Rhodomicrobium vannielii ATCC 17100 uid43247

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|312112809|ref|YP_004010405.1| transcriptional regulator, AraC family [Rhodomicrobium vannielii ATCC 17100]
    MTLAARPAFDRALWESDCWARLEQRQADADRAFVYGVVSTGIYCRPGCPSRLPRRENVRFFADAAAARRAGFRACLRCDP
    DGASRAEREAALVAKAVALIESAEGRPAFDAIARSCGMSRHHFHRMFKAATSMTPGSYFAAIKKRRALDSLGQGESVTTA
    IAAAGYGSPSRFYEGVADLGARPRALSRGGAGEHIRFTVAACSLGFVLVAATQKGICAIELGDGADALAADFRRRFARAC
    LAEDAAFSQAVADVVTLVEEPSRAFALPLDVRGTVFQEKIWRLLREIPPGETMTYGELAAKAGCPSAVRAVARACASNAI
    AVAIP
    CHRVVGKGGTLTGYRWGVERKAALLKREGR

    >gi|312112869|ref|YP_004010465.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodomicrobium vannielii ATCC 17100]
    MLQNGDLAPDFALPDAEGKTVTLNGLKAPYKVVYFYPKDNTSGCTTEARSFSDLKDAFDAAGAEVIGISPDSVKSHANFR
    DKHGLRVTLVSDQEKAAIEAFGVWVEKKMYGRAYMGVERATFLIGPDGKILKSWGKVKVPGHAAAVLDAVREAAGAS

    >gi|312112922|ref|YP_004010518.1| UBA/THIF-type NAD/FAD binding protein [Rhodomicrobium vannielii ATCC 17100]
    MTTLSPEEIERYKRHLLVKDIGGQGQQRLKAARVLIVGAGGLGSPLLMYLAAAGVGALGIIDDDRVSLGNLQRQVAYRTD
    DIGALKTDRAAALVHALNPHVEVEAMPFRLTAENALAVVSRYDIVADGSDNFATRYLVNDACYFAMKPLVFAALGQMEGY
    VSTFRAYEMDESGTPRPSYRDLFPEPPAPGEIPT
    CEEAGVLGPVAGVIGTLQAVEVVKSILGLEGTLVGRLLIYDALVGR
    FQTIALKWDANNPLTGLAPSIRDLSIHAADSEQRA

    >gi|312113036|ref|YP_004010632.1| electron transport protein SCO1/SenC [Rhodomicrobium vannielii ATCC 17100]
    MKRKSVIVIALAFLCAAGAALYAISHFSNAGSTATKPLIGGAFSLVDTNGKRVTDADFRGKLMLVFFGYTHCPDVCPTGL
    QQAADVLAKLGPDAGDVVPVFISVDPARDTPPVMKSYVENFDPRIVGLTGDPAEVASAAKAYRVYFRKSGSGEDYSVDHS
    AFVYLMDRHGKFITNFMFNAPIDVMVGELKKQIAAGTSRETVSPPTKS

    >gi|312113059|ref|YP_004010655.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium vannielii ATCC 17100]
    MTTEVNISVSERAANRIREIVGSAQGENALRISVQGGGCSGFSYNFEIVLEAAADDIVIEKSGARVVIDPVSVPFMAGSE
    IDFIDDLMGSSFKITNPNATASCGCGTSFSI

    >gi|312113103|ref|YP_004010699.1| glutaredoxin-like protein [Rhodomicrobium vannielii ATCC 17100]
    MSEDVQSWIKDQVTTNDVVLFMKGTKEFPQCGFSGRVSQILNFLGVPYQDINVLTDDGIRDGIKAYTNWPTIPQLYVKGE
    FIGGADIVSEMFQSGELQKVFADKGVPTSKAA

    >gi|312113145|ref|YP_004010741.1| thioredoxin [Rhodomicrobium vannielii ATCC 17100]
    MATTAVSDASFEQDVKNAELPVLVDFWAEWCGPCRTVGPILEELSEEFAGQLKVVKLDVESNPGIAQAYNIRGIPALLLF
    KNGEVAGQQIGALPKQQLRAWISGAIASV

