Rhodoferax ferrireducens T118 uid58353

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|89898846|ref|YP_521317.1| heavy metal translocating P-type ATPase [Rhodoferax ferrireducens T118]
    MNTAAAPAISPGSLDIGIGGMTCASCVGRVERALKKVPGVQSVAVNLATESARIAYAPTEQMEARLRRAVRDAGYEPLAA
    DATIDAPDASPWAGFMPVAIGLALSAPLVLPMLGNLAGWHWMLPAWLQFALATPVQFILGARFYKAGWHALKNLAGNMDL
    LVALGTTAGWLLSMWLWLNAAPGVMAHLYFEGSAVVITMVLLGKWLEARAKRQTTSAIRALHGLRPATAHLISIDGEVDV
    PVAEVLVGDRLVVKPGERLPVDGLLQEGQTQVDESMLTGEPLPIVKDPGAALTGGSINGDGRIVMQVKAVGSETVLAHII
    RLVEDAQAAKAPIQRLVDQVSAVFVPVVLGIALITLLGWWLSGHPFEVAVINAVTVLVIACPCALGLATPAAIMAGTGVA
    AKYGILIKDAQALELAHKVDVVVFDKTGTLTVGQPRLTAFQAVAGGDEVTLLAAAASLQSGSEHPLARAVVAVASERGLA
    IHPPITVRAVPGRGTEGELRATDGNEAAQPSYLIGSLRWMDELGVDWRALAAPAATLQGSGATVSLLARRWVATAAQAER
    IEILALLAFADEPKPGAQAAVAALRARSIKTVMISGDNQGAARAMARRLGFRPESDEVRAEVLPGDKAAQVLALKNGGHT
    VAMVGDGVNDAPALTAADVGMAMANAGGGGSDVAMHAAGITLMRGDPGLVAAALDISDRTVAKIRQNLFWAFAYNVAGIP
    LAALGFLNPVVAGAAMAMSSVSVMSNALLLKRWKPRK

    >gi|89898861|ref|YP_521332.1| periplasmic protein thiol [Rhodoferax ferrireducens T118]
    MKKKLIPLGIFAVLVVFLAIGLTRDPHEIPSPLIGKAAPMFNAPLLQTPEQQFSAKDMLGQVWLLNTWASWCVACRQEHP
    ILMEFAKTKTLPIVGLDYKDQNPEGLKWLARFGNPYDHAITDKDGRIGIDFGVYGVPESFLIDKAGVIRYKQIGPVTEEA
    LRDKIVPLIRELQK

    >gi|89898889|ref|YP_521360.1| hypothetical protein Rfer_0067 [Rhodoferax ferrireducens T118]
    MTPAALPSPAAVLVVCLCAEWCGVCRDYRQRFAQVQTQFPGVRFLWIDVEDEAELLDPLDVEDFPTLLLAVGDRPHFFGP
    LTPQTDTLARLVRSLIEDSSSPALADPSLTALVARLRAAHPFL

    >gi|89898908|ref|YP_521379.1| thiol-disulfide isomerase-like protein [Rhodoferax ferrireducens T118]
    MKTVFSLILLCLVATTNLAAAKTPGEVEVGSVLREATMLGLSGPSRQLSQYRGKPLIINVWASWCGPCQQEMGSLERLAR
    SKTGQQVTLIGISTDDYPEAARAFLKRYPTSFSHYIDQQLLLENMLGAAQLPLTLLVDAQGRVLAKHVGAQQWDSPQALQ
    FIGKTLRLKP

    >gi|89898936|ref|YP_521407.1| DSBA oxidoreductase [Rhodoferax ferrireducens T118]
    MRLSTTTHQARIMSRPLKIDFVSDISCPWCAIGLSALEQALDRLQNEVAAELHFQPFELNPQMPAGGQDIGEHLAQKYGS
    TPEQQTQIRDTIRQRGAEVGFSFNPAGRGRIYNTFDAHRLLHWAGLETPSRQPALKKALLVACHSQGQNMESHEVLLAAV
    AQAGLDVARARAILASDEFAPEVREREAFYTSQGIHSVPTVIINDRHLISGGQPVAVFEQALRQIAANQPGD

    >gi|89898999|ref|YP_521470.1| dihydrolipoamide dehydrogenase [Rhodoferax ferrireducens T118]
    MLNDMKPIHVNVAVIGAGTAGMGAYRAARAHTDSVLLIEGDVYGTTCARVGCMPSKLLIAAAEAAHQARHTEAFGVQVKD
    ITIDGAAVMARVQRERNRFVGFVLETVEAIPPCDRLKAKVSFQDANTLVTEHGQLIHAQRVVIATGSIPMLPPVLKGLSA
    HLLTNESVFDLPTLPTSLAVFGPGILGMELAQAMSRLGVKVKVFGVGGGIAGIRDPAIRDYANKVLNEEFYLDASAQVKS
    VKEWAGGVEVHYLHRDGAWQTEPFEYVLAAAGRTPNLAGLVLENTGLQLNERGVPVFDRFTQQCGSSAIFIAGDASNDIP
    LLHEAADQGRIAGENAGRYPDIQPGLRRTPLAVVFTDPQIASVGFNLKQLNQQFKDRFAEGLVSFEDQGRSRVMLRNKGI
    LKVYGEHGSGLFLGAEMFGPAAEHTGHLLAWAAQQRMTVSGMLEMPFYHPVIEEGLRTALRDLNHKLRIGPPVIERCMDC
    GPGA

    >gi|89899016|ref|YP_521487.1| thioredoxin [Rhodoferax ferrireducens T118]
    MAGCGLSRKLIKLNFTYPQPELPPMMNVTIANFDAEVVAASMTVPVLVDFWAPWCGPCKVIGPLLEKLETAYAGRFKLVK
    IDSDQEQELSQAFGVRSIPTCVLMFQGKPVDGFMGALPEGEIKAFLDKHLPAGEVLEAEVTAETVSDAPDENDPDAIREA
    LQQAVLKNPDDEEARFNYVKRLLQEGRTDDAKVAFAPVIAKTALVRRFDSLQRWMDAIDFVADRADLTGAISGFDAKIAA
    NKRDFDARFGKAQSLIAAQDWTDAMDELLEILMRDKSWADDLARKTYIAILDIIEPPKVKVADGQIPPVDPVVASYRRRL
    SSVVLS

