
    DLNVDMKVIDIENLNEPWDKYNIQGTPTIIHFKDGKEVSRISGEQSKDKFKEWFEQTKK

    >gi|218901986|ref|YP_002449820.1| pyridine nucleotide-disulfide oxidoreductase, class I [Bacillus cereus AH820]
    MSRKIIVVGGVAGGASVAARLRRLSEEDEIIMVERGEYISFANCGLPYYIGGVITERQKLLVQTVERMSKRFNLDIRVLS
    EVVKINKEEKTITIKNVTTNETYNEAYDVLILSPGAKPIVPSIPGIEEAKALFTLRNVPDTDRIKAYIDEKKPRHATVIG
    GGFIGVEMVENLRERGIDVTLVEMANQVMPPIDYEMAAYVHEHMKNHDVELIFEDGVDALEESGAVVRLKSGSVIQTDML
    ILAIGVQPESSLAKDAGLALGVRGTIKVNEKFQTSDPHIYAIGDAIEVKDFVTETETMIPLAWPANRQGRMLADIIHGHT
    DSLYKGTLGTSVAKVFDLTVASTGVNEKILKRLNIPYEVVHVQANSHAGYYPNATPVLIKLIFNKDSGKIYGAQALGRDG
    VDKRMDVIATAIKANLTVLDLPDLELSYAPPYSSAKDPVNMVGYAASNIVDGFVDTVQWHEIDRIVENGGYLIDVREPNE
    LKQGMIKGSINIPLDELRDRLDEVPVDKDIYIT
    CQLGMRGYVAARMLMEKGYKVKNVDGGFKLYGTVLPERIAY

    >gi|218901988|ref|YP_002449822.1| rhodanese domain protein [Bacillus cereus AH820]
    MSIKVDMSLDCKGLACPMPIVKTKKAIEGLASGQVIEVKATDKGSTVDIKSWANKVGHQYIGTKHEGDILMHYVRKAHEH
    EVNEVVKYPHTITNTELEEILVSGEECTVLDVREAAEFAFGHIPSATSMPLGELESLVLDKTKQIYVV
    CRTGNRSDVACQ
    MLKEKGYTNVKNVIPGMIEWQGNIEN

    >gi|218901989|ref|YP_002449823.1| metallo-beta-lactamase family protein [Bacillus cereus AH820]
    MEVKSLQAKDVAEKVLFGELFILDVRNETDYEDWKIEGKQISSINKPYFDLLDGVDQIVSELPKDKDVLVVCAKEGSSIF
    VAEQLTEAGLENIYYLAGGMKAWSEYVKPIKVGDLKNGGSMYQFNRLGKGCLSYMVVSNGEAAVIDAIRTVEAYEQFAKE
    NGVTITNVMDTHLHADHISGGRKLAEKVGGTYWLPPKDAEEVVFLYEPLVEGSVITVGGTKIEIDALYSPGHTIGSTSFI
    VDNSYLLSGDILFVDSIGRPDLAGKAEDWVSDLRNTLYSRYKELSQSLIVLPAHYSKISEMDESGIVSAKLKDLFEHNAG
    LNIEDEGEFRKVVTENLPPQPNAYEEIRQTNMGKIHPSVDEEREMEIGPNRCAVHK

    >gi|218901991|ref|YP_002449825.1| rhodanese-like domain protein [Bacillus cereus AH820]
    MNTILSTLFIVLAAWFVISRFLPVKGVQNINGKELKSIVGKQGKYFIDVRTVGEYRGNHMKGFQNIPLNDLASKTNQLDK
    NREVIVI
    CQSGMRSKQAAKMLKKLGFQHVINVSGGMNGL

    >gi|218901992|ref|YP_002449826.1| rhodanese domain family protein [Bacillus cereus AH820]
    MKEMTAKELEEKLLCKEAVNIVDVREVEEVAEGKIPEACNIPLGLLEFRMHELDKKKEYIIVCRSGGRSARAVQFLEGYG
    FRVINMVGGMLAWEGKVE

    >gi|218902388|ref|YP_002450222.1| hypothetical protein BCAH820_1270 [Bacillus cereus AH820]
    MVTLYSSPSCTSCRKAKLWLEENHIPYTERNIFSDPLTIEEIKEILRMTESGTDEIISTRSKVFQELNVNLESLPLQDLY
    KMIRDYPGILRRPIMIDEKRLQVGYNEDEIRRFLPRTVRTFQLREAQRLVN

    >gi|218902451|ref|YP_002450285.1| pyridine nucleotide-disulfide oxidoreductase, class I [Bacillus cereus AH820]
    MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEV
    TKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGA
    IGLEMAETFVELGKKVRMIERNDHIGTIYDADMAEYIHKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLV
    SVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRA
    FKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDK
    RIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE

    >gi|218902683|ref|YP_002450517.1| resA protein [Bacillus cereus AH820]
    MKKNRLLFRVIILLILSGAVGFTLYQGFFADKEKMQIGKEAPNFVVTDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEM
    PYMNELYPKYKEKGVEIIALDADETDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPSSFLIDKDGKVVEQIIGEQT
    KEQLEGYLKKITP

    >gi|218902786|ref|YP_002450620.1| rhodanese-like domain protein [Bacillus cereus AH820]
    MIVTVEWLREHIEDENVRIIDCRFDLANPNWGREKYEEEHIPHALYFDLNVDLSSPVTEHGGRHPLPNVEEFADKLSQAG
    IDEHMTVIAYDSEAGANASRLWWLLNYVGHEKVYILDGGFPAWKENGLPITPEIPVVIRKTFKANIQDHMLVTMETVREN
    IDAGKDVTLIDSREPKRYAGVEELVDPKAGHIPTAVNYFWKDGMLQSGQFKNEAQQQERFQNLSKDKETIVY
    CGSGVTAC
    PNIVALKLAGFQNVKLYAGSWSDWISYPENQIAKEED

    >gi|218902946|ref|YP_002450780.1| thioredoxin family protein [Bacillus cereus AH820]
    MKKLIAIILAGALIWAGVNFYNSKKEEKERKAKQAELQKTEVLPQVGFKAPDITLKGLDGKLYSLHDAKGKPYLINFWAS
    W
    CGPCEMEAPDLVRMYDKYKKDVEIFAVNATIGDPVQEASAFADRHGFKFPVLLDMDGVAGLDYKVFSLPTTFFVNKDGI
    IVEQVRGVLPPDQLEEKFKKLIES

    >gi|218903002|ref|YP_002450836.1| peptide methionine sulfoxide reductase [Bacillus cereus AH820]
    MSEKTYELATFAGGCFWCMVKPFDELPGIHKVLSGYAGGHVEDPTYEQVKAGTSGHLEVVQITFDPSIFPYEKLLNLYWP
    QIDPTDDGGQFFDRGPSYRTAIFYHTETQKELAEKSKHSLAESGMFKDPIVTEIRPAAPFYEAEEYHQHFYKKNPEKYAT
    EQKESGREDFIKENWQKK

    >gi|218903033|ref|YP_002450867.1| rhodanese-like domain protein [Bacillus cereus AH820]
    MATTKPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRFDGIVFKID
    EADGHAFKKMHVRPRPELVTLRLEDDINPHEITGKYLEPKDFYEAMKQEDTVIIDARNDYEFDLGHFKGAIKPDIESFRE
    LPDWIRENKEVLEGKKILTY
    CTGGIRCEKFSGWLVREGYEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQ
    KEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEENEAKYLRACSHECRVSPRNRYVIQHELTEEQVAAALEKIEAGK

    >gi|218903071|ref|YP_002450905.1| 2-hydroxychromene-2-carboxylate isomerase family protein [Bacillus cereus AH820]
    MTVKMKVYSDFICPFCFLAKGPLDEVAKEKDVEIEWMPFELRPSPYSKIDPWNEPEKLGSWDAFILPTAKKLGIDMRLPR
    VSPHPYTHLAFEGCQFAKERGLGNEYHHRVFTAFFQEEQNIEDIDVLTKLAVEVGLPEAEFKDTLVTRKYKEKHQEAIQH
    AYDEANIMAVPTVMIGDEVIQGLASKETLERVIDKEIEKDKTNSFEGMQCNTDGYC

    >gi|218903187|ref|YP_002451021.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus AH820]
    MYQAYYESELGLLEITANDKGITSVIFVDERQEEHTNEMIDQCINELDEYFKGNRKEFTVPLSPEGTAFQKNVWDALYTI
    PYGVSASYLDIAEKVGNTKAVRAIGGANSRNPISIIVP
    CHRVIGKSGKLVGYAGGLWRKEWLLKHEGILK

    >gi|218903270|ref|YP_002451104.1| glutathione peroxidase [Bacillus cereus AH820]
    MTVYDFSAKTIIGEEKSLKDYEGKVLLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILGFPCNQFGGQEPGTEVDITSF
    CELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMKAVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE


    >gi|218903283|ref|YP_002451117.1| putative molybdopterin biosynthesis protein MoeB [Bacillus cereus AH820]
    MQERYSRQVLFSGIGEMGQRKIREKHVLLIGAGALGAANAEALVRMGIGKLTIADRDYVEWSNLQRQQLYTEEDAKQCKP
    KAIAAAEHVRKINSEVEIVPVVTDVTMKEMEELTKEVDLILDATDNFDTRLLINDISQKENIPWIYGGCIGSYGVTYTIL
    PGKTPCFRCLMDHPMGGAT
    CDTAGIIQPAVQMVVAHQVAEAMKILVDDFETLRGTMLSFDIWNNQFLSLKVNKQKKSTCP
    SCGNTRTYPSLTFESQVKTEVLCGRNTVQIRPGIKRVLYLNEIKKRLQKIVHVQKTPYLLSFLIDEYRFVLFTDGRAFIH
    GTNDVKIAKRLYAKYIG

    >gi|218903452|ref|YP_002451286.1| thioredoxin family protein [Bacillus cereus AH820]
    MREIKSDKEFKDIIASEEPVVVKFFTTWCPDCVRMDNFIGDVMEEFNKFEWYSINKDEFPSIAEEYQVMGIPSLLVYQNG
    EKLGHLHSANAKTEEQVTEFLEAY

    >gi|218903587|ref|YP_002451421.1| hypothetical protein BCAH820_2471 [Bacillus cereus AH820]
    MKKFDVAIVGGGLAGLTASIYLAKAGRKVIVLEKSSRFGGRGMTINKNGICMNLGAHALYRGGAAFLTFNELGMNLPGGI
    PSTKAHGIWKGDIFTIPTDFRSILSTPLLSWSAKVQFLRLIIRLGHLNIGEVPKMSLTTWTENEIKDPMVRNIFYALCRT
    TTYTFAPTIQLASSVLKQIQLSIKEGVFYVDGGWETIITKLRDIANHVGVQFLAKKHVLEIEHYEDKQRIYCFDDEVFEV
    GTVIVTTPPKEACNIIKGAEGTSLQRWSEQSIPVTVAALDIGLRRLPNPTHQFALGLDQPIFFTNQSRAAKLSDDGSIAV
    SLIKYQNPALEMKHTHEDKGQLESTMDLLHPNWKREVVAQQYLPTIKVVYDFPHINRVETPGPNIPEMPGVYVAGDWAGH
    DEILADAAVASGKRAALHILKQLESEAVHHGNGAII

    >gi|218903668|ref|YP_002451502.1| metallo-beta-lactamase/rhodanese-like domain protein [Bacillus cereus AH820]
    MLLKYFYDEKLAHASYLVGCQKEGVAIVIDPGRYIEQYIEFAKKEGMEVIAAAETHIHADFLSGSRELSTLYHANLYVSD
    VGDCNWKYQYLNEGQYNLVREGTEFKVGHIKFNVIHTPGHTPESISFLVTDTSQNNYTNDKPIGIFTGDFIFVGDIGRPD
    LLETAVGMKDTAKIGAKQLFDSIQKIKTLPDYLQIWPSHGAGSACGKALGAIPTSTLGYEKMFNWAFQCNEESDFISTLL
    TGQPEPPRYFSLMKNLNKYGPPIRKKREIFAIKTVEELQGVMRSVQQIVDIRDVESFASGHIEKSINIPYNNSFTTWCGW
    LLDYKTETLIILDEEKVRVEEVIRDFESIGLDNIIAFAPLQVIQRLDRFESYKEKTSIELYPHIKDGRVKVIDVRSKKEW
    DEGHLHDAIHIPLGNLLKQLDCIPKDCPIVLQ
    CRTGLRSAIAASILQRAGIKEVVNLKGGFLAWNKEELPYTTCNLNV

    >gi|218903892|ref|YP_002451726.1| acetoin dehydrogenase complex, dihydrolipoamide dehydrogenase component [Bacillus cereus AH820]
    MSKLVVIGGGPAGYVAAITAAQNGKDVTLIDEADLGGTCLNVGCMPTKSLLESAEVHDIVRMANNYGVTLNKESISVDWK
    QMQARKSQIVTQLVQGIQYLMKKNKIKVIQGKAKFETDHRVRVTCGDKEYVVDGEQFIIAAGSEPTELPFVPFDGKWILN
    SSHAMSIDNIPKSLLIVGGGVIGCEFASIYSRLGTKVTIIEMAPQLLPGEDEDIANILREKLENDGVEIFTGAALKGLNN
    YKKQASFEYEGSIREANSEFVLISVGRKPRVQEIGLEKAGIQFSNKGIVVNKHMQTNVSHIYAAGDVIGGIQLAHVAFHE
    GTTAALHASGEDVKVNYHAVPRCIYTAPEIASVGLSEKLAREQYGDILIGEFPFTANGKALIIGEQMGKVKVIVEPKYQE
    IVGISIIGPHATELIGQGTVMIHTEVTADIMRDYIAAHPTLSESIHEALLQAVGHAVHA