    >gi|312113308|ref|YP_004010904.1| Glutathione S-transferase domain protein [Rhodomicrobium vannielii ATCC 17100]
    MPTTLIHFPLCPASRAIRVALFECGIEADLSEVKPWALARDFLNINPAGTLPVLMLDARAICGVYPVVEYLSESTPRETG
    AAARAQIWPGLPVERAEARRVADWFLTKFDAEVSQSLLDEKLYKPMARGRLAPDLPAIRACRSNLRYHLSYISFLSDQRK
    WLGGDHISFADVAAAAQLSVMDYLSEIPWTEFPEAKAWYQRLKSRPSFRSILADRIPGFSPPETYADLDF

    >gi|312113380|ref|YP_004010976.1| sulfur relay protein TusD/DsrE [Rhodomicrobium vannielii ATCC 17100]
    MQLAIVVNEGPYTHQASDTAYHFTKAALEKGHGITRVFFYHDGVNNGTRLTVPPQDDRNLQKLWSELGEKHGLDLVVCIA
    AAQRRGILDADEARRHGKDASNIAPGFRISGLGQLIEAGIDADRLVVFGD

    >gi|312113424|ref|YP_004011020.1| thioredoxin [Rhodomicrobium vannielii ATCC 17100]
    MAISLLGGGAAQPADNTSDIIKNTTTATFVADVIEASHKVPVIVDFWAQWCGPCKQLTPILEKVVRASKGKVRLVKMNID
    EHPEVAGQLQIQSIPAVFAFSQGQPVDGFMGALPESQVKAFVQRLIGPDADDAAGVEEAQRLFEEGDIAGAAQLYGAVLK
    NDRENADAIGGLSKCYVRLDDLARAEQVLSMTPPAKQTAEAYLSAKAALELAKKAEPSADTAPLEKAIAANPRDWDARFK
    LALALVAKGKREDALDHLFEIVRKDRAWNDDAARQQLVELFEAWGPKDPLTQAGRQRLSSILFA

    >gi|312113433|ref|YP_004011029.1| dihydrolipoamide dehydrogenase [Rhodomicrobium vannielii ATCC 17100]
    MVDAYDLIVIGSGPGGYVCAIRAAQLGLKTAIVEKNPTFGGTCLNVGCIPSKALLHASELYEEAGHGFAGMGIKVKPELD
    LAAMMKYKAEGIDGNVKGVEYLLKKNKIDTHRGTGRVAGAGKVSVTAADGAVETLATKAIVIATGSDIVRLPGIEIDEKR
    VVSSTGALDLDRVPEHLVVIGGGVIGLELGSVWRRLGAKVTVVEFLDRILPGMDNEVVKSFQRILEKQGVAFRVSQKVTG
    VKANGKGPLKVAVAPASGDGATEEFEASHVLVAVGRVPYTEGLGLEEAGVAIDNKRRIVVDDHFETNVPGIYAIGDVIRG
    PMLAHKAEDEGVAVAENLAGKAGHVNYGVIPGVIYTYPEVASVGKTEESLKAAGVEYTVGKFPFTANGRAKVNRQTEGFV
    KILADAKTDRVLGVHILGPDAGNMIAEAAVLMEFGGSAEDLARTCHAHPTLPEAVKEAALAVGKRAIHI

    >gi|312113473|ref|YP_004011069.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
    MENTEKLDCIVIGGGPAGLTAALYLARFERRFVVIDKGEPRAALIPESHNVPFFAQGIGGVEMLRRARDHAETYGARILS
    REATALASDGDGFTVGLRDANGGERTLRARFVLLASGVVDIPPRLADVDAAVLSGLVRY
    CPICDGYEAKGKRVGVIGRGA
    CGLGEAKFIARTWGADVTLLSLDEPLSPEHPKLSALAEHDIDFVPVPIRSLARSGDGIEALGYDGAVHRFDIVYSAIGCD
    YRSGLATALGAAVNEAGALKVAAHAETTVPGLYAAGDVTEGLNQIVVGMGQAARAATHIHNRC