    >gi|89899115|ref|YP_521586.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodoferax ferrireducens T118]
    MTAHIVIIGAGQAGVQTAEALRAGGFAGAITLLGDEPHGPYHRPPLSKAWLAGDIGAEQLVMRAPEALARKNIALRTHTQ
    VNAIDRAARQVKLADGSALSYSGLVLATGSTPRRLPLPGGDAKGVLALRSRMDASAIAERMAM
    CIEQQLPVVVIGGGFIG
    LEVAATARKKGLRVTVLEAAPRLLGRVLAPLLSDWYAQLHRSHGVNLVLGAQITALEADRQGTVSGVRMADGTLHPAALV
    VVGIGVSANEQLARDAGLACERGIVVDACGRTSDPVIVAAGDCAARRLPDGSLLRLESVQNAIEQGKSVAAALLGQERPF
    TATPWFWSDQYDKKLQMAGLSGGADQWAVRGDMDSGSFSVYHLRAGQLLAVDSVNASRDHLQARKLLDAGVSPTPAQVGD
    AAFDLGTLLLK

    >gi|89899228|ref|YP_521699.1| DSBA oxidoreductase [Rhodoferax ferrireducens T118]
    MKQKSIFTLAAVLLIAAFIVGAFFYKNQKTEQAAQLAAKNQTALVRADAPSFGNADAPVHIVEFFDPACGTCREFYPLVK
    NLMAAHPGKIRLTMRYAPFHPGSDQVVKVMEAARKQGQFQQTLEALFASQTVWVQNHTAHVDLIWSPLGTLGLDMERVKS
    DMNSPEIARTIAQDLADAKTMNVTMTPEYFVNGKPLPSFGFEQLQTLVDEALVNTNTK

    >gi|89899274|ref|YP_521745.1| ArsR family transcriptional regulator [Rhodoferax ferrireducens T118]
    MNQRTLKDLLYEQVARIGKAVSSPKRLELLELLAQGEKTVDVMATELSADIKLISAHLKALRDARLVTSRRDGKYVVYRL
    TGGDVAGLLVTLREVAEEHLLELRLALDQMVADPARLASVGREALLEQARRGDVVVIDVRPLAEYEAAHLPFARSMPMAE
    IEKRLAELPFDKDIVAY
    CRGPFCLLSDEAVVLLAAKGYRVRKILDGVSEWQAAGLPVQASAGEPSQPRTGITPQEPVRKN
    FNPLQSTIKPGGQ

    >gi|89899275|ref|YP_521746.1| DsrE-like protein [Rhodoferax ferrireducens T118]
    MVKYLFILNDPPYGTERSYNGLRLARSLLKAGDAEVKLFLIGDAAACAKAGQKVPQGYYNLGDMLGMIERAGGAIGVCGS
    CIDARGISETDLVKGASRSSMDELAAWTQWSDKVLVF

    >gi|89899296|ref|YP_521767.1| glutathione peroxidase [Rhodoferax ferrireducens T118]
    MSPVYDFEALQINGQPVSLSQFKGRVMLIVNTASACGFTPQFAGLEELHETYGNKGLVVLGFPCNQFGAQDAGSNNEIAE
    FCQLNYGVSFPMMAKIDVNGAQAHPLYQWLTQEAPGLLGSKAIKWNFTKFLVGKDGQVLKRYAPTATPASLAKDIETALA
    A

    >gi|89899385|ref|YP_521856.1| OsmC-like protein [Rhodoferax ferrireducens T118]
    MVTKVEKVVYQAHATSTGGRDGSTRTSDGLLDIKLAVPKEMGGAGGGVNPEQLFAAGYSACFIGAMKFVAGTQKLAMPAN
    ASIDATVGIGQIPAGFGIEVQMVVHLPGMDRAVAQALIDKAHQV
    CPYSNATRGNIEVTLTLA

    >gi|89899462|ref|YP_521933.1| hypothetical protein Rfer_0651 [Rhodoferax ferrireducens T118]
    MRRRLEKRPTILPSHSAVPLMNTLSRVLTGLLLTLLSSLVVAQDLPTKFDPHRDAAKDVATAQSLAKATGRRVLVDVGGE
    W
    CAWCRMLDRLIASQPQIRALIDSHYVWVKVNYSPENKNTAVLSRWPKIRGYPYLLVLDGAGKLLHAQGVQGLETETEKE
    ADENYDPDRVMAFLNRYATATSVSAQHY

    >gi|89899535|ref|YP_522006.1| iron-sulfur cluster insertion protein ErpA [Rhodoferax ferrireducens T118]
    MSAVAETIQTEMPSPILFTDSAAAKVADLIAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEITNEDDTTMTKNGVSLLIDA
    MSYQYLVGAEIDYKEDLEGAQFVIKNPNATTTCGCGSSFS

    >gi|89899558|ref|YP_522029.1| cytochrome c biogenesis protein, transmembrane protein [Rhodoferax ferrireducens T118]
    MNCLKLPHRLIFATLFVAFCTITTGARGQNIPQSVVNTEQVRAELMVQAPDGADAGKSVWVGLQLTHLPEWHTYWKNPGD
    SGLPTTLQWTLPAGVTAGEIAWPLPKKIPLGNLTNYGYEGTVLLPVPLSISPAFKPSPQSSGLEIKLKATWLVCRLECVP
    QDGEFVLNVPVRGSTALNSAAFTASLKAQPAALEGDSRVAVDGKQLKLTVVGLPPTLRGKQLEFFPETPELIDPAATWSQ
    QWTKNGQGDVWTASVPLSGLRSESPALIPLVLVADVNGQRQGFRAQAQVLGNWPPVAGVAGSSPPGLAPALASTTAPTGP
    QVSFGLWAALLGALLGGMILNLMPCVFPVLAIKVMSFTRHAHDRRGHRISGLAYSAGVVLSFLALGALLIGLRSAGEQLG
    WGFQLQSPAVVAALAVLFTVMGLNLAGLFEFGRFLPNAVLTLEAKNPAVNAFLSGVLAVAIASPCTAPFMGASLGLALGL
    PPLQALLIFMTLGIGMALPYLAASLTPAVARWLPRPGAWMDTFRRAMAFPMFATVVWLVWVLGQQSGIDGAAALLALLLS
    LSLVLWSLTLTGRSRVVIATISIATLTLLTGAIGQNVIKMAGASRVASDSRWQLWAPGRVEQVLATGAPVFVDFSAAW
    CV
    TCQYNEKTTLANPEVLADFAANKVTLLRADWTQRDPAISAALAQLGRSGVPVYVLYQDGRAPVVLSEILSVQEVRSMLAK
    LKSS