    >gi|218903951|ref|YP_002451785.1| carboxymuconolactone decarboxylase [Bacillus cereus AH820]
    MEHEQHHSSVNDVLHHYKEGIGSFTNQIPEIAETYNAFTQACFQEGTLTKREKQLIALGISLATQDEYCTIYHTKGCLDQ
    GCSDKEILEACGVSAAFAGGAAMSQAVTLVQECLTELKNQKH

    >gi|218904538|ref|YP_002452372.1| hypothetical protein BCAH820_3422 [Bacillus cereus AH820]
    MVVLYTTASCASCRKAKAWLEENQIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIEELSLNEFY
    KLIIEHPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN

    >gi|218904639|ref|YP_002452473.1| hypothetical protein BCAH820_3523 [Bacillus cereus AH820]
    MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYA
    GHQFGHFNMLGDGRALLIGEQMTPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTT
    GEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKW
    QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEAL
    KIAQDEISKFSVQYEKQWFLGMKKKLGLFSNEEQDQSLIEQLLKMMEKFKADYTNTFRSLTLNTIENTALFESPEFKEWY
    KLWQSRLEKQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALSNPYAYATEQEEYCVPPAPTNR
    PYRTF
    CGT

    >gi|218904691|ref|YP_002452525.1| putative molybdopterin biosynthesis protein MoeB [Bacillus cereus AH820]
    MAERYSRQQLFKPIGDRGQEKIRNKHVLIVGAGALGSASAESFVRAGVGKLTIIDRDYVEWSNLQRQQLYSEEDAREKLP
    KAIAAKNRLEKLNSEVQIDAFVMDACAENLEGLLENVDVIIDATDNFDIRFIINDLSQKYNIPWVYGSCVGSYGMSCTII
    PQETPCLHCVLKNVPVTGVT
    CDTAGIISPTVQIVAAYQVAEALKILVEDFSAIRKTFFMFDIWSNQNHFIKLGKIKTDAC
    LSCGLNRTYPYLSYENQTKVAVLCGRNTVQIRPVENRQYNFDDIEKVLNKLGKVDRNPYLLSCQLDEYRVVIFRDGRVFI
    HGTNDILKAKQLYYRVFG

    >gi|218904740|ref|YP_002452574.1| ahpC/TSA family protein [Bacillus cereus AH820]
    MWRKLTIIVVLLCLAGYAAYEQFGKSDQAAQGEQEKSEAAMKEMIASNGIEIGKSAPDFELTKLDGTNIKLSDLKGKKVI
    LNFWATW
    CGPCQQEMPDMEAFYKKHKDNVEILAINYTPSEKGGGVEKVSNFAKEKGITFPILLDKNIDVTTAYKVITIPT
    SYFIDTKGVIQDKFIGPMTQKEMEKRIAKLK

    >gi|218904857|ref|YP_002452691.1| heavy metal-transporting ATPase [Bacillus cereus AH820]
    MNEQKEANLQISGMTCAACANRIEKGLKKVEGVHDANVNFALEKTKIMYDPQKTNPQQFKEKVESLGYGIVSDKAEFTVS
    GMT
    CAACANRVEKRLNKLEGVNGATVNFALESATVDFNPDEINVNEMKSAITKLGYKLEVKSDEQDESTDHRLQEIERQK
    KKFIISFILSFPLLWAMVSHFSFTSFIYLPDMLMNPWVQLALATPVQFIIGGQFYVGAYKALRNKSANMDVLVALGTSAA
    YFYSVYLSIQSIGSSEHMTDLYFETSAVLITLIILGKLFEAKAKGRSSEAIKKLMGLQAKTATVVRDGTEMKILIEEVVA
    GDIVYVKPGEKIPVDGEIVEGKSAIDESMLTGESIPVDKTIGDVVIGSTMNKNGFLKVKATKVGRDTALAQIIKVVEEAQ
    GSKAPIQRVADQISGIFVPVVVVIAIITFAVWMIFVTPGDFGGALEKMIAVLVIACPCALGLATPTSIMAGSGRSAEYGI
    LFKGGEHLEATHRLDTVILDKTGTVTNGKPVLTDVIVADGFNEEEILRLVGAAEKNSEHPLAEAIVEGIKEKKIDIPSSE
    TFEAIPGFGIESVVEGKQLLIGTRRLMKKFNIDIEEVSKSMEELEREGKTAMLIAINKEYAGIVAVADTVKDTSKAAITR
    LKKMGLDVVMITGDNTQTAQAIAGQVGIEHVIAEVLPEGKAEEVKKLQAQGKKVAMVGDGINDAPALATADIGMAIGTGT
    DVAMEAADITLIRGDLNSIADAIFMSKMTIRNIKQNLFWALAYNGLGIPIAAFGFLAPWVAGAAMAFSSVSVVLNALRLQ
    RVKLK