    >gi|312113663|ref|YP_004011259.1| Rhodanese domain protein [Rhodomicrobium vannielii ATCC 17100]
    MPIQPVNAASLNTWLESGDAVLVDVREPQEYAAEHVAGATLVPLGTVCCAKLPDYTGKKLVIMCKLGGRGGKACEKLAGE
    LPPRAVVYNLDGGIEAWKKAGLPVERAPRRGFMNWLTGRG

    >gi|312113665|ref|YP_004011261.1| alkylhydroperoxidase like protein, AhpD family [Rhodomicrobium vannielii ATCC 17100]
    MEKDYAEITRAISANMKELRKGIPETMQGFSALAAAATKDGSLDKKTKELIALALGVAARCDGCIGFHSEALVRLGATRE
    EVLEVLGMAIYMGGGPSLMYAADAIGAYDQFAGKRSA

    >gi|312113820|ref|YP_004011416.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
    MMTLPRRLAAAFAFAASTAFLFAPHAAAAKDDPLSREAMYEDPDAPVSGNPKGDVTIVAFLDYNCPYCKKSVGDLKRIVK
    DDGKIRLIYKEWPILGNASKLASRLALAANYQGKYEAAHDALMRAVNHSSTKAQLVKALGNAGIDTPRLEADLAAHGKDI
    DRALARNDAQGDIVGFQGAPTYLIGPLVSSTLDYAGFKRAVADARTRQAAQ

    >gi|312113909|ref|YP_004011505.1| arsenate reductase-like protein [Rhodomicrobium vannielii ATCC 17100]
    MTISMYGIKNCSTVKKARTWLEERGVAYTFHDYKTAGADEALLRRFVKEHGWEALLNRAGTTFRKLPEADRENIDEEKAI
    ALMLANPSVIKRPVLDLGKKTLVGFKPEVYEAAVPATRA

    >gi|312113921|ref|YP_004011517.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodomicrobium vannielii ATCC 17100]
    MLGIGDKLPSFEVTGVKPGFNYHEENGVSAFEALTETSFPGKWKVIFFYPKDFTFVCPTEIAEFARLSSEFADRDAIVLG
    GSSDNEFCKLAWRRDHKDLHNLNLWQFADTTGSLIDGLGVRSDAGVAYRYTFVVDPENVIQHVYANNLNVGRNPSDTLRV
    LDALQTDELCPCNRAVGGDTLKAA

    >gi|312113923|ref|YP_004011519.1| periplasmic protein thiol/disulfide oxidoreductase DsbE [Rhodomicrobium vannielii ATCC 17100]
    MTDTPEKQTKPRRLVLPVVIVVAVLSLLYYQLRTGDPQSLPSVLIGKPVPDFQLAALPGAPSPTGLPVPGFSSDELKKGR
    VSLINVWASW
    CAPCQVEHPLITDLARQGIPVYGINYKGDTPEGAKRFLSRLGNPYKAVGVDDTGRVAIDFGVYGVPETFV
    IDGAGRIAYRHAGQLTEEVIAQKIKPAMEKAAKAPPQS

    >gi|312114094|ref|YP_004011690.1| dihydrolipoamide dehydrogenase [Rhodomicrobium vannielii ATCC 17100]
    MAEAFDVAVIGGGPGGYVAAIRAAQLGLKTVVIEREHLGGICLNWGCIPTKALLRTAEVLRLAQHGAEFGIKAEGLSFDL
    GKIVARSRAVANKLASGVAYLLKKHKVTVIDGTARLKAKGVVAVAGKDGKPLADVEAKHIIIATGARARVLPGLEPDGKL
    VWTYKEAMVPPSLPKSLLVVGSGAIGIEFASFYNALGVKVTVVEIVDKILPFEDDEISALARKSFEKQGMTIHTGAKVDK
    LEKGKDSVKATLALKDGRTQVAEFDRVIVAAGIVGNVEGIGLEELGIKTDRTHIVVDEFSRTNMPGVYAIGDVAGPPWLA
    HKASHEGIICVEKIAGRDPHPLNVRNIPGCTYSHPQVASIGITEAMAKKDGREIKVGRFPYQGNGKAIALGEPEGLVKTI
    FDAKTGELLGAHMVGAEVTELIQGFGVAKTLETTEAELMETVFPHPTLSETMLESVFDAYGRVIHI