    >gi|89899585|ref|YP_522056.1| DSBA oxidoreductase [Rhodoferax ferrireducens T118]
    MKRRDFSFTCGAALAASALVLPTARAQTTAPAQVQGKKPELGTDYLQLDKRAAVEAPAGKIEVVEFFWYSCPHCNAFEPT
    FDAWSKRVPKDVVVRRVPIAFRPDFAPQQRLFYALEAMGLLDQLHRKVFAAIHSEKQSLATGEAIVDWVAKQGVDKAKFL
    ESFNSFSVSTKTSRATQLQNAYKVEGVPALGVGGRFYTDGSLAKSMERSLQVVEFLIAQVRSGR

    >gi|89899749|ref|YP_522220.1| putative thioredoxin [Rhodoferax ferrireducens T118]
    MTMNEVYAGIEPARAEIDMLEGPTMLEFGSPSCGYCRAAQPLLASAFSDHPNVRRIKIADGSGRPLGRSFKVKLWPTLVF
    LSNGREIARLVRTGDAGAIRRALAQIESSPLA

    >gi|89899924|ref|YP_522395.1| thioredoxin [Rhodoferax ferrireducens T118]
    MTDSLHIICPHCHTTNRVRQVDLASAPDCGNCHKPLFVAHSVALDDSNFDRHINRCQIPVLVDFWAPWCGPCRQMAPAFE
    QAAAQLEPRFRLAKVNTEEAQALGARFNIRSIPTLALFSAGRELARQPGAMGAADIVRWALAQRL

    >gi|89899988|ref|YP_522459.1| putative thioredoxin [Rhodoferax ferrireducens T118]
    MSTPTPYLSETEAPARAEVDALPGLTLLEFGTDWCGHCRAAQPALAEVLPQHPQWRHLKVEDGPGRPLGRSYRVKLWPTL
    VLLHDGQEVARLVRPTQAAYISAALNIA

    >gi|89900006|ref|YP_522477.1| hypothetical protein Rfer_1211 [Rhodoferax ferrireducens T118]
    MTRAQSIVDATMQTDLTDQQIEHLKTTQAVLLLFGGPQCAVCQAIKPKLENLMTQRHPEIALVYVDCVTSSAICAQHGVF
    TLPVVQFYIEGRLYLERGRSFSLVELSDQIERLVLLWKAAAG

    >gi|89900070|ref|YP_522541.1| glutaredoxin-like protein [Rhodoferax ferrireducens T118]
    MSDTQQRIDDLVKNNEVLLFMKGNASFPQCGFSGRAIQILQACGVDPKTLKTVNVLEDEEIRAGIKDYSNWPTIPQLYIK
    GEFIGGADIMMEMYQNGELQQALAAKAS

    >gi|89900101|ref|YP_522572.1| UBA/THIF-type NAD/FAD binding protein [Rhodoferax ferrireducens T118]
    MTDEQLLRYSRHILLNEIGIEGQAQILSSHALIVGAGGLGSPVALYLGSAGVGHITVVDHDRVDMTNLQRQIAHTMERVG
    QPKVLSIQTAIAAINPDVQVTPIMLRADAALLDTLVAQADVVLDCSDNFATRHAINTACVKHRKPLVSGAAIRFDGQVCV
    YDPRDANSPCYACVFPPDNTFEETR
    CATMGVFAPLVGIIGSLQAAEALKLLSAVGNPLTGRLLMLDGRAMEFTEVRIARQ
    AGCPICGAAH

    >gi|89900104|ref|YP_522575.1| rhodanese-like protein [Rhodoferax ferrireducens T118]
    MKFILDNWMIMSVALASGAMLFWPVLKGASGGSLTAAGAVQLINREKAVVIDICEVNEFAAAHIVGAKNIPLGQLEEKLP
    TVVKNKTVPLILV
    CQSGARSKRAEAIAKKLGYAQAQSLAGGLGGWRAANLPLEKS

    >gi|89900105|ref|YP_522576.1| glutaredoxin GrxC [Rhodoferax ferrireducens T118]
    MSPMQTVKMYTTAVCPYCMQAKQILKAKGVAQIEEIRIDTDAQARAQMMEITGRRTVPQIFIGQTHVGGCDDLIALDARD
    GLLPMLNAA

    >gi|89900367|ref|YP_522838.1| thiol:disulfide interchange protein DsbC [Rhodoferax ferrireducens T118]
    MNERMNGQVKMKLAKSALLCATVLLALGVSAQEATIRKNLAERIPQLAKIDEVSKSPMSGLYEIRVNGTEIYYTDAEGNY
    LVQGNLIDTKQRRNLTEERVDKLTAIRFDALPFKDAFTIVRGNGKRKLAVFEDPN
    CGYCKRFERELQGVDNVTIHLFLYP
    ILSAESIEKSKHIWCAKDKGKAWQDWMVRDQLPKVASCDSAAITRNVEIGRKYKITGTPTLIFADGTRVPGAIGVADVEK
    YLTTAKN

    >gi|89900390|ref|YP_522861.1| hypothetical protein Rfer_1598 [Rhodoferax ferrireducens T118]
    MTIGKVVLSTLLVFGAMVSHALEVKPYSAAALAEAQKAGKPVALHFHADWCPTCRAQEKVLQGLKSEAGLDLTVLVASYD
    TEKDLKRRFNVRAQSTLVVLHGEKETYRVVGDTSPGGIRAALKSAL

    >gi|89900402|ref|YP_522873.1| radical SAM family protein [Rhodoferax ferrireducens T118]
    MHDTLPLLEKTRFPVIRRTHLETLQINLGYKCNQSCVHCHVNAGPNRTEMMDVATMALIPQVLAAREIGTLDLTGGAPEL
    HEGFRGLVRAARAQGVRVIDRCNLTVLFEPGQEGLAAFLAAQRVEVVASMPCYSAANVDKQRGDGVFDLSIAALQQLNAL
    GYGRQGSGLVLNLVYNPQGASLPPEQQKLQADYKRELLQHFSIVFNELFALTNMPIQRFGSTLVSKGTFDAYMDLLRSSF
    QEQNLPGVMCRSTVSVDWQGWLSDCDFNQQLGLPLGTSGLKRHLRDLLKTGLDEQTIRVAGHCFGCTAGQGSS
    CGGALEH