    >gi|218904858|ref|YP_002452692.1| copper-ion-binding protein [Bacillus cereus AH820]
    MEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSVVTLKDIVAVIEDQGYDVQ

    >gi|218904868|ref|YP_002452702.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus AH820]
    MNSYKNKFIYWTLLTHANWKFHIAATESGLCFIGSQDEQFEELNIWARKKLPQHILIHSPDYLQVYTKEIIEYLKNKRET
    FTFPIDAYGTAFQLSVWNTVREIPYGKTYSYTEIADRIQKPTAVRAVASAIATNPILITIP
    CHRVIGKNGKLTGFRGGLE
    MKKELLVLEKLQVEFI

    >gi|218905100|ref|YP_002452934.1| pyruvate dehydrogenase complex E3 component, dihydrolipoamide dehydrogenase [Bacillus cereus AH820]
    MVVGDFPIELDTVVVGAGPGGYVAAIRAAQLGQKVAIIEKANLGGVCLNVGCIPSKALINAGHRYENAMHSDDMGITAEN
    VKVDFTKVQEWKNGVVKKLTGGVEGLLKGNKVEIIRGEAYFVDANTLRVMTEEAAQTYTFKNAVLATGSTPIEIPGFKYS
    KRVINSTGALSLPEIPKKLVVIGGGYIGMELGTAYANFGTEVTVVEAGDEILAGFEKAMSSVVKRALQKKGNVNIHTKAM
    AKGVEETETGVKVSFEVKGEIQTVEADYVLVTVGRRPNTQEIGLEQVGVKMTDRGIIEIDEQCRTNVPNIYAIGDIVPGP
    PLAHKASYEGKVAVEAISGHASAIDYIGIPAVCFTDPELASVGYTKKQAEEAGMTVTVSKFPFAANGRALSLNSTDGFLQ
    LVTRKEDGLLVGAQVAGAGASDIISEIGLAIEAGMTAEDIAQTIHAHPTLGEITMEAAEVALGMPIHIVK

    >gi|218905119|ref|YP_002452953.1| glutaredoxin family protein [Bacillus cereus AH820]
    MKKIEVYTQPDCPPCVIVKEFLKHNNVVYEEFDVKKDAAARNRLLYDYDSYSTPTVVIDGEVVAGFQIEKLQQLLNIE

    >gi|218905262|ref|YP_002453096.1| Na+/H+ antiporter NhaC [Bacillus cereus AH820]
    MVSKIESVLLTIFIFFCIGFSVIKLEVSPHIPILFGIVLLLAFGFMKKIDWSTMEKGMISSISAGIPSIFIFLLVGVLIS
    VWIAAGTIPTLMVYGFQLVSPKIFIPTVFVV
    CAIVGTSIGSAFTTAATVGLAFMGMGSALGYDPALIAGAIISGAFFGDK
    MSPLSDTTNLAPAVTGVDLFEHIRNMLWTTVPAFIIAFIAFFILGSGTSGDVDFTNFISTLEKNATISIFTLIPILLLFL
    FAFKKVPAVPTLLAGIIVGIIILFIFKPSTSLTDLMKIMQDGYVSKTGIKDIDSLLSRGGLQSMMMSIALIFLALCMGGL
    LQGMGIITQLMNIISSFVKTSTRLIISTASTAIGVNFLLGEQYLSIVLTGQAFANKYDEVGLERRNLSRVLEDAGTVINP
    LVPWGVSGVFLSNVLGVPTFDYVPFAIFCLACPIVTIIVGFTGFGLSWKKEKAVTIS

    >gi|218905299|ref|YP_002453133.1| 3-methyl-2-oxobutanoate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Bacillus cereus AH820]
    MAKEYDLVIVGGGTGGYVAAIRASQLGLKTALVEKENLGGTCLHKGCIPSKALLRSAEVYATAKKSEEFGVIASNVELNF
    AKVQERKEKIVTQLHKGVQHLMKQGKIDVFEGIGRILGPSIFSPMPGTISVELASGEENEMLIPKNVLIATGSRPNSLPG
    LELDGEYVMSSDHALKMETLPSSIIIVGGGVIGIEWASMLADFGVEVTVLEYAKTILPLEDQDVSKEMQRLFKKKGIKVV
    TGAKVLPETLVKDNGVTIQAEHNGENKEFKAEKMLVSVGRQANTQNIGLENTDIVVEKGYIQTNEFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIVAVEHIAGKEVTPIDYSMVSKCVYSSPEVASVGLTEQEAKEKGYKLKVGKFSFRAIGKALVYGES
    DGFVKLVVDEETNDILGVHMIGPHVTDMISEAGLARVLDATPWEVAHTIHPHPSLSEAIGEAALAVDGKALHA