    >gi|312114687|ref|YP_004012283.1| nitrogenase-associated protein [Rhodomicrobium vannielii ATCC 17100]
    MARVIFWEKPGCAGNARQKALLKASGHTLDVRSILDEAWDGERIRSFFGARPVAEWFNVSSPRVKSGEIVPATLEPEEAI
    ALMLADHLLIRRPLMEVDGRREAGFDAERVRAWIGLIYTAAPVTDTCVQETARAAGKPEPDCSTPD

    >gi|312114729|ref|YP_004012325.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium vannielii ATCC 17100]
    MIYLTEAAANAVRTAIKGANTPIEGLRLAVDAGGCAGFKYLMGLVADPNPEDIVVEERGVKVFVDRDSVQMLEGTTVDFV
    IGLQSSGFTFDNPQATASCSCGKSFG

    >gi|312114761|ref|YP_004012357.1| methionine-R-sulfoxide reductase [Rhodomicrobium vannielii ATCC 17100]
    MAERMTKSDAEWRAKLTPEQYKVTRQHGTERAASSPLNDEKREGVFACVCCGAPLFASDAKYDSGSGWPSFTAPVEKEAI
    TTHQDHSFMMNRTEVRCARCDAHLGHVFPDGPRPAGLRY
    CMNGVALDFKPSAAK

    >gi|312114814|ref|YP_004012410.1| hypothetical protein Rvan_2084 [Rhodomicrobium vannielii ATCC 17100]
    MSRIPPVDLETAPPDIRRRHDALIKTHALTNMKAVLLHSPVALDAVLEWYKLFDRVKPFLGEREAVLFCFAISRANACEL
    CTTFMRRAIIGWGEDPENLNLAPREQAIWDYGWQLAKDPNRIGDALYARLAAHFSPAEIVDLTVFGALMIVNNVFNSALR
    IDADESLDPYRIDPETYFS

    >gi|312114883|ref|YP_004012479.1| thioredoxin reductase [Rhodomicrobium vannielii ATCC 17100]
    MAARHHRVFIVGSGPAGYTAAIYAARAMLKPLLIEGMQPGGQLTTTTEVENYPGFAEPIQGPWLMEQMRAQALHVGAEIV
    QDLITSVDFSRLPLVLNGDSGTTYRAESVIISTGAQARWLGIPSEQHYRGYGVSA
    CATCDGFFYRGKDVLVIGGGNTAVE
    EALFLTKFAKSVTVAHRRDSFRAEKILQNRLFSNPKVKVLWNTVLNEVVGNDNPKAVTGARLRDTVTGEATLLPMDGIFI
    AIGHAPATEIFKGQLDTTSGGYLVTAAKSTATNVAGVFAAGDVTDDIYRQAVTAAGMGCMAALDAERYLASLETLAQAAE


    >gi|312114968|ref|YP_004012564.1| peptide methionine sulfoxide reductase [Rhodomicrobium vannielii ATCC 17100]
    MFSFSKKTKMPDAATALPGRDAPIPTTDTNIVNGAALKPPYPEGSEIAIFGLGCFWGAERRFWQIPGVIVTAVGYAGGFT
    PNPTYEEVCSGRTGHTEAVLVVFDPKKVSYGELLKAFWESHNPTQGMRQGNDVGTQYRSAIYTTNDEQEREALASKEAYQ
    QALSAKGHGAITTEIAPAGEFYFAEGYHQQYLAKNPGGYCGLGGTGVSCPVGIGETSPA