    >gi|89900403|ref|YP_522874.1| UbiE/COQ5 methyltransferase [Rhodoferax ferrireducens T118]
    MPIQTSTHNLVQDYYGHQLQGTADLKTSACCDASTMPEWLKPLLARVHPEVLSRYYGCGLVCPPLLEGCRVLDLGCGSGR
    DVYALAQLVGPEGEVVGVDMTDEQLAVARAHQAHHTEVFGYSNTRFLHGYIERLDELGLEPASFDVIVSNCVVNLSPDKD
    AVLAGVQRLLKPGGEFYFSDVYADRRVPPAVRNDPVLYGE
    CLGGALYWNDFIQLAQRHGFADPRLLEDRPLEITDPKLAA
    RTGNLRFFSATYRLFKLAALESACEDFGQAVIYQGSIPEHPGRFVLDKHHDMQTGKVFAV
    CGNTWHMLQGTRFAPHFNFI
    GNFDTHYGIFDGCGGNLPFGARSESSSGVCGLAACC

    >gi|89900404|ref|YP_522875.1| selenide, water dikinase [Rhodoferax ferrireducens T118]
    MQAPEQPILRDIVLVGGGHSHVGVLKSFGMQPVPGVRLTVICTDMHTPYSGMLPGYVAGHYDYDEVHIDLSRLAVFAGAR
    LYRDEVIGLDRVNRKVLCRNRPPVPYDVLSINIGSTPQLHGVPGALENAIAVKPITRFNERWLALLERVQRHPGTTTVAV
    VGAGAGGVELLLAMQWRLRHALRALGRNPDELVFHLFSSDANILPTHNLGVRRRFDAVLAERQVRVHRNAAVTQVTPGRL
    QTAAGEVIDTDEIVWVTRAGGAAWLRDTGLALDADGFIQVTDTLQTVTDPAVFAAGDIASMVNHPLEKAGVFAVRQGPPL
    AANLRLSVQGGTLKPYHPQRSWLALISTGDRYAVASRGWLGFAGAWVWRWKDWIDRRFMAKFQDLTPMDTHGTRAQPTSA
    GVAGTVQLTPEESLQAISAIAMRCGG
    CGAKVGATVLSRALSQLHPVQREDVIIGLSDPDDAAVVRVPAGKAMVHSVDFFR
    SFIDDPYLFGKVAANHALGDIWAMGAQAQSATAIATVPSGLESKVEDVLFQMMTGALEVLNEANCALVGGHTGEGKELAL
    GFAINGLIDDDPAQILRKNGMCPGDVLILTKPIGTGTLFAAHARLSAKGRWIDAALQSMVVSNQKGAQCLREFGATACTD
    LTGFGLLGHLVEMTRPSGVDAELDLGALPLLDGAQECVAAGIVSSLQSANVRLRRALRNQEAMVNHPRYPLIFDPQTAGG
    LLASVPADKAQACIAALRELGYSHTVAIGRVLPQGEALEPISLCA

    >gi|89900412|ref|YP_522883.1| pyridine nucleotide-disulphide oxidoreductase dimerisation protein [Rhodoferax ferrireducens T118]
    MKKLLILSAAALLVFGFFALDLNRYLTLDGMKASLGQFESQRAASPVVVGLVFFSVYVVVTAMSLPGAAILTLAAGALFG
    LSMGTLIVSFASSIGATLAFLASRYVLRDAIQRRFGDRLKVINEGMAKDGALYLFTLRLVPLFPFFLVNLLMGLTPVRTL
    SYYWVSQVGMLAGTLVYVNAGTQLAQINSLVGIVSPGLLLSFALLGVFPMLAKMFMRLLQGRRVYAKWQRPKKFDRNLVV
    IGGGAAGLVTSYIAAAVKAKVTLVEAHRMGGD
    CLNYGCVPSKALIKSARIANQMRHAESYGLSAAEPQFSFRKVMARVHE
    VIRTVEPHDSVARYTELGVEVLEGYARIVDPWTVEIKLNNGGMQRLTTRSIVIAAGASPFVPPLPGLADVGYVTSDTLWD
    EFAKLDAAPKRLVVLGGGPIGCELAQSFARLGSKVTQIEMAPRIMIREDLEVSDLARDSLRRDGIDVLTGHKALRCEREG
    TRKFIVAEHQGKEIRIEFDALLCAVGRVARLQGYGLEELGIPTQRTVAVNDYLETLYPNIYAAGDVAGPYQFTHTAGHMA
    WYAAVNALFGDFKRFKVDYSVVPWATFIQPEVARVGLNEQDAKEKGIAHEVTKYGLDDLDRAIADGTAYGFVKVLTVPGK
    DRILGVTIVGEHAGDLLAEFVLATKHGLGLNKILGTIHTYPTLAEANKYVAGEWKRAHAPQKVLALLARFHAWKRG

    >gi|89900480|ref|YP_522951.1| electron transport protein SCO1/SenC [Rhodoferax ferrireducens T118]
    MNKRNALKLIAIYALLTGAIGLIPACSKQGPSFAGIDLTGADYAKDFALTDHNGQPRTLKDFAGKVVVMFFGYVQCPDVC
    PTSMAELAEVKRLLGKDGERVQGLFVTVDPARDTPEVLKGYMAAFDPTFLALYTTPEKLAVLAKDYKVYYKKVEGPTPTS
    YSMDHSAGSFVYDTQGKLRLYNRYGSGAALLAADIKLLLQQ

    >gi|89900494|ref|YP_522965.1| methylated-DNA--protein-cysteine methyltransferase [Rhodoferax ferrireducens T118]
    MPTQAYALFPTPIGHCGIAWSERGLTGVQLPEQDEAATRARMDRRFPQCSEAIAPPQVQEAIDAVMALLSGALQAPVDLM
    NVVLDMDGVPPFHQRVYELARRLLPGETVTYGDIARQLGDPGAARAVGQALGANPFAPVVP
    CHRVLAADGRAGGFSAHGN
    VTTKLRLLLIEHAQFNGPGLFDDPVDAQLS

    >gi|89900600|ref|YP_523071.1| protein of unknown function DUF395, YeeE/YedE [Rhodoferax ferrireducens T118]
    MNLSLSLFPLGWQHYLLGGLIIGSGAALLFVLTGRIGGMSTVFSSSWSYLVQRPFFQQGRFVDSRGWRLAYALGLILGAL
    VWWLGFAGGVREATAVPAWQLLVGGFFVGYGARLGNG
    CTSGHGICGLGSLQWPSLLAVLTFMATAFLTANMAARWLA

    >gi|89900645|ref|YP_523116.1| HesB/YadR/YfhF [Rhodoferax ferrireducens T118]
    MTITLTPAAAKQIRSQIAKRGSGLGLRVGVKSVGCSGFAYTYELADEVRAGEQRFDAHGATLLIAPQNLLTLDGACLDFV
    TEGLKQSFQFDNPNVGTTCGCGESFSLKAGAGKGVAA

