Rhodococcus opacus B4 uid13791

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|226349452|ref|YP_002776566.1| putative thiol-disulfide oxidoreductase [Rhodococcus opacus B4]
    MCWSSRSGHDKSDDDPSTGPPTAIATGRGSDQAERGRLAAAAALQPCPTAKAETVDAGALGGITARCLGSTTEVDLGAAL
    SGEPTLINVWASW
    CGPCREEIPVLEEYAHTPDAIRVVGVDVDDSSTAALALLTELGAHYPSFGDTDAGALRGALGAPPVL
    PLSFLLRSDGSIARITEPAVFAEPAQIHRAVSELTS

    >gi|226349453|ref|YP_002776567.1| putative thiol-disulfide oxidoreductase [Rhodococcus opacus B4]
    MTTPTPQRLLRRRVVLAAVCAALLTAPACATGADAVAQGGTFDFVAPGGQTDIFYDPPQARGSIGALTGPDLMTDRPVSL
    ADYAGHVVVINLWGQW
    CAPCRSEADDLERAYTATADRGVRFLGINVRDPGRDKAQDFVVDNAVTYPSIYDPPMRTLLALG
    GSYPTSVIPSTLVLDRQHRVAAVFLRALLTEDLQPVIERVAAEPGDPR

    >gi|226349470|ref|YP_002776584.1| putative copper chaperone CopZ [Rhodococcus opacus B4]
    MTSSEENTVSTTASYHVSGMTCAHCVKAVTEELDRLDAVTSVDIDLVPGGDSRVRVTSSRPLSLEQVRHAVDEAGYSLAD
    PPT

    >gi|226349475|ref|YP_002776589.1| putative copper-transporting ATPase CopA [Rhodococcus opacus B4]
    MNPVTQHPTADGQVELEIGGMTCASCANRIEKKLNKLDGVTATVNYATEKARVNYVGDVSTEDLVATVEQAGYTAKVPTP
    PSASTGTDAPAAEQDPTASWRQRLLISLVLSVPVIAMAMVPALQFPNWQWLSLTLAAPVVVWGAWPFHKAAFTNLRHGTS
    TMDTLISMGTIAALGWSLYALFWGTAGMTGMTHPFELTISRSDGAGNIYLEAAAGVTTFILAGRYFEARSKRRAGAALRA
    LLELGAKEVSVLRNGVEERIGIDQLAVGDEFVVRPGEKIATDGVVTEGSSAVDASMLTGESVPVEVGPDDQVVGATVNVG
    GRIVVRANRIGSDTQLAQMAKLVEDAQTGKAQAQRLADKISGVFVPIVIALAVATLGFWIGTGGGVAAAFTAAVAVLIIA
    CPCALGLATPTALMVGTGRGAQLGILIKGPEVLESTRRVDTVVLDKTGTVTTGKMTLLDVITADGEDTAQVLRLAGALED
    SSEHPIAQAIAKGAREQVGALPAVDQFANIEGLGVQGMIDEHAVIVGRARLLADWAQHLPEALENAMAAAEADGKTAVAV
    GWDGRARAVLVVADAVKATSAEAIEQLRGLGLTPIMLTGDNAAAARAIADQVGIEEVIAEVLPADKVDVVKRLQDAGKVV
    AMVGDGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLRAAADAIRLARKTLGTIKGNLFWAFAYNVAALPLAAMG
    LLNPMLAGAAMAFSSVFVVSNSLRLRRFKSTAG

    >gi|226349525|ref|YP_002776639.1| hypothetical protein ROP_pROB01-02880 [Rhodococcus opacus B4]
    MDGYMKLSTNLKFSAALVAVFAVVIGMLLYVNRSGSGSAASGAAGRTVDPAAVLRENTHLLTSSPDRKVVLVEFLDFECE
    SCLAMYPTMERIRAEYSGRITVGVRYFPIPSHTNSNLAARVVEAASRQGKFEAMYQRMYETQTQWGESGRSQEPLFRSFA
    QDLGLDMGRFDSDLGNPALAERVDQDFNEGIELGVQGTPTLFLGGTALPPMPSYEDLRARIDAALAE

    >gi|226349531|ref|YP_002776645.1| putative thiol-disulfide oxidoreductase [Rhodococcus opacus B4]
    MTTRYCLTIGRRPMWWSHRGWRARLLAVLAVGMAAVLGAAGCASGSDAVAQGGTFDFVAPGGQTDILYDPPESRGKVGPL
    SGPDLMADGRAVSLSDYAGQVVVINLWGQW
    CAPCRSEADDLEQAYEATKDLGVQFLGINVRDPQRDKAQDFVIDNRMSYP
    SIYDPPMRTLIALGGSYPTSVIPSTLVLDRQHRVAAVFLRALLAEDLLPVIERLAAQP

    >gi|226349532|ref|YP_002776646.1| putative thiol-disulfide oxidoreductase [Rhodococcus opacus B4]
    MRTGSRWLVFFLAAVVALIAAIWPRSEESDVPEARVTAGAGAVSVAGAGAPQGAAELSRVAAEAELRPCPTPLPSQPVGM
    VLSGVSARCLGAAQAVDLGAALSGAPTVVNMWASW
    CGPCREQIPVLESYANQPDSLPVAGINVQDDPVAALKLLTELDAH
    YPSFGGAEAAMQALAAPPVLPLSFVVQRDGSVDRIVTPSVFADPAEVRSAVGELIR

    >gi|226349565|ref|YP_002776679.1| hypothetical protein ROP_pROB01-03280 [Rhodococcus opacus B4]
    MAGIDLVPLIDEGLGNSAYLVDLGDGRALAVDVSRDLRAVHAAAARRGLTVAFAADTHLHADFLSGAHQLGATGGTRVLA
    SAAGDREFPHTGLRDGDEVDLGGLRLRALMTPGHTHEHLSFLLLDGEKEVGVFTGGSLIVGSAARTDLLGPDRTEVLARA
    QYASLQRLAALPGDVAVWPTHGAGSFCSAPPGADRTSTIARERATNPLLATRDEDTFVDQLLGSLGSYPPYFLRLGEINR
    LGPPLLDQDPVLPALTVDTVRARLAGGAALIDVRPLARFAAAHIPGALSIPLRPVFASWLGWLAPADRPLIIVRDPDQDV
    NEIVWQALKIGYDNLIGELGGGLAAWTAAELEVAATALTGPDGVEGVRVLDIRQRPEYLAGHLPGAVHIELGALPGRVDD
    LPDEPTVVM
    CGHGERAMGAASLLERAGHRNLTVFEGGPDDWAAATGRTLETGTSAKTGA