    >gi|218905345|ref|YP_002453179.1| rhodanese-like domain protein [Bacillus cereus AH820]
    MSTTWIILLAVIVAFIGYTVWMYFYQKKLITTLSEEEFRAGYRKAQLIDIREADEYTAGHILGARNIPLSQIRLRHKELR
    KDQPVYLY
    CQSGFRTGRAAQYLKKQGYKDFYQLQGGFKTWTGKIKKK

    >gi|218905648|ref|YP_002453482.1| mercuric reductase [Bacillus cereus AH820]
    MKKYRVNVQGMTCTGCEEHVAVALENMGAKEIEVDFRREEAVFELPNDVEVERAKKAISEAKYQPGETEEVNQQETVQLG
    DEGDYDYIIIGSGGASFSSAIEAAKYGANVAIIERGTVGGT
    CVNIGCVPSKTLLRAGEINHIAKNNPFVGLHTSAGNVDL
    APLIKQKNDLVTDLRNSKYVDLIDDYGFELIKGEAKFVDEKTVEVNGKQLSAKRFLIATGASPAVPKIPGLEEVDFLTST
    TLLELKQVPKRLTVIGSGYIGMELGQLFHHLGSEVTLMQRSPRLLKEYDPEVSEAITQALTEQGINLVTGASFERIEQDG
    DVKKVHVEVNGKKRIIEADQLLVATGRTPNTTTLDLEVAGVEVGSRGEIIIDEYSKTTNSSIYAAGDVTLGPQFVYVAAY
    QGGIAAGNAIGGLNKKLNLEVVPGVTFTAPAIATVGLTEQQAKEKGYEVKTSVLPLDAVPRALVNRETTGVYKLVADAKT
    MKILGAHVVAENAGEVIYAATLAIKFGLTVEDLRETMAPYLTMAEGIKLAALTFDKDVSKLSC
    CAG

    >gi|218905670|ref|YP_002453504.1| organic hydroperoxide resistance protein [Bacillus cereus AH820]
    MDKLYTASVTATGGRNGKVVSDDGILNLDVKMPKALGGAGGEATNPEQLFAAGYAACFDSALQLVIRTKRVKVESTEVTA
    HVSIGKDTDGGFGLSAVLDVHVAGVSHSEAQELVEAAHGV
    CPYSKATRGNIEVTLNVR

    >gi|218905745|ref|YP_002453579.1| thioredoxin [Bacillus cereus AH820]
    MAIVNANDQSFAAETSEGVVLLDFWAPWCGPCKMIAPVLEEIDAELGEKVKVVKVDVDENQETARQFEVMSIPALFVLKD
    GKVVDQALGYKPKEALVELVSKHF

    >gi|218905869|ref|YP_002453703.1| thiol peroxidase [Bacillus cereus AH820]
    MANVTFKGNPMTLVGTEVKVGDQAPNFQVLANDLSPVSLETYKGEVKLISVVPSIDTGVCDAQTRRFNQDAAGIENAKVL
    TISADLPFAQKRWCAANGLENVVTLSDHRDLSFGEAYGLVMKELRLLARAVFVVDSNDKVVYVEYVSEGTSHPNYEAALE
    AAKAAK

    >gi|218905923|ref|YP_002453757.1| thioredoxin family protein [Bacillus cereus AH820]
    MKSLESMEQFQQLKNEENVVFMFSAEWCPDCRFVDPFMPEVEEKYSDFSFYYVDRDEFIDLCVKLDVFGIPSFVAYNKGE
    ETGRYVNKDRKTQEQIEEFIEGLK

    >gi|218905937|ref|YP_002453771.1| conserved hypothetical protein TIGR00275 [Bacillus cereus AH820]
    MHYDVIVIGGGPSGLMAAIGAAEEGASVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNN
    EDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVVLKTGEVLETNHVV
    IAVGGKSVPQTGSTGDGYAWAKKAGHTITELFPTEVPILSNEPFIQDRSLQGLALRDVNLSVLNPKGKAIISHKMDMLFT
    HFGLSGPAALRCSQFVVKALKKFKTNTVQMSIDALPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLERNE
    IDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYN
    ITSALVTGRIAGTTAGENAKMQY