    >gi|89900695|ref|YP_523166.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodoferax ferrireducens T118]
    MTHPCYTRLRTMAIIVNKPLPEFESTATGGVRVSNTSHLGKVVVLYFYPKDNTPGCTTEAMQFRDRYQDFVKAGATVFGV
    SRDNMRSHDEFKAKLELPFELIADTEEKMCHMFGVVKNKIMYGKKVKGIERSTFLIGADGTLKEEWRGLKVPGHVDDVLK
    AVKAQKKVAVPA

    >gi|89900713|ref|YP_523184.1| heavy metal translocating P-type ATPase [Rhodoferax ferrireducens T118]
    MSIASPAVAVAAPPVPINPDDSSPAQAPGSEAAVERLRLLDDPQEWSAFSRPDVKRANYWESNILIEGMHCAACALTLED
    ALLGVPGVVTADVSAGSHRARVVWSADAVRPSDWMGAVQAAGYRAVPANDAFARERRKTEARKALWRLLVAGLCMMQVMM
    YAYPAYVAEPGDLTAEMEQLLRWASWVLTLPVVLFSCGPFFGSAMRDVLHRRISMDLPVALGMLITFAVSTAGTFEPLGI
    FGREVYFDSLTMFVFFLLSGRWLELRLRDRTAGALEVLMNRLPDSVARRAGDGTYERVPVRRLVAGDVMRILPGETFPAD
    GVVLQGETTVDEALLTGESRPVARGVGAAVIAGSHNLSTVVQVRVERLGHQTRFAQIVALMESASTTKPPIARLADRIAK
    PFLLAVLLAAGLAAAFWWGRGPGHALMVAVAVLVVTCPCALSLATPAAMLAAAGTLARRGVLVRRLEAFEALAAIDTVVF
    DKTGTLTRDAMVLGDVQTRAGVAPEQALAMAATLAHYSLHPVSRALVLAAVGAASSAPWQAEGVRELAGAGVSGRVRSDS
    AGGAPIELRLGSADFCGVEIARPDTLQACLSDAQGWLATFEFHEDLRSDAIATVAALQGAGIAVHLLSGDSLSAAARVAA
    QVGITAFKGACSPQDKLDFLRSAQQQGHRVAVVGDGLNDGPVLAGAHVSFAFGQAVPLAQAQADFIVLGDQIGAVAQALS
    LARRTLRVVRQNLWWAAGYNAVCVPLAMVGWMPAWLAGLGMGMSSLLVVLNALRLSYGAKPAKTPLPCHDLAGVQ

    >gi|89900888|ref|YP_523359.1| disulphide bond formation protein DsbB [Rhodoferax ferrireducens T118]
    MSFQVVTGWLDNSPRRIFAFVSLASIGMLAFGQYLQHVVGLEPCPMCIVQRYALVLVAIIAGLTGASGRKGLHLGGAVLM
    LGSSGFGAYVAARQSWLQWYPPEVVS
    CGRDFYGMIETFPLQRAIPMIFKGSGDCSKVDWTFLGGSIANWTFVVFGLIVLL
    SLALIWRRVSRRVS

    >gi|89900963|ref|YP_523434.1| iron-sulfur cluster assembly protein IscA [Rhodoferax ferrireducens T118]
    MAVTLTEAAARHVTRYLAKRGRGVGVRLGVKTTGCSGLAYKLEYVDEIEPEDMVFEDFGVKVLIEPKSFAYLDGTELDFV
    REGLNEGFKFNNPRERDRCGCGESFRV

    >gi|89900991|ref|YP_523462.1| hypothetical protein Rfer_2207 [Rhodoferax ferrireducens T118]
    MKNSIHQVNPKTWGATAAIGAALLLAVGLAQAQTIYRVVGADGKVTFSDKPPVAAANVSTTEAGGKAMSAGGPALPFELR
    QVVSKYPVTLYTSSN
    CAPCGSGRALLSSRGIPFTEKTVNTAEDSDALQRISGENSLPFLTIGGQQIKGFSDSEWTQFLNA
    AGYPKASVLPSAYRNPATTPLVVVQKPVPTAKAEENQNQPQSPAPGQAPVDSPSNPAGIKF

    >gi|89900998|ref|YP_523469.1| dihydrolipoamide dehydrogenase [Rhodoferax ferrireducens T118]
    MALIDIKVPNIGDFAEVTVIELLVKPGDTVRAEQSLITVESDKASMEIPCSHAGVVKELKVALGDKVSEGSVLLVLEAAE
    APVVPDIKPNQAVAPVASTQAATQTVASPAVSAPIPVATAASYAGGVDLDCDLLVLGGGPGGYSAAFRAADLGLKVILVE
    RYAQLGGV
    CLNVGCIPSKALLHVAAVIDEVSHMAALGVDFGAPTVSVDKLRAHKEKVVTKLTGGLAAMAKMRKVTVVRGY
    GAFVGANHVQVEETTGTSQEKTGKTQTIAFKKCIIAAGSQAVRLPFMPDDPRVVDSTGALALKEVPKRMLILGGGIIGLE
    MGTVYSTLGARLDVVEMLDGLMQGADRDLVKIWQKMNAPRFDNIMLKTKTVGARATPEGIEVTFAAAEEGVKVPEPQTYD
    LVLQAVGRTPNGKKIAAEKAGVAVTDRGFINVDIQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEVIAGELQGNKEL
    ASAAFNARVIPSVAYTDPEVAWVGLTEDQAKAQGIKVKKGLFPWTASGRAIANGRDEGVTKLLFDDSEDAHGHGKILGGG
    MVGTHAGDMIGEIALAIEMGADAIDIGKTIHPHPTLGESIGMAAEVAHGSCTDLPPARK

    >gi|89901006|ref|YP_523477.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodoferax ferrireducens T118]
    MNFVIIGAGSAGVRAAETLRENDPQASITLVSGEPGEPYSRMAIPYILNGAIDENGAHQRQSHHHLESLGIRYLNCKALQ
    LHAGPDGGHVDLDDGSQLNYDRLLVATGSSPSLPPIPGTDLPGAVT
    CWTLEDARQIAAKLVPGARVVMLGAGFVAGVCMK
    SLVNSGAQLSVVAGRSGQILRSMMTPVGSHLLQRWLEGRGVEVITSGRTLRIEPGPRLVMDTRTIDADLIILATGVHPNV
    AFLEGTGAEIRSGVVIDEHMRTTVPHVYAAGDVAEGRDFSTGEWVVHALQPTATEHGRIAALNMTGKEVAYRGSLSMNVL
    DSVGLISHTFGLWQGIPTGDNTEVVDEANFIYTRLCFDSDQLIGAITIGHPHHVGAIRGLIQSRRHLGAWKDQLMKNPQL
    VMDALVDLNRG