    >gi|226349566|ref|YP_002776680.1| putative ArsR family transcriptional regulator [Rhodococcus opacus B4]
    MGDRIAKTELFDQFARVGKALGSGKRLELLDLLAQGERTVDGLARAAELGLTTASAHLQTLKQANLVATRREGTKVFYRL
    AGADVAQLFALVRTVANEHLPDVEAARAAYLGPDTDQVSKDELLERARSGKVTVLDVRPREEYEAGHIPGAVSIPWDELA
    DRLADLPEDQEIVAY
    CRGAYCVFAHDAVRLLTDHDRQASRLADGMLEWRLADLPVAT

    >gi|226349568|ref|YP_002776682.1| hypothetical protein ROP_pROB01-03310 [Rhodococcus opacus B4]
    MDVSIIETSSLGDRSYLVSDGAVGVVVDPQRDIDRVLALAHDRDVRITHVLETHIHNDYVTGGLELARTTGAEYVVPTGD
    DVDYQRCAVSDGDLIDAGPIQLQVMHTPGHTHHHVSYVLRETTGGIRGVFTGGSMLFGTTGRTDLLGNDHTRELTHAQYH
    SVRRLAGALPADTKIYPTHGFGSFCAATPASGDSSTVGEQRTTNPALTQDEQSYVEELIAGLGDYPAYYAHMGVINTQGP
    TPVDLSLPKLVDPDELRRRIDDGEWVVDLRERTAFAAGHLGGTLGFELSDSFVTYLGWLYKWGAPLTLIGENEDQVTDAR
    RELVRIGIDDLAGAAVGEIHTLVTGTELRSYRVADFPALAERLPEHDITVLDVRQRNEYDSSHIDGAINIPLHELADRQG
    TLPDGEIWVH
    CASGYRSSIAASMIDRPDRTTVLINDEYDNAKDTDITSTP

    >gi|226349573|ref|YP_002776687.1| hypothetical membrane protein [Rhodococcus opacus B4]
    MREVDLGEFAVRWADGVPVVDVRERWEYVDGHVPGALLMPLGQLAAHTVEIPAGEVVYVICASGNRSREGARIVEATGRG
    AVSVAGGPRAGPPWAGRSTPETDRERTLTPDLADTRCQRFAITSRRTCMTRSTALGGDAPRTEPITEGGVLGRMGAAMAG
    HAKWVFGIWLILLVALGAAAPSVFSSLAGAGWQANGSESVQVRELAEQHFGGNSSAAVQVVVHSDTQTIDSPQMQHTLAD
    VGTVFAGDPRFGAVIAPQPGTSISPDGHTGILIAGANASTDDMVKAVDERKAELTALSGDGIEVYPTGASALWSDFNKAN
    HDAMIQAELFSWPVTLAIMVLAFGSLVAAGLPLLLTLAGLVASAGGLVLLNQVFPISVWAMNFAMMFALALGIDYALFVV
    ARFRDAIRHASSPRAAVADTMETAGKAVVLSGITVLVSLSAVLLVPAPAVRTMAVGIMLAVFFVLLASMTLLPAALGALG
    GKVNAGSLPYAKRQIHRSPRFAAWGELLHRHPWPFAIGALLVLIALSVPALGLKVAMPSIEVVPTDAPVRQGYELVQAQM
    GEGAPGMLQIITPTTGGAETAAAAAATDGIAMVTPPQPAPDGSDYVMLQAMPTVDPSDTRMGTILDTLRADLPQGALVGG
    APAENLDLQQALNDYLPLIVGIILVLGFVLLLVALQAPLIALLGTVVSLLSTAAAFGVAKLIFQDGHGASLLGFTPQGFL
    DGWGPAFFFAMIFAIAMDYTVFLLATAKEHYEHSGDPTVAHVDGLAHSGRVIFAAAAVMVAVFFTFALADPLPPKEMGII
    LGVAVLLDAVLIRLILLPVLLRLTGHAAWWSPAWLRMVLPKINFSH

    >gi|226349574|ref|YP_002776688.1| hypothetical protein ROP_pROB01-03370 [Rhodococcus opacus B4]
    MILEQYYIECLSHASYLIGDESTGRAVVVDPRRDIGEYLDDADKHGLRIEGVINTHFHADFVSGHLELVEATGSWIGFGE
    AAETDYPIRRLRDGERIRLGEVELEILSTPGHTWESISVLVRERAGVTPTAVLTGDSLFIGDVGRPDLVNLGHGSNTDLA
    RAMYRTVHEKLLTLPDQVTVMPAHGAGSSCGKNLSTELSSTIGEQRATNPSVQPMSEDAFVALVTNGQPAAPSYFSVDAA
    MNKQVHPLLSRDRAIPELSPERVRAELVAGTRVVDARSVDDFAAGHLCGSVNVGFDGRFAETGGMVAEVGEKLVLITYPG
    EEQDAAVRLARIGSDDTVGYLSVGHDGHFPAELADLVQSALRTTVDELDALLAADAVTLIDIRNPGEREFGTIPGAAPIP
    LAQLHTRLEQIPTGKPIVVH
    CAGGWRSSVAASLLRAQGFENVSDLLGGYNAWAEAHVPA

    >gi|226359450|ref|YP_002777227.1| hypothetical protein ROP_00350 [Rhodococcus opacus B4]
    MDVSIIETSSLGDRSYLISDGAVGVVVDPQRDIDRVLALARDRGVRITHVLETHIHNDYVTGGLELSRTTGAEYVVPTGD
    DVGYQRRAVSDGDLIDAGPILLQVLHTPGHTHHHVSYVLRETTGGIRGVFTGGSMLFGTTGRTDLLGKEHTEELTHAQYH
    SVRRLADELPPDTEVYPTHGFGSFCAATPATGDSSTVGEQSKTNPALTRDEQSYVDELLAGLADYPAYYAHMGVLNTEGP
    PPVDLSLPKPVDPDELRRRIEDGEWVVDLRERTAFAAGHLGGTLGFELSDSFVTYLGWLYTWGAPLTLIGDNEDQVADAR
    RELVRIGIDDLDGAAVGEIHTLVAGTALRSYRVADFAALSEALREKDITVLDVRQRNEYDDSHIDGAINIPLHELADRQS
    TLPNREIWVH
    CASGYRASVAASMIDRPDRTTVLINDEFDNANDTDLTSTT