    >gi|312115055|ref|YP_004012651.1| glutathione-disulfide reductase [Rhodomicrobium vannielii ATCC 17100]
    MAINEAHANIAGAATTKKLMTFDYDLFVIGGGSGGVRSARLAAKLGVRTAIAEEYKFGGTCVVRGCVPKKLFVYASEFGR
    AIDDASGYGWTVEGKRFDWKALVAAKDKEIERLSGLYSGGVEAAGGTVFNSRAEVVGPHTVRLLAENRTVTAERILIATG
    GHPFLPDIPGIEHAITSNEAFHLEELPKKVVIVGGGYIAVEFAGIFNGLGVDVELVYRGGEILRGFDHDMREGLTSIMRQ
    HGVTITCNTEPAAIEKTDAGLIVATNRDTRIACDSVMFATGRRPNTVGLGLQSLGVKCGWNGRVMVNDSYQSSVPSIYAV
    GDVTDRVNLTPVAIRDGVAFIEAVYKNNPNPVDLAFLPTAVFSQPEIGTVGYTEEAAREMFCAVDIYKAAFRPMKNTLAG
    RPERTIMKLVVDADSDRVIGVHILGPDAAEIIQALAIAVKMGATKADFDNTIALHPTMAEELVTMREKWTPPATT

    >gi|312115120|ref|YP_004012716.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
    MPQLLTPDICVIGAGSGGLSAAAIAAAFGVSVVLIERGPMGGECLNTGCVPSKALLAAAKRAHQIRDAEKFGIRVGNPGI
    DHKAVAEHVAGVVAAIAPNDSVERFNGLGVDVIKASARFVDPDTVEAGDYQIKARRFVIATGSAPLIPPIPVLDRVPFFT
    NETIFQNTYRLPQLIILGGGPAGLELAQAHKRLGSEVTVVEAGKALSRDDDELRQYLLNRLRDEGIRVQENARVERIEPF
    GNNIRVVFANLGRTYSIEGTHLLLAVGRAPVVADLNLEAAGIDYSERGIQVTSGLRTSNKRVYAIGDVTGEVNLTHAANY
    HASIVIKNALFRLPAKADHSTIPWVTFTDPEVAHVGLTEDAARARYGKLAILRWPYAENDRAQAERETGGFVKVIASRRG
    KILGAGIVGAQAGELIQMWSLAMQKGISLKVMQSIVSPYPTLSEMNKRAALNYFAPSAQNPFLRRIIALLAKFR

    >gi|312115138|ref|YP_004012734.1| Redoxin domain protein [Rhodomicrobium vannielii ATCC 17100]
    METGNDDGGTRRQGFLIYGLAAAGALAVMAVGMVMERASNVPDEPRPAAVTVPTPVESGQFIRHAKPVTLPALSFNGADG
    KARFLSEWRGKIVLLNIWATW
    CPPCVREMPALDKLQAEKGGDGFAVVAVSTDRSGLAKPKAFYERVGIKSLALFNETSGD
    LSLALDADRLPLTIILDREGREVGRYFGAAEWDSAEVFAKVMAMAGATAGAARR

    >gi|312115384|ref|YP_004012980.1| hypothetical protein Rvan_2669 [Rhodomicrobium vannielii ATCC 17100]
    MALNRLSEETSPYLQQHKHNPVEWWPWCQEAFEEAQRLDKPVLLSVGYAACHWCHVMAHESFEKEDTAELMNRLFINIKV
    DREERPDVDTLYMTALQELGEQGGWPLTMFLTPDGMPFFGGTYFPDKSRFGKPSFKDVLVNVARVYAQEKETIAQNTAYL
    KQRLTPRLNYGAAPEFSEEQLAAIAAKFIGAIDPTNGGLRGAPKFPNTTIFQFLWRAGLRYNLKTCIEEVKNTLLHICQG
    GIYDHLGGGFSRYTVDERWLVPHFEKMLYDNALLIEFMTEVWKETQSDRLKTRVAETIGWLKRDMIVPGGAFAASYDADS
    EGEEGKFYVWTAREITDILGHGEEAAIFAQTYDVTEGGNWEGKTILNRLKALALLNGGEERAMDECRAKLFAERERRVKP
    GWDDKVLADWNGLAIRALARAGDAFAQPDWIVLAADAYGFVKSRMIENGRLFHSWRDGKLKGPATAADYANIISAALVLH
    QVTGEPRYLDDAVEWTAIMNRHYDAEQGGYYFAADDTSDLILRPLSASDDAVPNANATMLQNLADLYTLTGDAAYLKRAD
    GLLTAFQGAAQTMAIGYTGLLSGALTLISPQSIAIAGDRAGPDAAAWRRALAEVSLPGATVQWVNPDENLPASSPAFGKK
    AIDGKTTAYICFGPRCSEPITDPAILKDRLKEDRAVSVQVAASPV