    >gi|89901016|ref|YP_523487.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodoferax ferrireducens T118]
    MSLINTEVKPFAATAFHNGQFVPVSNESLKGKWSVVVFYPADFTFVCPTELEDLADNYATFQKLGVEVYSVSTDTHFAHK
    AWHDTSPAIKKVNYVMVGDPTGAITRNFDVMIEEEGLALRGTFVINPDGVIKLCEIHDNGIGRDASELLRKVKAAQYVAS
    NPGEVCPAKWHEGAKTLTPSLDLVGKI

    >gi|89901034|ref|YP_523505.1| putative thiol:disulfide interchange protein [Rhodoferax ferrireducens T118]
    MLTLNLGSLPVPIALLLLAVALLVAAGVGRLVGRDQQIGIGNVLGDMLWAALLVARIAFVAAWFDLYRKAPWSMLDIRDG
    GFTLWAGLLAALGVAIWRGWRRPALRKPLIWGVAAGVLAWGGMFGAIQTMNNAALPQVALTTLAGDSADLAALAAGKPMV
    VNLWATW
    CPPCRREMPVLAAAQKQETGVSFVFVNQGEEGSTAQRYLNSEKLDLANVLLDPGARLGREVGSGSLPTTLFYD
    TNGRLVDTHLGQLSAASLASKLSKIRTPQKP

    >gi|89901097|ref|YP_523568.1| dihydrolipoamide dehydrogenase [Rhodoferax ferrireducens T118]
    MSKQFDVIVIGAGPGGYIAAIRAAQLGKNVACVDEWKNSKGGPALGGTCTNTGCIPSKALLQSSEHFDHASHHFAEHGIE
    VKGVSMDAAKMVARKDAVVKQNNDGILYLFKKNKVSFFHGRASFVKAVEGGYEIKVAGAAEETLLGQQVIVATGSSARAL
    PGAPFDESQVLSNEGALAMTAVPKKLGLIGSGVIGLEMGSVWRRLGSEVTILEGLPAFLGVVDAQIAKEAHKAFVKQGLK
    IELGVTVGDVKVGKKGVSVAWTNAKGEAQKLDVDKLIVSIGRVPNTVGLNAEAVGLQLDERGAIVVDGDCKTNLPGVWAV
    GDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFNTIPWVIYTSPEIAWVGRTEQQLKADGVAYRAGTFPFLANGRARALG
    DTTGMVKMLADATTDEILGVHIVGPMASELIAECVVAMEFRASSEDIARICHAHPTLSESTKEAALAVDKRTLNF

    >gi|89901156|ref|YP_523627.1| glutaredoxin family protein [Rhodoferax ferrireducens T118]
    MKFFIRTFFKTLRLVLGPVMLLRERLTRPVGAARPPAVQAQVDQQCGSLVLYQFTTCPFCIKVRQEMRRLSLDIERRDAQ
    HDVKNREDLGRQGGQVKVPCLKIDNSTGESQWLYESGAIISYLRGRFAAA

    >gi|89901172|ref|YP_523643.1| hypothetical protein Rfer_2395 [Rhodoferax ferrireducens T118]
    MTVATQNLTALDVGLAWRNSFAQLGKSFYTPLAPWPLPAPYWVGRSTSTARELGLSESWLDSPELLQVLTGNQPMAGTQP
    LASVYSGHQFGQWAGQLGDGRAILLGETGGLEVQLKGSGLTPYSRMGDGRAVLRSSIREFLCSEAMQGLGIATSRALCVV
    GSDAPIRRETVETAAVVTRVAPSFIRFGHFEHFSHHDQHAQLKVLADYVIDRFYPECRASDKFAGNPYAALLEAVSERTA
    ALVAQWQAVGFCHGVLNTDNMSILGLTIDYGPFQFLDAFNPGHVCNHSDQEGRYAFDKQPNIAYWNLFCLGQALLPLIGE
    QELAIAALESYKTVFPAAFERLMFAKLGLLDASDSTATVDRALLQDILQLLAREQVDYTIFWRRLSHCGVATDAQTVRDL
    FVDRSAADAWLLRYSERLEHIPQGLAADLMLKTNPKFVLRNYLGEQAIQAAKLKDFSQVETLLMLLESPFEEHPGFDKYA
    DFPPDWASSIEIS
    CSS

    >gi|89901173|ref|YP_523644.1| protein-methionine-S-oxide reductase [Rhodoferax ferrireducens T118]
    MTYKIEKTDAQWQALLAAKGAEPLAFEVTRHEATERAYTGRLEGNQAAGIYSCICCDKPLFDSSTKFESHCGWPSYFQPI
    DEAAVATKMDGRMGMQRTEVHCPDCGAHLGHVFQDGPAPTGLRY
    CMNSASLKFTPHENTD

    >gi|89901239|ref|YP_523710.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodoferax ferrireducens T118]
    MRNHQDPIETDAVIVGAGPVGLFQVFELGLLEIKAHVVDSLAYPGGQCIELYPDKPIYDIPAVPVCTGRELTQNLLKQIA
    PFGATFHYGQEVTVVEKQSDGRFFVETSKGTRFLSKTIFIAAGVGAFQPRTLKVDGLEVFEDSQLFYRVRNPADFADKNL
    VIVGGGDSALDWALDFVKDGPNKAASVILIHRRDGFKAAPASVAKMRELCDALEMQFIVGQVTGFEAQDSLLTGIKVTGA
    DGVTRVVPLDVLLVFFGLSPKLGPIAEWGLDIERKQLKVDTEKFSTSEPGIFAVGDINIYPGKKKLILSGFHECALAAFG
    AMPIISPEKKVFLQYTTTSPKLHKVLGVESPVFD

    >gi|89901374|ref|YP_523845.1| peptide methionine sulfoxide reductase [Rhodoferax ferrireducens T118]
    MSKPLQTITLGGGCFWCLESVYVHVKGVTDVESGYSNGHVVQPDYEQVCSGDTGHAEVVKLVFDPAQISLREILEIFFVI
    HDPTTPNRQGNDSGTQYRSGIYFSTPQQAQVAKDLIAEMRQSGVYQQPIVTEVLPLANYWPAEEYHQDFFAKNPHQGYCL
    AVAAPKVAKFRKTFARLVAD