    >gi|226359456|ref|YP_002777233.1| hypothetical protein ROP_00410 [Rhodococcus opacus B4]
    MGLRGAVDTCARVYPLGYGGEVLGDTPSGMKELEMREVDLDEFAVRWADGVPVVDVRERWEYVDGHVPGALLMPLGQLAA
    RTAEIPAGEVVYVI
    CASGNRSREGARIVEAAGRGAVSVAGGTSGWAAHGRPLDRGDGS

    >gi|226359480|ref|YP_002777257.1| carboxymuconolactone decarboxylase family protein [Rhodococcus opacus B4]
    MPESLYQPTTTEISERRKALAPGIHDAFENFSRAVFADGALPEKTKQLIAVAVAHVTQCPYCITGHTKLARRKGAEPEEI
    MEAIWVAAEMRAGGAFAHSTLALNAMNHSGHTSTGEPEP

    >gi|226359489|ref|YP_002777266.1| ferredoxin reductase [Rhodococcus opacus B4]
    MATAEQTFVIVGAGLAGAKAAEALRTGGFDGRIVLIGDETDRPYDRPPLSKSYLQGTTERQKIYIHPAGWYTEHDIELRV
    GTPVTALDTAEHEVVIDGVERLGYDKVLLTTGSSPRRLQVPGADLGGVHYLRRVTD
    CETLKAAFAAADRVAIVGAGWIGL
    ETAAAARAAGCDVTVVGRSKLPLLAVLGAEVAETYAALHRDHGVELRLNSGVREIAGKDNQATGIRLTDGTVIEADTIVV
    GVGIVPNTALAETAGLAVDNGIVVDEHLATTDPDVYAAGDVANTYYPLLGTHLRLEHWSAALNQGPVAAANMSGRVTAYD
    QVPYFFSDQYDSGMEYSGYAPHGSYDSVVFRGDVAAGEFIAFWMRDGRVLAGMNVNTWGVTDAIEALVRSGERVDPAKLA
    DPDELLRYLADPVPGGAR

    >gi|226359817|ref|YP_002777595.1| hypothetical protein ROP_04030 [Rhodococcus opacus B4]
    MTNKAVVSLTTGLEDAEKVTVAFLVAVGAAEQQRQTLMFLTKEAVRLALDGTIQGVACEGCPPLPDLAARFENAGGTYMV
    CPICFEAKHLDKDALVSNAELAGTVPMWKWIGDEGAVTFSY

    >gi|226359837|ref|YP_002777615.1| carboxymuconolactone decarboxylase family protein [Rhodococcus opacus B4]
    MGDRIPPPLDNLLEGNIMTSVNLSKQHPSVYKSLMKLDADVKAALETAGVDPLLVELVKIRVSQLNGCAFCLRMHTRDAL
    AKGETTDRLAVVAAWWEAQYFSEKERAALALAEQVTALSVPERRAWDDGSLTDEQVSAISWLATVMNAWNRVAVTSHYPV
    TP

    >gi|226360009|ref|YP_002777787.1| hypothetical protein ROP_05950 [Rhodococcus opacus B4]
    MAVPKIVLFYVFTPLADPEAIRLWQYTLAEAHDLTGRILVSEHGINATVGGDIRDVKRYVKGTRSYAPFKDADIKWSDGL
    GNDFPRLSVKVRPEIVTFGAPGELKVDADGVVGGGTHLAPEEVHRLVEGRGDDVVFFDGRNGFEAEIGRFRDAVVPDVST
    TRDFVHELDSGKYDHLKDKAVVTY
    CTGGVRCEVLSSLMRSRGFGEVYQLDGGIVRYGEAFGDTGLWEGSLYVFDKRMTIE
    FSDQAKTLGRCTRCGGPTSRYENLPDDRGRELVLVCAGCTENRAG

    >gi|226360132|ref|YP_002777910.1| thioredoxin [Rhodococcus opacus B4]
    MATKTLTQQNFDETVTGNDVVLVDFWASWCGPCRSFAPTFEASSEQHPDVVHAKVDTEAEQGIAAAANIRSIPTIMAFRE
    GVLVFSQPGALPPAALEDLVTQVKALDMDEVRKQIAEQAPAE

    >gi|226360157|ref|YP_002777935.1| putative hydroperoxide peroxidase [Rhodococcus opacus B4]
    MKPGQLAPEFTLPDQDGIARSLSSLLEDGPLVLFFYPAASTPVCTAEACHFRDLGIEFSAVGASRAGISTDAVAKQASFA
    QAQSFDYPLLSDTDGAVAEKFGVRRGLLGKLAPVKRSTFVIDTDRTVLEVISSEFRANTHGDQALAFLRTRQAT

    >gi|226360282|ref|YP_002778060.1| putative iron-sulfur cluster assembly protein IscA [Rhodococcus opacus B4]
    MTVQNETAVHGVKMTEAASAKAKALLDQEGRDDLALRIAVQPGGCAGLRYQLFFDDRNLDGDLIVDFGGVALAVDRMSAP
    YVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|226360331|ref|YP_002778109.1| peroxiredoxin AhpE [Rhodococcus opacus B4]
    MPLEVGTTAPDFTLKDQNNQEVTLSDYRGKKNVLLVFYPLAFTGTCQGELCKVRDELPKFENDETAILALSVGASPTHKI
    WSAEQGYTFPLLADFWPHGAVAQQYGVFNDKLGFANRGTFVIDKEGVIRFAEMNGPGEARDQGAWEKALATLES

    >gi|226360508|ref|YP_002778286.1| hypothetical protein ROP_10940 [Rhodococcus opacus B4]
    MSAGTNTGTAKDVADFWFDPLCPWCWITSRWILEAAEVRDLEANFHVMSLAVLNEGRDLPDEYRELMTRAWGPVRVLIAA
    AQKHGDEILLPLYTAMGTLIHNEGNKDVDDVIVKSLAEVGLPAELAEAAGSDEYDAALRESHAAGMDAVGPDVGTPTIHV
    NGVAFFGPVLSRIPRGEDAGKVWDGAVALAGYPHFFELKRTRTEDPQFD