    >gi|218905954|ref|YP_002453788.1| putative molybdopterin biosynthesis protein MoeB [Bacillus cereus AH820]
    MQERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKITIADRDYVEWSNLQRQQLYTEEDAKQYKP
    KAVAAAEHLKTINSEVEINPVVTDVTVQEMEELVKDVDLILDATDNFETRLLINDISQKYNIPWIYGGCVGSYGVTYTIV
    PGKTPCFRCLMEHPASGAT
    CDTAGIIQPAVQLVVAHQITEALKILVEDFEALRETMLSFDLWNNQQMAFKVNRQKKDTCL
    SCGRLRTYPSLTFEAQTKTEVLCGRNTVQIRPGVRNEFNLEEIKKRLQRSVDVKATPYLVSFLVEEFRFVLFTDGRAFIH
    GTNDINVAKRLYTRYIG

    >gi|218905959|ref|YP_002453793.1| rhodanese-like domain protein [Bacillus cereus AH820]
    MTEVKTITTEEVQERLENGETLFLVDVREDEEVATGKIPEAVHIKMGDIPNKVDFFDKENEYIFICRSGMRSENVCHYLN
    EQGFKTVNMVGGMLQYEGEIK

    >gi|218906003|ref|YP_002453837.1| hypothetical protein BCAH820_4891 [Bacillus cereus AH820]
    MYVTVTEAAYKKIMDTIPNEAKYIKLFYDNEGCGCVMSGIIDLVAVAEKDERDVDIESSAMNFIADRTKLVFMDDKLTVD
    WHEGGGTFQLKSPSQFYNPNMKLHVRV

    >gi|218906132|ref|YP_002453966.1| hesB/yadR/yfhF family protein [Bacillus cereus AH820]
    MIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEVEPKEDDTVLEFFGVEFVIDKESAPIVKGVKIDYK
    QSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC

    >gi|218906135|ref|YP_002453969.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus AH820]
    MKHLVILGGGYGGMRILQRLLPSNQLPDDVQVTLIDKVPYHCFKTEYYALVAGTISETHIRIPFPEHPRLNIQYGTVTNI
    DLEEKAVHLDGGEAIQYDDLIIGLGCEDKYHNVPGAKEYTHSLQSIEQTRKTYEQLNSLEPNATVAVVGAGLSGVEVASE
    LRESRSDLKIYLFDRKDRILFPYPEKLSRYVEEWFVKHKVTIIRNSNITKVEPNIVYNHDEPLECDAIVWTAGIQANEVV
    RNLPVEQDGSGRVVLTKYHNIPNNEHVYVVGDCAALPHAPSAQLAEGQGEQIVQILLKRWHNEPLPDELPVIKLKGVLGS
    LGKKHGFGLLANQPLMGRVPRLLKSGILWMYKYHNG

    >gi|218906183|ref|YP_002454017.1| putative thioredoxin [Bacillus cereus AH820]
    MIEVIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEDLKIGMLDLNYAPHFAKEYGIESVPCLLVFE
    NGTLIKKIYAFHSVEYLYTELK

    >gi|218906186|ref|YP_002454020.1| hypothetical protein BCAH820_5098 [Bacillus cereus AH820]
    MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASED
    EMYELLASDGMLIKRPIVTDGTKVTLGFNEEQFESVWKKYQ

    >gi|218906314|ref|YP_002454148.1| glutaredoxin family protein [Bacillus cereus AH820]
    MKVVLYTKKDCGLCVKAKQVLQEVQCEYSFQIEEIDIYEDNDLLEKYHLMIPVVEIDEKQVEYGNIHKGVIINYIKNAVK
    S

    >gi|218906330|ref|YP_002454164.1| thioredoxin-disulfide reductase [Bacillus cereus AH820]
    MSEEKIYDVIIIGAGPAGMTAAVYTSRANLSTLMLERGIPGGQMANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYA
    YGDVKEVIDGKEYKTIIAGKKEYKARAIIVASGAEYKKIGVPGETELGGRGVSY
    CAVCDGAFFKGKELVVIGGGDSAVEE
    GVFLTRFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEANGKVGSVTLVDVNSGEEKEVKTDGVFVYIG
    MLPLSKPFVELGITNENGYLETNERMETKVPGIFAAGDVREKMLRQIVTATGDGSIAAQSAQHYVEELLEELKTVSEK

    >gi|218906617|ref|YP_002454451.1| peptide methionine sulfoxide reductase [Bacillus cereus AH820]
    MAVNEKVELATFAGGCFWCMVSPFEEMEGIIKVVSGYTGGHKENPTYKEVCSETTGHYEAVQITFDANKMPYEELLNIYW
    RQIDPTDVGGQFHDRGQSYETVIFYHNEEQHKKAEASKEELAKSGRFSKPIATKILPAATFYPAEEYHQGYHKKNTFRYE
    LYRKGSGRDAFIKQHWPKDNAHLKEKLNEMQFYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSIDKFDSGCGWP
    SFTKPVMSASVKEKMDVSHNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRY
    CINSAALRFIPKEELEKEGYGDFLMLFGNK
    K