    >gi|312115453|ref|YP_004013049.1| glutaredoxin 3 [Rhodomicrobium vannielii ATCC 17100]
    MQPVTIYTTPSCPYCRRAKALLGRKGVAFDEIDVSDRAKRAAMSDLVGGRTSVPQIFIGSRHIGGCDDLHALDAKGELDP
    LLQS

    >gi|312115591|ref|YP_004013187.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium vannielii ATCC 17100]
    MSSSFGKVVTLTDSAAERVKAIIGRSETPVVGLRVGIKKGGCAGMEYTMEYAAEARPLEEVVEDKGVRILIEPSAILYLL
    GTEMDYKTEKFVSGFVFKNPNQTSACGCGESVELSPAQTVGE

    >gi|312115629|ref|YP_004013225.1| heavy metal translocating P-type ATPase [Rhodomicrobium vannielii ATCC 17100]
    MARTIAADELGVEFKDAQREAGASPASSRAPSASRTITLAVENMHCGGCMRKVETALLGVPGVAAARANLSARRATVIFD
    RDAGSAAPLVDALEKAGFKAAELAPETVDNEKDNPARPLLARLAVAGFAAANIMLLSVSVWSGKGGGADDPTHALFHWLS
    AVIALPVVAYAGQPFFSSAWGVLKRGHVNMDVPISLAIWLSAIMSLYQTIRGTDQVYFDACVTLLFFLLIGRYLDQRVRM
    TARGAAENLIGLQSQWAHVIAPDGTIERLPSRLVEPGMRIAVAAGERFPADGVIASGMTTVDESLITGETTPRTAAANAI
    VYAGSVNLGAPVEMEARAAEADTLLAQIGRLMATAEQARGRYVRLADRAARFYAPMVHSLALASFIGWMIAGAGWEHSLT
    IAIAVLIITCPCALALAVPAVQVAASARLFDKGILLKAPDGLERLAETDVAVFDKTGTLTAGIPSLANGDAIDDATLKAA
    SALAAASRHPYAQAVVQAAKMRFGAVSASSGVEEKPGFGLRRATDGGEERLGSAAWCGVDDAQASSASLWFSRPGAAPVA
    FRFEDKLRDDAAATVDALTRAGYRVELLSGDRIDAVASAASAAHIADWHAGLKPDEKIALLDTLKAEGHRVLMVGDGLND
    APALAAAHASASPSTAADISQTASDAVFQGAKLAPVVELLATAKKARRMSFQNFAIAFGYNIVFVPLAIAGFVNPLVAAI
    AMSTSSILVTLNAVRLRTAKLELKA

    >gi|312115650|ref|YP_004013246.1| Rhodanese domain protein [Rhodomicrobium vannielii ATCC 17100]
    MTDFSSKWLVETDWLAERLGAPGLVVVDAGLTMPADARAANEVYNEAHIPGALYFDIEALSDTNSPYPHMLPSPEKFASR
    MRKAGIGDGMKVVVYDSKGLFSAPRAWWMFRVMGHEDVVVLNGGLKKWLAEGRPVEAGAPTPRSERHFTARKNSELVREI
    DDMIHIVEGGRTQIADARSKPRFEGAEVELRPVARLGHMPGARNVPYGSLIAPDGTLKPAAELRAAFEAAGIHPEKPVIT
    T
    CGSGVTACILALALAVTGNEHAAVYDGSWAEWSEVPKAPVTTGPA