    >gi|226360546|ref|YP_002778324.1| hydroperoxide peroxidase Bcp [Rhodococcus opacus B4]
    MTDNSRLAPGDTAPAFTLPDADGNDVSLADFRGRKVVVYFYPAASTPGCTKQACDFRDNLADLNGAGLDVIGISPDKPAK
    LAKFRDNEELTFPLLSDPEKSTLEAWGAFGEKKMYGKTVQGVIRSTFLVDEDGKIEVAQYNVRATGHVAKLRRDLSV

    >gi|226360579|ref|YP_002778357.1| putative thioredoxin [Rhodococcus opacus B4]
    MSGAVDLSALKERAAAPPPPAPAPSGDGAAPAAPGGTGLTPVIDVTEATFEAEVLARSQQVPVVVDLWATWCEPCKQLSP
    LLEKLAHEAGGTWVLAKVDVDANPRIAQAFGVQSVPTVVAIAGGQPLADFQGAQPEPQLRQWLAAVQQATAGKLSGPPAG
    DGSADEPEPEDPRFVAAEAALDEGDLAAAEAEFQKILDAEPANAEAQGAIRQVRFLARVQSVDPGAVAAADAAPADIDAQ
    LQAADVELYSQAPDAAFARLIGVVARSAGDDRTRVRTRLLELFELFDPAEPVVMTARRKLAAALY

    >gi|226360804|ref|YP_002778582.1| hypothetical protein ROP_13900 [Rhodococcus opacus B4]
    MSFRHYLRRPPSVSAADAVRLVEDGALVVDVRRQFEWNRVHIPGAVHAPLEVLLDRCLEFPDDRLLITFCTGGIRSAGAA
    NLLVENGFDAVNMSGGLIHWRAAGGPVTDR

    >gi|226361123|ref|YP_002778901.1| cytochrome c biogenesis protein ResA [Rhodococcus opacus B4]
    MNRGRFAGLLAVICTAAVALSACASGDDAVAQGGTFDFVSPGGQTEIFYDPPADRGTIGTVSGPDLMTEGKTTSLDDFEG
    QVVVLNVWGQW
    CGPCRGEANDLEQVYEETKDQGVSFLGINVRDNQQDKAQDFVIDNKVSYPSIYDPAMRTMIALGQNYPT
    SVIPTTIVLDREHRVAAVFLKELLAEDLKPVVDRVAQES

    >gi|226361141|ref|YP_002778919.1| hypothetical protein ROP_17270 [Rhodococcus opacus B4]
    MSTGGHEVTLLTRAGCGACAPARERLLVLCEEFGLELTCIDVDEAAATDPEIRAEFGDRLPVVLLDGREHSYWEVDEERL
    RSDLRK

    >gi|226361272|ref|YP_002779050.1| dihydrolipoamide dehydrogenase [Rhodococcus opacus B4]
    MTSHYDVVVLGAGPGGYVAAIRAAQLGLSTAIIEQKYWGGVCLNVGCIPSKALLRNAELAHLFTKEAKLFGISGEASFDF
    GAAFDRSRKVAEGRVKGIHFLMKKNKIPEYDGKGTFTDAHTIEVELTKGGTETVTFDNAIISTGSTTKLLPGTSLSKNVV
    TYEEQIMTRELPGSILIVGAGAIGMEFGYVLKNYGVDVTIVEFLDRALPNEDADVSKEIEKQYKKLGVKVVTGAAVQSID
    DDGSKVTVAIKNNKSGETETVVVDKVMQSVGFAPRVEGFGLEKTGVQLTDRGAIGITNTMQTNVPHIYAIGDVTAKLQLA
    HVAEAQAVVAAETIGGAETLPIDDYRMMPRATFCQPQVASFGLTEQQAKDEGYDVKVATFPFAANGKAHGLGDATGFVKL
    IADTKYGELIGGHLIGPDVSELLPELTLAQKWDLTVNELARNVHTHPTLSEALQEAIHGLAGHMINF

    >gi|226361461|ref|YP_002779239.1| putative methylated-DNA--protein-cysteine methyltransferase [Rhodococcus opacus B4]
    MNIPDIVYSLFPLDSAVEQKLRERLAVAAADAGLLDVAYRTLDTPVGSLLLAATDRGLVRVAFPSQDHDAVLQTLAEQIS
    PRILRAPARLDRVAYEIDEYFLGRRTSFDVPLDFRLSKGFRLEVLHHLPDIDYGHTASYAAVAAAAGSPRAVRAVGTACA
    LNPLPVVVP
    CHRVVRSDGSMGQYAGGPEAKSILLTLEAAA

    >gi|226361463|ref|YP_002779241.1| methylated-DNA--protein-cysteine methyltransferase [Rhodococcus opacus B4]
    MNADRAAHTVIDSPIGPLTLVSVDGVLSGIYMAEHRHQPNPATFGDRDTAGFDEATAQLAEYFDGRRTEFTVPLATRGTP
    FQKRVWDALRTIPYGDTWTYGRLADSLGSPTAVRAAAAANGRNPISIIIP
    CHRVIGSNGSLTGYAGGLDRKRFLLEREAE
    RAGLRLSS

    >gi|226362063|ref|YP_002779841.1| dihydrolipoamide dehydrogenase [Rhodococcus opacus B4]
    MSHRTADVVILGGGSGGYAAAIRSAELGRSVILIEENELGGTCLHQGCIPTKALLHSAEVADSARTASQFGVDVTFGGVD
    LEKVLSYQNTIITRLHKGLQGLVDSYGITVVNGRGRLVGPNGVEVDGELITGAAVVLATGSSPKTLPGISIGGRVVTSDE
    ALVLPSVPKKAIILGGGVIGVEFASVWASFGTSVTIVEAMSRLVPNEDETVSKYLERAFRRRKIAAKTGVRVTDVTQDDN
    SVSVTLDSGDVLDADVVLVAVGRGPNTSSMGYEETGVVLDRGFVVTSDRLRTTVPNVYAVGDIVPGLQLAHRGFQQGIFV
    AEEIAGLRPDVIDETGIPRVTYSHPEVASVGLTETAAREKFGDEIRTVVHDLAGNGKSQILKTSGAVKLVVAPDGVVVGV
    HMVGDRVGELIGEAQLLYNFEVDAAQAAKYVHAHPTQGEALGEALMAVAGKPLHVHG