    >gi|89901379|ref|YP_523850.1| rhodanese-like protein [Rhodoferax ferrireducens T118]
    MIDQVRPSELATWLATARGHGAPVVLDVREPSELRTASIQADGFELITIPMGVIPPRLSELDPEQPIACLCHHGARSMQV
    AAFLKARGFKHVANIAGGINAWSAEVDPSIPRY

    >gi|89901399|ref|YP_523870.1| periplasmic binding protein [Rhodoferax ferrireducens T118]
    MNQVTSSLASASAQKPSWACRPAGPQRIVCMTEETTEWLYLLGQEHRIVGISGYTVRPRRARDEKPRVSAFTSAKMDKIL
    ALQPD
    CVLGFSDMQADIASSLIRAGVPVTIFNQRSVVEIFSVLYQVAAMVGQGEQGLALIAEMQRQLSVIADAAAALPRR
    PKIYFEEWDVPHISAIQWVSELIGIAGGDDCFPELAAQSMGKNRIIADGAEIVRRNPDIIIGSWCGKKFRPENVAARAGW
    GEVNAVKTGQLFEIKSADILQPGPAALTDGVAQLHRIVMDWSRQSGGAEKLA

    >gi|89901463|ref|YP_523934.1| hypothetical protein Rfer_2687 [Rhodoferax ferrireducens T118]
    MRGMNTLATPSSSNAPVTVFGIPNCDTVKKARAWLTGQGVSHEFHDFKKLGVPVDQLPRWIAAIGWEPLLNRKGTTWRKL
    DEDSRAAVVGAVSASALMLAHPSVIKRPVVVWRDGRVTVGFDAASFSAHLP

    >gi|89901615|ref|YP_524086.1| selenophosphate synthetase [Rhodoferax ferrireducens T118]
    MKLQQEKNLTTSLTPSPATTPPKQPRLTSLSHGGGCGCKIAPGVLSEILKGITAMPIPKELMVGIETADDAAVYRLNDEQ
    ALIATTDFFMPIVDDPFDFGRIAATNAISDVYAMGGKPILALALVGMPINVLSTETIAKILEGGASVCRAAGIPIAGGHT
    IDSVEPIYGLVALGLVHPSRVKRNADAQVGDRLILGKPLGVGILSAALKKEKLDGPGYAQMIAVTTQLNTPGPELAALSG
    VHAMTDVTGFGLAGHALELARGAHCTVQIDWARVPLLAGVRELALQGIVTGASGRNWTAYGQEIALPTGFAEVDQALLSD
    PQTSGGLLVSCAPAAVDAVLAIFRQHGFDAACEIGEITAGAGTPKLQLR

    >gi|89901620|ref|YP_524091.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Rhodoferax ferrireducens T118]
    MTHHVILGAGPAGVIAAETIRKLSAQDSITVIGDEPEPSYSRMAIPYLLMGNIDERGTYLRKSPTHFEDLKIKVLQARVQ
    SVQSATKTIAFTSGETLSYDTLLIATGSHPVSPPIPGIQSEGVHT
    CWTLADARAICLRAKPGARVLQLGAGFIGCIIMEA
    LTARGVHLSVVEMGDRMVPRMMGPTAGGMIRDWCESKGVEVFTGTRVESIEPGTPLNVKLSNGTTMQADLVISAAGVRPA
    IGFLEHSGITCLLGVLTDEHLQTNVPGVFAAGDCAEAFDKVSGKTMVSAIQPNAAEQARIAAANMVAFAQGRPAQADLSG
    VTQINVLDTLGLISASFGDWQGTPGCDHVELTDKASGRHLSLRFQDDVMVGCNAVGWTEHIGVMRGLVEGQIKLGAWKDK
    LMQDPTRLVEAYQASALGQGDWSGADARKR

    >gi|89901651|ref|YP_524122.1| 3-mercaptopyruvate sulfurtransferase [Rhodoferax ferrireducens T118]
    MYSTLISVPQLQSLLASGQPVMVFDCSFELMQPEAGDAQYSQAHIPGAVRADLDRHLSAKGALEAASGGRHPLPSRESFA
    AWLGSIGFDNRMQAVVYDRQSVNYCGRLWWLLKWVGHENVAVLDGGWQAWLAGGGATQGGPCERTKAKTSKSNYALAPAN
    TALVTTETVAKQLGRPTQTLLDARGAPRFRGEVEPLDPVAGHIPGALNRAFNLNLDASGKFKAAAELRAEFEALLAGRDP
    ATVVHH
    CGSGVSAVPNIIAMEVAGLGRTALYAGSWSEWCSDPARPMAQG

    >gi|89901669|ref|YP_524140.1| thioredoxin [Rhodoferax ferrireducens T118]
    MQGLGFCHNFSTLPVPTIYQGILMASELIKHVSDASFEADVLQSTQPVLVDYWAEWCGPCKMIAPILEEIATSYEGKLQI
    AKMNVDENRDIPAKFGIRGIPTLMLFKDGQLAATKVGAMSKSQMTAFIDQQLA

    >gi|89901738|ref|YP_524209.1| glutathione S-transferase-like [Rhodoferax ferrireducens T118]
    MMVLYSGTTCPFSHRCRFVLFEKGMDFEIRDVDLYNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PGDPVDRARVRLFLLNFEKELFVHVSTLESRAAKSNEKMLEKARAHIRDRLTQLAPVFLKNKYMLGDGFSMLDVAIAPLL
    WRLDYYGIDLSKNAAPLLKYAERIFSRPAYIEALTPSEKVMRK

    >gi|89901772|ref|YP_524243.1| methylated-DNA--protein-cysteine methyltransferase [Rhodoferax ferrireducens T118]
    MKFAPSTVQASYDSPLGRIILAAAHDRLTGVWFDGQSHQPDTARWPVDRDLPVLQQAKTQLSAYFAGRRQAFELALDLSA
    GTDFQQSVWRALLQIPFGATLSYGALSASIGKPAAVRAVAGAVARNPLSIIVP
    CHRVLGAGASLTGYAGGLPRKTALLQL
    EGASFKPEPNQPQEATP

    >gi|89901774|ref|YP_524245.1| hypothetical protein Rfer_3003 [Rhodoferax ferrireducens T118]
    MNTPRYPMPELKDLPEDIRVKVLEVQEKAGFVPNVFLALARRPAEWRAFFAYHDALMLKDSGLTKGDREMIVTTTSAANK
    CLY
    CVVAHGAILRIYEKKPLVADQVAVNYRKADITPRQRAMLDFAMKVCLHSDELGEADFAALQAHGFSDEDAWDIAAIT
    AFFGLSNRMASFSNMLPNPEFYAMGRTPKTK