    >gi|312115734|ref|YP_004013330.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
    MTLSSVARLVGAASFAALLAGCTSGVSLPAMPSMPSLPSLSLGADEAAQADADKPKSERVISAADLAEPGPLGDQVIGKG
    NAPVTVVEYLSLT
    CANSAKFQAETLPKLKKAYIDKGKVKLVLREYPIGKAAAATAVLSRCLPQKDYFKVVEKLLSTQQTW
    VAQEVKPDDIYNAVKFTGIKRDKFDECLTNQSINDALVLVKQRGRGFGVSGTPTFFVNGKKLAGAVSFEEMQPIIEAALA
    NPAASAPAAQQPQSQQHVSANPA

    >gi|312115735|ref|YP_004013331.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
    MSSKLKLSVFAPVAALALALGFSILIDGRFVSPAVAQDAAAQPALPDMALGKADAPVTIIEYSSLSCPHCAHFHSDVLPE
    LKKQFIDTGKVRYVQREFPLNDAGFAGSVLARCLDSSRFFAFNDLLFKKMDDWAFKQDALTPLKLYAKQAGLNDAEFNKC
    LADEDLQKKILAVRGLGEKQGVRGTPTFFINGKKFDGAPTIEAFAEAMKPYLGTQ

    >gi|312115738|ref|YP_004013334.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodomicrobium vannielii ATCC 17100]
    MSFLKQLAVLLASVAMTAAAYAAPEVGKPAPDFSATDSNGKTVKLSDYRGKTVVLEWTNDGCPYVQKHYSTNNIQSLQKD
    AAAKGVVWLSVISSAPGEQGAVSGAEANKLSEKRGAAPAAVLLDPEGKVGRAYDARTTPHMFIVNGDGTLVYQGGIDDKP
    TAVPSDVKAAKNYVRAALDDLAAGKPVATPVTRPYGCSVKYKHSS

    >gi|312115739|ref|YP_004013335.1| Protein-disulfide reductase [Rhodomicrobium vannielii ATCC 17100]
    MIHWKSKSVLGLLLACILLAGIASAEAAPIKHVEVDLLAEKTAVVPGETITIAVRERIEPEWHTYWLNPGDSGEPTSIAW
    SLPQGFEAGPIQWPLPDIIPIPPLVDYGYSGDLLLLTDIAVPKDIAGDSVTLAAKVNYLVCKDICVPEESEARLTLPVAA
    AGGGTPSDHAAAIEKARSTVPVPLPGSAAYSVNAAKGELRLTVSADASILNGATDARFFPLGWGAVSNSAPQTMAIEGGK
    LTLDMQQGETKETPDRLEGVLALTKGGERKGYVITATRGPDSAALGAPAKLAEGGASGGGGITEAAHKAAPSASGAVVGN
    GPASDEGAVTSVGLAILFAFLGGAILNLMPCVFPVLAIKALGFAKKSEGGHVQQGFAYLGGVLVCFAALAALLAVLREGS
    AAFGWGFQFQSPAFVLALAILFFVMGLSLSGVVSFGGGLMNAGDSLARKPGNAGYFFTGVLAAVAATPCTAPFMGAAIGY
    ALTQPTAVLAAVMLGLGLGFAAPVMLLSLSPGLQRILPKPGAWMETLKQVLAFPLYATAAWLVWVLSIQTGSDGVMAAAL
    AFVGVGFAAWLAGKTTYAPLRLKLIAPMLGVAAFAVSLSLAETAGSVNMATSAEKTALSGETFTKARLEGLIAEGKPVFV
    NLTAAW
    CITCKVNERVALKSDAVADAFAKRGITYLVGDWTSRNPEITDLLQTFGRAGVPLYLFYPGGGQEPRVLPQLLTV
    GLVLDETKTKAKLAGPSSNKGA

    >gi|312115956|ref|YP_004013552.1| Redoxin domain protein [Rhodomicrobium vannielii ATCC 17100]
    MTIAPGTHLPNAKFKIMTANGPADVSTDELFGGKKAVLFAVPGAFTPTCSLAHLPGFIEHADDFKAKGVDVVACTAVNDV
    FVLDAWAKSTGAGDKIVFLADGSGDFAKAIGLDLDAGGFGLGLRSKRYAMLLEDGVVKALHVEENPSVAEASSADRLLAD
    L