    >gi|226362204|ref|YP_002779982.1| alkyl hydroperoxide reductase subunit C [Rhodococcus opacus B4]
    MALINTQIKPFAASAFKDGAFTTVSADDVAGKWAIFFFYPADFTFVCPTELGDLADHYEELQRLGVEVFSVSTDTHFTHK
    AWHGSSDTIGKIKYAMIGDPTQEISKNFEILRENEGLADRGTFLVDPDGVIQFTEVTAEGIGRNAAELVRKVKAAQYVRS
    HPGEVCPAKWEEGEETLAPSLDLVGKI

    >gi|226362205|ref|YP_002779983.1| alkyl hydroperoxide reductase subunit F [Rhodococcus opacus B4]
    MLEASLAGQLKSLLERLTLPIELVSSLDDGPKSTELAELLTEIAAMSDKVTYERRDDDARRPSFAVRRSGTDIEVRFAGI
    PLGHEFTSLALALLQVGGYPSKESPELLEQVRNLDGDFHFETYFSLS
    CQNCPDVVQALNLMAVLNPRISHVAIDGALFQD
    EVDGRQIMAVPTVFVNGELFGSGRMSLEEIIGKLDVGAADRAATAIAQKDPFDVLVVGGGPSGAAAAVYAARKGIRTGIA
    AERFGGQVLDTMAIENFISVPYTEGPQFGSALENHVRQYGVDIMNTQKAAKLVPAATENGLVEIELESGASLLARTVILS
    TGARWRSMNVPGEDAYRNKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGLVEHVTLIEFDSVLRADEVLQRKLR
    SLPNADILLSTLTTEVVGDGGKVTGLAYQDRTTDTAHTLDVEGVFVQIGLLPNTEWLAGSVELSDRGEIAIDDRGQTSVP
    GVFAAGDCTTVPYKQIVIAAGAGATAALSAFDRLIRTGVPAEESAAATVG

    >gi|226362323|ref|YP_002780101.1| dihydrolipoamide dehydrogenase [Rhodococcus opacus B4]
    MTETHSDVLILGGGSGGYACAFRAAQLGLSVTLIEADKVGGTCLHRGCIPTKALLHSAEVADTARTGAAFGVRMTFDGID
    LGAVHQYKNDTVDRLYRGLQGLVAQHRISLVPGHGRYVGDRTIEVDGVRHTGTSSVVLATGSYVRTVPSLELGERIVTSD
    DALNLGFVPKKAVVLGGGVIGVEFASVWASFGAEVTVVEALPRLVAAEDPWCSKHLERAFRKRGITARTGARVESAKESA
    DGVLVELSGGETLDADVLLIAVGRGPRTADSGFAENGITLDRGFVVTDERLRTHVDGVYAVGDIVDGLQLAHRGFQHGVF
    VAEEIAGLAPVPVAEHLVPRVTYSHPEVASVGLTEDAARERYGDATSAVYDLAGNGKSQILRTSGGIKVVRAGDTGPVVG
    VHMVGDRVGELIGEAQLTVAWEALPTDVAPFVHAHPTQNEALGEAMLALSGKPLHTHG

    >gi|226362414|ref|YP_002780192.1| putative thiosulfate sulfurtransferase [Rhodococcus opacus B4]
    MSTTPATTPITATAAAIDQVDVRGPRFAAWITTTVLVAVLLAASVSTVTAGVILAVQTVVFAVSAAVGPRRSPYGRIFGK
    LVAPHIAPPSEREPTAPLRFAQLVGFVFAAAGLLGFALSAPVVGAVFTGFALFAAFLNAAFGICLGCQIYPLVARFRPTA
    STHPTHSAAPRKVHSEGKNMARSDVLVSTDWAQQNVNAPNIVFVEVDEDTSAYDGAHIEGAIKLDWKKDLQDGVRRDFLD
    REQFSDLLSARGVANDDEVVLYGGNNNWFAAYAYWYFKLYGHDNVKLLDGGRKKWELEGRPLSKNAVTRPSTTYRAAEPD
    LSIRAFRDEAVDAIGVLNLVDVRSPDEFTGKILAPAHLPQEQSQRPGHIPGALNVPWSKAANEDGTFKSDEELAAIYGEA
    GLDGSRDTIAY
    CRIGERSSHTWFVLKELLGHKNVKNYDGSWTEYGSLVGVPIELGK

    >gi|226362743|ref|YP_002780521.1| putative copper chaperone CopZ [Rhodococcus opacus B4]
    MVVLEHSIDTPKRGRTVSTSSVTVTGMTCDHCVSSVTEEISALPGVTSVNVDLATGKVVIDSTTDLDPGAVADAVEEAGY
    SLAG

    >gi|226362745|ref|YP_002780523.1| putative copper-transporting ATPase CopA [Rhodococcus opacus B4]
    MTRADLAAPPDSQVELAIGGMTCASCANRIERKLNKLDGVTATVNYATEKARVHYDAGVSPEDLVATVEQAGYTARLPEV
    KPPTPEDEDPAAELRQRLLVSAVLTVPVIAMAMIPALQSTNWQWLSLTLAAPVVVWGAWPFHKAAWTNLRHGTATMDTLV
    SMGTLAAFGWSLYALFWGTAGMPGMTHPFELTIARVDGTGNIYLEAAAGVTTFILAGRYFEARAKRRAGAALRALLELGA
    KEVSVLRDGTEQLIGIDQLDVGDLFVVRPGEKIATDGVVVEGSSAVDASMLTGESVPVEVSPDSEVAGATVNVGGRIVVR
    ASRIGADTQLAQMAWMVEDAQTGKAEVQRLADRISGIFVPIVIALSVATLGFWIGTGGPIAAAFTAAVAVLIIACPCALG
    LATPTALMVGTGRGAQLGILIKGPEVLESTRRVDTVVVDKTGTVTTGTMSLHDVVAADGQDEEQVLRFAGALEDASEHPI
    ARAITRGAKERLTTLPDVEQFTNVAGLGVQGMIDGHAVVIGRAKLLRDWSLHLTTELQRAVEAAESDGKTAVGIGWDGQA
    RGVLVVADTVKPTSREAVAQFRELGLTPIMLTGDNKSAARAIAGQVGIGEVIAEVLPQDKVDVIKRLQADGKVVAMVGDG
    VNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLRAAADAIRLSRRTLSTIKGNLFWAFAYNVAALPLAAAGLLNPML
    AGAAMAFSSVFVVSNSLRLRRFQPLTTPTRGEQS