    >gi|218848406|ref|YP_002455061.1| hypothetical protein BCAH820_B0179 [Bacillus cereus AH820]
    MNKVYKIGAIVTTLCVACIAIFTLTKNESVNPETVTPNKTIVSAAETKGSPENIKDISKEELKQKIQSHEEFIAYYYQPT
    CHYCKKAAPDINSMSKKHDRTIYRIDISTPENQSAFQEFDIPGTPVVVAYNRGEEIERLEGAVSAATYDGFFARRNSSAS


    >gi|218848437|ref|YP_002455143.1| thioredoxin, putative [Bacillus cereus AH820]
    MLKEINLTELEQQISVISKPILLKFTAEWCPGCRQLAPVVESVSEQFGNQIVFFDVNVDKEIDLAKKFGVMSIPTLVLLK
    NGKEVDRVTAPAPNEDVIVSFIKNNYNA

    >gi|218848287|ref|YP_002455156.1| cytochrome c biogenesis protein, putative [Bacillus cereus AH820]
    MKIRIVAILAVVLILGFKFLSPTSETPKAQAPQSINTDKKSVSTFSVGLEKDQQAPEFTLSTLTGESVKLSSLRGKTVIL
    NFWTTW
    CPPCKSEMPDMQQFYSDYKKNNIIIIGVNLTDNESNTKQVKDFTKQYKISFPILLDTKGEIRKQYKIITIPTTY
    IIDSNGIIAENVIGPITYDKIKKLTLNSANIKKG

    >gi|218848225|ref|YP_002455162.1| copper-translocating P-type ATPase [Bacillus cereus AH820]
    MDKQKHVTLGVTGMTCAACATRIEKVLNKMDGVDANVNLAMEKASIKYDPSQQEISNIKNKIENLGYNVAEEKITLDIEG
    MT
    CAACATRIEKVLNKMEGVSNATVNLATNSAVVEYNEGLISTENILEKIKKTGYKGQIRSEDVDRSERKEEVIKAKKRQ
    LIISIILSLPLLYTMIGHMPFDTGIPMPHILMNPWFQLLLATPVQFYIGGHFYVGAYRALRNKSANMDVLVALGTSAAYF
    YSLYEALKTLGNANYSPDLYFETSAVLITLILVGKYFETLAKGRTTEAISKLLSLQAKDALVVRDGQEIRVPLEEVVIGD
    TIIVKPGEKIPVDGIVTSGVSSVDESMITGESIPVDKKEGDAVIGATINANGVLTIKAEKVGKDTALAGIIKIVEEAQGS
    KAPIQRLADIISGIFVPIVVAIAVVAFIVWYFFITPGDLPNALEVGIAILVIACPCALGLATPTSIMVGTGKGAEKGILF
    KGGEFLEGTHKINAVLLDKTGTVTKGKPEVTDVLEFEEGMLDYAISAESASEHPLAHAIVEYGKQQGINLKDLAQFSAIP
    GHGIEANIEDKKVLVGTRKLMNEQSIEISQHEEVMKDLEYQGKTAMLVAIDGKLAGIIAVADTVKESSKAAIQTLKEIGI
    EVYMVTGDNKRTADAIAKLVDLDHVYAEVLPEDKAKIVEDLQKQGKRVAMVGDGINDAPALAKADIGMAIGTGADVAIET
    ADVTLVGGDLSHIPKAIELSRKTMKNIRQNLFWALFYNAIGIPVAAAGLLEPWVAGAAMAFSSVSVVTNALRLKRVKI

    >gi|218848428|ref|YP_002455163.1| hypothetical protein BCAH820_B0281 [Bacillus cereus AH820]
    MTITLNVQGMTCNHCKMSVTNALTELEGVQNVEVHLQEGTVNVEYDDTKVDVEKMKEVIEDQGYDVI

    >gi|218848277|ref|YP_002455189.1| hypothetical protein BCAH820_B0307 [Bacillus cereus AH820]
    MNITDKAKEFIENAMKENGVSTLRFTFEGAGCCGPSYGINLGEAEESDITETVNGVQVAMDPKVAEIVNTLTLDYVEDQQ
    GAGLVISGGSNCC

    >gi|218848384|ref|YP_002455202.1| disulfide bond formation protein C [Bacillus cereus AH820]
    MEWIRKYHIAIAWSIATSAMLISLFFSEWMKLPPCDLCWYQRMAMYPLVLILGIGMYRKDPHVSTYAFPFACIGLMLSVY
    QITIQAFPISEMKI
    CSVGVSCTEDYLNLFGFISIPMLSFVGFLAIIILIYIKSDRETKEQTT