    >gi|312116107|ref|YP_004013703.1| DSBA oxidoreductase [Rhodomicrobium vannielii ATCC 17100]
    MKTIMKRAVALAVPAAMALSLSIAAPIAARAQTDTFTDGQTRSIEKIVKDYLVSHPEILLEVQDAFEKKAEAKRGEATRS
    RMPEFYKSLSGLKSELAPLTIGQGDVTLVEFFDYN
    CGYCRHALPEVVKLLDADKKVKVVFMEYPILSQGSADASKVALAA
    AKQGKYFEFHKAMFAAGRANKESALKVAEQIGLDMEKVKADSASPETEALVAKIGEIGKRMFVDGTPTFVVGDKVTPGAA
    DYDALKKVVEDTRKDGCKACAEAASAPGAKDEKKS

    >gi|312116125|ref|YP_004013721.1| iron-sulfur cluster assembly accessory protein [Rhodomicrobium vannielii ATCC 17100]
    MNLTVTPAAEKVIRRFLRFDGKPGSGFRLKVAPGGCSGLSAEFSVEAEPQPDDAVIEVNGLKLFLPEESRLLLEGVTIDF
    SDTPLQSGFVFRDPKQQASSCSSTAPVLFDITELKIQ

    >gi|312116214|ref|YP_004013810.1| arsenate reductase [Rhodomicrobium vannielii ATCC 17100]
    MSIVIYHNPACGTSRNTLAMIRQSGEEPEIIEYLETPPSREKLTELIAAMGISTRALLREKGTPYHDLGLDDPKWSDDEL
    IDVMLAHPILINRPIVVTPKGVKLCRPSEEVLEILPNPDIGPFTKEDGEVVTPRG

    >gi|312116216|ref|YP_004013812.1| Methyltransferase type 11 [Rhodomicrobium vannielii ATCC 17100]
    MSDTNVKEAVRERYGEAARRVSEGRSCCGGNAALEGSEPITSNLYDVSEKGMLPEAAVLASLGCGNPTALAQLAPGEIVL
    DLGSGGGIDVLLSARRVGPTGKAYGLDMTDDMLALARENQKQAGVENVEFLKGEIEAIPLPDNSVDVIISNCVINLSGDK
    DRVLREAFRVLKPGGRFAVSDIVTRGEIPDDIRKNVLAWAG
    CIAGALEEGEYAAKLAAAGFEAIGIEPTRLYRGEDAREF
    LSGKGIDVDAIAGQLDGKLMSAFVRAVKPKKSCCCA

    >gi|312116270|ref|YP_004013866.1| OsmC family protein [Rhodomicrobium vannielii ATCC 17100]
    MNADDLRALQAPLKDRYKAEPEAAIITLKARGDLDAESVVCRVDTGKALVEAGLHPATGGTGAFACSGNMLLDALVACAG
    VTLKAVATAIGFDLRGGVVSAEGDLDFRGTLGVAKDAPVGFRAIRLTFDLETSEPQERIDQLVKLTERYCVVYQTLARPA
    DLGLTVRTTAA

    >gi|312113670|ref|YP_004011266.1| HI0933 family protein [Rhodomicrobium vannielii ATCC 17100]
    MRQSTTDFDVIIIGAGAAGLMCALTAGQRGRRVLLLERTDKAGAKILISGGGRCNFTNLGIAPDRFVSGNPHFCVSALRR
    YTQWDFIDLVARHRIAYHEKTLGQLFCDGSARAIVAMLLEECERGEVTLRFGQSISSVSKPDGFRVETSSGVFTAPALVL
    ATGGLSIPKMGATGFSHDLARRFGLRVTETRPGLVPFKAKADAPGFDASLAGVSLEAIVSCGDRAFREAILFTHRGLSGP
    AILQISSYWRQGASIAIDLLPGLDAAGFLKERKRTRPRASGRAVLAEVLPARLAQALADAHLPPAEMANIPDRVLMALAE
    HLKGWRFTPPETEGFAKAEVTVGGIDTRDLSSKTMESREVKGLYAIGEAVDVTGWLGGYNFQWAWSSGWCAGQAV