    >gi|226362882|ref|YP_002780662.1| thioredoxin reductase [Rhodococcus opacus B4]
    MTTPSTVHELIIVGSGPAGYTAAVYAARAELEPLQFEGTQFGGALMTTTEVENFPGFREGIMGPDLMDQMREQAKRFGTD
    IRTEDVEELDLTGPIKKVVVNGETYLAHAVVLAMGAAARYLGIPGEEKLLGRGVSA
    CATCDGFFFKDQDIVVVGGGDSAM
    EEATFLTRFARSVTVVHRREEFRASRIMLERAKANAKIRFVTNAAPVEVLGENSVTGLVVRDTVTGETSTLDVTGMFVAI
    GHDPRSELVKGQVDLDEAGYVIVQNPTTATSVDGVFAAGDLVDHIYQQAITAAGTGCSAAMDAERWLAERGDITANTVAA
    AGSPVDA

    >gi|226362883|ref|YP_002780663.1| thioredoxin [Rhodococcus opacus B4]
    MSNTVTITDDSFQQDVISSDKPVLVDFWATWCGPCKMIAPVLEEIAGEHSDKLTIAKLDIDANPGAARDFQVMSIPTLIL
    FKDGKPINTIVGTKGKAALLKELADVL

    >gi|226363178|ref|YP_002780960.1| carboxymuconolactone decarboxylase family protein [Rhodococcus opacus B4]
    MSSTSTENDYVHIDKRSPAVYQAQIGVAKAIRHATTEAGMDRRFVELINVRVSQINRCAYCLDVHVAAALAAGETQQRLA
    VLPAWRETTLFSEREVAALTLAESITTLPDAHSQEADYAFARRFLSEQEMSTVSWIAVTMNAFNRISIVSRHQVRPKQ

    >gi|226363302|ref|YP_002781084.1| peptide methionine sulfoxide reductase MsrA [Rhodococcus opacus B4]
    MMVTAEDALPGRSQPIPVPATHFVNGHPLKPPFPEGLQTAVLGMGCFWGAEKEFWQLDGVYTTAVGYAGGYTPNPTYEET
    CSGRTGHTEVVLVVFDPKVISYAEILKEFWENHDPTQGMRQGNDQGTQYRSAIYTIDEQQVEIAEATGEAFEKRLAEAGY
    GAITTEIAPLTQFYYAEDYHQQYLAKNPGGYCPVHATGVSCPVGLLKQDEVPAQTDILPPS

    >gi|226363377|ref|YP_002781159.1| putative oxidoreductase [Rhodococcus opacus B4]
    MEISYDVVVIGGGAAGLGGALALARARRSVLVIDAGEPRNAPAGHIHNYLGRAGTPPGELLAIGREEVTGYGGEIVTGTV
    TSADKVGDGEFRVTLADGRAVGARRLLVTTGLVDVLPPDIPGVAERWGRDVLH
    CPYCHGWELRDQPVGVLACSPLAVHQA
    LMWGQWTDQVTLFLNDANEPTGEEYEQLAARGVAVIDGAVAGLEVRDDRLTGVRLRTGRVFPLAAVVVPPLFRARADFLA
    TLGLATTEMEMAGHVIGTAVAADAMGATAVPGVWVAGNVADPKAQVIVAAGAGLTAAAALNADLIAEDTRLAVAGALSR

    >gi|226363644|ref|YP_002781426.1| putative thiol-disulfide oxidoreductase [Rhodococcus opacus B4]
    MSSAARWSLAALVVVVALVVAIWPRGDDVEAPSYEDRFGAGGAAPTSVAADPDALAALRTQARLAPCPPPAAAPPADPVL
    AGITLECVGDGSQVDLAAALGGKPAMLNLWAYW
    CGPCAEELPYMQQFSDRAGDAVTVLTVHTDPNESSALSRLIDYSVTL
    PGVQDGDGRVRAAVGAPPVLPVSVLIRPDGTVAKVLPQPFRSVDEIADAVEQNLGVAA

    >gi|226363752|ref|YP_002781534.1| putative hydroperoxide peroxidase OsmC [Rhodococcus opacus B4]
    MPTRTARTAWNGSLEQGSGQVELTSSGVATFDVSFPKRAAEEAGGTTSPEELIAAAHSSCYAMQLSALIAEAGGTPQSLE
    VKADVSLGPDNPGFKLTGIKLTVRGEVDGLDADGFAKAAQAAKES
    CPVSKALTGVEITLDAALES

    >gi|226363758|ref|YP_002781540.1| putative oxidoreductase [Rhodococcus opacus B4]
    MHHGEPRQSPARNPVGTQSGVDLFHWSVTTQQNADGDIEIEIWSDVACPWCYIGKHRFLSALAEFEGRDRVTVVWRSYQL
    SPDTPAGQRRSELDALVESKGMAPEQVRQMFGHVAQTAAEEGLRLDFGTVIAANTFDAHRLIHIASDNRDAVVEALFRAH
    FAEGAVIDDRAVLVDIAARAGLDADTVRAELESGAGADAVRADLDAARALQVSAVPFFVANRRIAVSGAQPKDVFLQLLA
    QASADDQVRAT

    >gi|226363978|ref|YP_002781760.1| ferredoxin reductase [Rhodococcus opacus B4]
    MVTSQATPTVVIVGAGHAGGTLAGMLRQQKFDGRIVLCGDETHPPYHRPPLSKKYADDEFVQWLKPESFYADNAIDTLLG
    DPVVRIDRDARTATTASGDILEYTTLVLATGAAPRTLTLPGSDLEGVLSLRTLADATQLREAVHTGSTLAIIGGGYVGLE
    VAASARARGCEVTVIEREDRVLARVASPELSAALTDFHRNRGTRILTGAEVRGITEKSGRVAGVELGDGTEIPCDLVLVG
    VGAIPNDTLARESGIECLAGIVVDGSARTSDPHVLAIGDVTYRLHDTLGKMVRLESIPSAVEQAKQAASVITGTPLSPHE
    VPWFWSDQFDLKMKMAGMVGPDTRAVLRGNPSDSSFALFHLDSDGVPVAVETVNAASEFMAGKKFIGNRSKVDPTALADP
    AISLREAVL