    >gi|89901914|ref|YP_524385.1| carboxymuconolactone decarboxylase [Rhodoferax ferrireducens T118]
    MRKNRPELINRNLLENIMRDLSPRDLELVALGAAMGSNCPPCMEYHIPQSRKAGLSDAEIHAAILHADKIRQVPARKTLQ
    TALAMLPAVALEAGSAEPVPACGCAQDDNAPSAAASSRAQPAGGMAAMMSKMMASCGTLAPSACHAHPSGEEDAGKPAAN
    AAGACC

    >gi|89901948|ref|YP_524419.1| thioredoxin reductase [Rhodoferax ferrireducens T118]
    MSTTTHAKVLILGSGPAGYTAAIYAARANLKPLLITGIAQGGQLMTTTEVDNWPADVDGVQGPDLMQRFLAHAERFKTEI
    VFDHINTVDFSKRPFTLKGDSGEYTCDALVLATGASAQYLGLASETAFMGRGVSG
    CATCDGFFYRDQDVCVVGGGNTAVE
    EALYLSNIASKVYLIHRRDKFRAEPILIDKLMEKVGSGKIVLKTSNTLDEVLGDASGVTGVRLKNASTGSTEELRLQGCF
    IAIGHTPNTEIFKGQLDMEGGYIITQGGNKGFATQTSVPGIFAAGDVQDHVYRQAITSAGTGCMAALDAQRFLEQE

    >gi|89902123|ref|YP_524594.1| putative thioredoxin-related transmembrane protein [Rhodoferax ferrireducens T118]
    MIESPLSSELAENRSRTRRRWLMGAVAGAAALGGVGLAWRTYAPQTMPPAADSGLWQLEFPGLDGGVFSMASLRGKPVLL
    NFWATW
    CPPCVEELPLLSSFYQEHSAKGWQMLGLAVDQLEPVKRFLVKTPVTFPVVLAGVPGVELSKSLGNLSGGLPFTV
    VLGSDGVVAHRKIGQVSPANLLAWATLK

    >gi|89902158|ref|YP_524629.1| alkylhydroperoxidase [Rhodoferax ferrireducens T118]
    MSAQPILHTLHPVNPATAEGAQKEILDKAVKQVGFLPNMYANMANTPAVLSTYLHGYALFRSESGLKPAEQEVVFLAVSQ
    VNGCNY
    CTAAHSMMADKKSGVPADVLQAIRAHQPIPSARFAALYALTAEMVSTQGRPGAATVKAFLDAGFQEKDVLYIVL
    AIAVKTLSNYTNHALATPVDEVFSAYRVD

    >gi|89902391|ref|YP_524862.1| alkylhydroperoxidase [Rhodoferax ferrireducens T118]
    MSTFDHAGLIQDINEGLAPFRKTQAEVMQSFGQMARAAMAEGVISAKNKELMALAIGITQGCSGCIGFHVKALHKLNCTR
    AELEEMLSVCVYMGGGPALMHAAEALKAWESMAPAASISQP

    >gi|89902393|ref|YP_524864.1| rhodanese-like protein [Rhodoferax ferrireducens T118]
    MKRLILAVALVATTLSAAISWNAHAAEQQLEANEVANEQMVSYFEQGMIGKSVWVVDSRPAGKYSAGHIPGALSLPLDML
    RKDAASAEKLGIPKTGKVIFYCAGRE
    CTLSVDSAEIFRKMGYADAWVYRNGVPGWTQKAQPLLAEASFVQKGNLILIDTS
    PGKETIVTESNKLVQLSISDFKGSPGQTALGTLSKNAPIIVVGRGDLDAVNATLEELRERDFRRLAYFPLSAWKGALAMA
    PALTTVTWAPVYGPGQVAPKAFEEAVAAGKFILDVRPVADYARGHFKGAVSLPIEEMEKDYAKIPKDVPVFVN
    CASGAKS
    QKTFDILGRKGYVNVSYLDAEVACKGEICTIKE

    >gi|89902404|ref|YP_524875.1| thiol-disulfide isomerase and thioredoxins [Rhodoferax ferrireducens T118]
    MDIKVLGTGCANCKATIALIDQIAQAKGVTVKLEKMEELRDIMAYGVMSTPGVVINGKVVHAGGIPSRDKIEHWLAAA

    >gi|89902545|ref|YP_525016.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Rhodoferax ferrireducens T118]
    MRCLTNFNPSFKDHSMIKVGDQLPATTLMEFSEVEGGGCSLGPNPVDVAKASAGKTIALFALPGAFTPTCSAKHVPGYIQ
    HFDALKAAGVDEIWCVSVNDAFVMGAWARDQKTNGKVRMLADGDAAFAKATGLTLDLTGKGMGLRSNRYSMLVKDGKVVT
    LNIEAPGKFEVSDAATLLAQAKA

    >gi|89902571|ref|YP_525042.1| hypothetical protein Rfer_3811 [Rhodoferax ferrireducens T118]
    MKLHSLFFSSLLLLALGISGCSPKDSAATAAASKREVSLPAIAAEAKGFAVGALMSTNTVYVFFDSQCPHCGHLWAASAP
    LQQKVKFVWIPIGMINATSKAQGAALLTAANPAALMSEHEASLLAGQGGISASSSVAPEIEKSIKNNTQLLNSFGAESVP
    FVVAKNMKSGQTVSREGAMSTAALAEFLGVDAP

    >gi|89902595|ref|YP_525066.1| rhodanese-like protein [Rhodoferax ferrireducens T118]
    MAITKGFRALVDEAMAQVTTYSVAQVKARLTDANTQMVDIRDVRELAEGTVPGAFHAPRGMLEFWVDPASPYHKPVFADE
    TKEFILF
    CGAGWRSALAAKTLQDMGMSNVAHMDGGWAEWVKQGAPTETLEQHKARRLAKA

    >gi|89902672|ref|YP_525143.1| rhodanese-like protein [Rhodoferax ferrireducens T118]
    MKPTLGKSLLASALLALAAAASAGLPAVNVKQAAALQSSGALLLDVREADEYAQGHAPGSTLIPLGQLAQRLKEIAPFKN
    QRVVLI
    CRSGRRSAQATALLETAGFSAASNIEGGMLAWQQAGLPVLTGAASR

    >gi|89902889|ref|YP_525360.1| alkylhydroperoxidase [Rhodoferax ferrireducens T118]
    MDSSIYPHAGAEVARKRRELAPNPLDAFKAFSASVFADGALPSKTKQLIAVAVAHVTQCPYCIRGHTQTALKAGATEQEL
    MEAIWVAAEMRAGAAYAHSALAIDTMLHAHDAKPS