    >gi|226364189|ref|YP_002781971.1| hypothetical protein ROP_47790 [Rhodococcus opacus B4]
    MGTNTTLPGLESTFADELGALTVPWRGADVADPRLLVFNDQLAASMRLDAAALRSGDGVAVLSGSATPAGAKPVAMAYAG
    HQFGGYVPLLGDGRALLLGELVNDDGRRVDLHLKGSGRTPFSRGGDGFAVVGPMLREYLVSEAMHALGIPTTRALSVVAT
    GRQVLRGGAEPGAVLARVGSSHLRVGTFEYAVRQGAVLAPLADYAIARHYPELIDRPATGESSRYVAFFEAVVEAQASLV
    AQWMLTGFVHGVMNTDNTTISGETIDYGPCAFLDAFDPAAVFSSIDHGGRYAFGNQPAVLKWNLARLAETLLTLIDSTPD
    DAIAAVSAVLDTFDARYDAHWTAGMAAKLGVAGGPVDRTLVDDLLTLMTERGADWTGSFRALADELRGNPVPLDGLVPRE
    HIGPWLQRWRGVVERQGRAAVQVADAMDCVNPVYIPRNHQLDAALRAATDGELAPFEKLLEVVTHPFDRRDEWSDYTTPA
    PRVFSETFQTF
    CGT

    >gi|226364318|ref|YP_002782100.1| putative glutathione peroxidase [Rhodococcus opacus B4]
    MTTPVQNIGINTLGGTPTSLGEYDGRAVLVVNVASKCGLTPQYKGLEKLATDYADRGLTVLGVPCNQFMGQEPGTAEEIE
    TFCSTTYGVTFPLLEKIEVNGENRHPLYEELAKTTDAEGAAGDIQWNFEKFLVAPDGTVVKRFRPRTEPDAPEVVEAIEA
    ILPK

    >gi|226364348|ref|YP_002782130.1| putative thiosulfate sulfurtransferase [Rhodococcus opacus B4]
    MARSDVLVSADWAEQNLNAPKTVFVEVDEDTSAYDGGHIEGAIRLDWRKDLQDGVRRDFLNQQQFSDLLSAKGVANDDTI
    VLYGGNNNWFAAYAYWYFKLYGHQDVKLIDGGRKKWELDGRPLSKETVSREATQYKADAPDLTIRAFRDEVIDAIGNKNL
    VDVRSPDEFSGKILAPAHLPQEQAQQRGHVPTAINIPWSTTANEDGTFKSDDDLEKLYSEKGYDESKPTIAY
    CRIGERSS
    HTWFVLKEILGKSDVKNYDGSWVEYGSLVGAPIELEVH

    >gi|226364350|ref|YP_002782132.1| putative thioredoxin [Rhodococcus opacus B4]
    MTGITLLLIALFAALAFGLVWQRRQGKVRTTGETTAVVTDQRRLLLEAAGIGPQSPEHPRRATVLHFSADWCGPCAAVRR
    VVGQVVADLAGEPEPPVEVEVDIDEYPALAKELGVLSLPTTFILDADLQQRFRVSGVPTAADLRAALGPLTRPPASNS

    >gi|226364383|ref|YP_002782165.1| putative organic hydroperoxide resistance protein [Rhodococcus opacus B4]
    MKIIYTAEALATGEGRNGHARTSDGRLDLNLAIPTEMGGSGDGTNPEQLFAAGYAACFHSALQLVARQAGANVADSAVGA
    RVGIGSTDGGGFGLAVTLEVSLPHLPRAEALELTEKAHQV
    CPYSNATRGNIDVTLEVTED

    >gi|226364569|ref|YP_002782351.1| putative methyltransferase [Rhodococcus opacus B4]
    MVIDNDVYDRVGESWWEEDNPLNLLHGSLTPGRFAYFRTVLGQTIGRNYRGLRALDVGSGGGFLAEEFTRIGFRVTGIDP
    SRVSIDTARRHAARAELDIEYRIGSGERLPVPDSTFDVVYCCDVLEHVSDLSAVIAETSRVLKPGGLYLFDTINRTFASK
    LVAIKIMQEWRMTRMFDTPIHDWSM
    CIRPAELTALMEHRDLRLGEIVGLGPRSRNPLRLLDLARAGGTRLSYGELSRRLD
    FGQIRSTAISYMGYAVKNGESPPRLRDGLPDGRDQL

    >gi|226364864|ref|YP_002782646.1| hypothetical protein ROP_54540 [Rhodococcus opacus B4]
    MTTSSADGRVAITYCTQCQWLLRAAWMAQELLGTFGQELGEVALVPGTGGIFRITVDGELIWDRKEQGGFPEITVLKQLV
    RDRVAPERDLGHSDRKNP

    >gi|226364876|ref|YP_002782658.1| putative 3-mercaptopyruvate sulfurtransferase [Rhodococcus opacus B4]
    MSPVVTVDELAQSLSSDAPPTLLDVRWALGDTEGRQHYLDAHIPGAVFVDLDTELAAPGTPELGRHPLPAVPDLQDAARR
    WGIRAGSPVVVYDATGNLAAARAWWLLRWAGVAEVTMLDGGFGAWTSAGHPVRSGDEQARVPGDVVLAAGHLPTLTADEA
    AEFAAAGYLLDARAAERYSGATEPVDPRAGHIPGARSAPTSENLGPDGRFVPVEALRARFAAVGAEPGRPVGVY
    CGSGVT
    AAHQVAALALAGIDAALYPGSWSQWSSDPDRPASTGPDAR

    >gi|226365032|ref|YP_002782815.1| putative methylated-DNA--protein-cysteine methyltransferase [Rhodococcus opacus B4]
    MTTGIALFDTALGTCAIAWRAAGIVGVQLPEGSPESTRQRLEHCFPDAVEHQPPAPVQQAIDGIREHLGGALDDLRWIDL
    DFEGVPEFDCNVYDITRAIDPGTTLTYGDIAAELGKPGAAQAVGQALGRNPLPVVIP
    CHRVLAAGGQVGGFSAGGGTLTK
    RELLALEHTPGFDDPVLF

    >gi|226365040|ref|YP_002782823.1| putative oxidoreductase [Rhodococcus opacus B4]
    MTDSGSGAEEFDVIVIGGGPAGENAASYAIAGSERTAALIEHELVGGECSYWACMPSKALLRPGEVLGAARNMPGVTAGP
    LDVDAVLARRDSFTNNHDDSSQVMWADSAGIDVIRGSARITGDRTVTVGDSRQLRARHAVVVATGTTATVPDTPGLRAAL
    PWISRDATNLREIPRRVAVVGGGVVACESATWLLDLGAEELTMVVRGRGLLPKNEPFAGERVARMLEKKGARILFGADLR
    GVERAEPRDTGIGRIHGGPVTLDVAGQDPLVVDEIVVATGRTPATSSLGLDARLLDSRGYLTTDDHLTTAYEWLYAVGDA
    NGRALLTHMGKYQGRVCGDVIAARAEGRPLDGSRFRATADHGQIPQVVFADPEVSAVGITEQEARDAGVDVETLEVDIAV
    AGSSLSRDDFSGHAKLVVDRATDTLVGATFAGTDVAELVHAATVALVGKVPLDTLWHAVPSYPTVSEVWLRLLEARR

    >gi|226365126|ref|YP_002782909.1| arsenate reductase [Rhodococcus opacus B4]
    MANTATIYHNQRCSTSRTVLGLIRDAGIEPTVVKYLETPPSRDGLRKLLDDAGLKPSEAIRKKEAVFKELGLAEASEDEL
    LEAMVDNPILIERPIVVTNKGTVLARPAAKVGDIL

    >gi|226365325|ref|YP_002783108.1| hypothetical protein ROP_59160 [Rhodococcus opacus B4]
    MDPREHNTLGGSTSPYLRQHADNPVHWQQWGPEATAWARERDVPILLSIGYSACHWCHVMAHESFEDEQVASLMNEHFVC
    VKVDREERPDLDAVYMNATVAMTGQGGWPMTCFLTPDGAPFYCGTYYPAQPRGGMPSFTQLLGAIADTWRDRRGDVDDAA
    ASVVAELRRGAGGIPEGEVRVTAALLDAAAGTVLRDEDAERGGFGGAPKFPPSALLEGLLRTYERSGDADVLGVVSRTAS
    AMARGGIYDQLGGGFARYSVDAAWVVPHFEKMLYDNAQLLRAYAHLGRRTGSEMALRVTEETVEFLLRDLRTDNGSFASA
    LDADTEGVEGLTYVWTPQQLVEVLGSEDGEWAARVFAVTADGTFEAGASVLQLSRDPDDWDRMRRIRDTLLARRATRPQP
    GRDDKVVTAWNGLAITALAEAGAGLGRPDWVDAAAECARAVLELHVVDGRLRRASLGASVGDSAGVLEDYACLATGLLAL
    YQATGGAEWLAHAQSLLDRALIHFADDERPGSWFDTADDAETLVTRPRDPVDGATPAGASCLAEALLTASAVADVDASGR
    YATAAAASLDRVALLLERAPRSAGHWLAVAEASVRGPIQVAVAADGDSALLREARRLAPGGAVVVGGQPDSSPLLADRPL
    VGGASAAYVCRGFVCDRPVSTVEGLAAAMSR

    >gi|226365691|ref|YP_002783474.1| putative ABC transporter substrate-binding protein [Rhodococcus opacus B4]
    MALSRNEVYMYCQSFRSSALVTFAVAALVVAGCSRGESVGETASTESFAEPVSVTNCARTETFDAPPQRIVSMNDHVTEV
    LIEMGAGDRIVGTGYGDATPLPEFAEQFAKIPKLATEYPTREQILDLDPDLVVGGMRSAFDEKEGRSRESLGEQGIPTFL
    FSEY
    CGQGFPDIGLLRSDYGQLGEILGVPDEARAVSDRVTSGLQAVRDEIAGAAPVPTFFYDSGEDVPLTIGGVGVGQLI
    ADHAGAANLFAEGEKPYSKSTWEVIGERAPEAIVVLDYGTTSAQAKIDFLKSHPIMSTTPAVKAGRFVVVPLDDFFESPR
    LVRSVETIARALHPDVVGAR

    >gi|226365697|ref|YP_002783480.1| putative sulfurtransferase [Rhodococcus opacus B4]
    MIEVDLNALDGALASGAPVIDVREADEYAQARVPGVTLIPLSEFVARVNEIPDAEVVYVICAVGGRSLQAAEYLNARGIN
    AVSVAGGTSAWMQSGRPVESGA

    >gi|226365732|ref|YP_002783515.1| putative oxidoreductase [Rhodococcus opacus B4]
    MTRIVIIGGGPAGYEAALVAAQHGASVSLIDSDGVGGACVLFDCVPSKTFIASTGVRTDMRRATDLGIALDPEQATVALP
    QIHARVKSLAQAQSSDIRTRLQTVGVELLSGTAELTDQRLGMASHQVCATLENGEKKTLDADVVLIATGASPRVIPGAEP
    DGERILTWRDLYDLDALPTHLVVVGSGVTGAEFVSAYTEMGVKVTLVSSRDRVLPGEDADAALVLEDVLAERGVTLVKHA
    RADAVKRTEDGIVVVLADGRTVEGSHALMTVGSVPNTQNLGLEKVGIELDKGGYLRVDRVSRTPVSGIYAAGDCTGLLPL
    ASVAAMQGRIAMYHALGEGVSPIKLKTVASAVFTRPEIATVGVSQAAIDDGEVPARTVMLPLNTNPRAKMSGLRRGFVKI
    FCRPATGVVIGGVVVAPNGSELILPIAIAVQNNLTVNDLAATFSVYPSLTGSITEAARQLMRHDDLD

    >gi|226365757|ref|YP_002783540.1| putative thiosulfate sulfurtransferase [Rhodococcus opacus B4]
    MPVAPDPTQSFAEYANPGRLVSTEWLSANLGTPGLKVVESDEDVLLYDVGHIPGAVKVDWHLDLNDPVTRDYIDGEQFAE
    LMSRKGISRDDTVVIYGDKSNWWAAYALWVFTLFGHEDVRLLDGGRDAWIAENRDTAFDVPETSPTDYPVVERNDAPIRA
    FKDDVLDHLGKGPLIDVRSPQEYTGERTHMPDYPEEGALRGGHIPSAQSIPWAKAAAPDSRFRSRGELNEIYGGVSADDD
    IVAY
    CRIGERSSHTWFVLTHLLGYPNVRNYDGSWTEWGNMVRVPIVRGEEPGHVPGASS

    >gi|226365831|ref|YP_002783614.1| putative molybdopterin synthase sulfurylase MoeB [Rhodococcus opacus B4]
    MKTTEALPPLVEPDAELSRDEVARYSRHLIIPDVGMAGQKRLKNAKVLVIGAGGLGSPALLYLAAAGVGTLGIVEFDEVD
    MSNLQRQVIHGRSDVGRPKGESARDSIREINDNVDVRLHEFRLEPDNAVELFEQYDLILDGTDNFATRYLVNDAAVLAHK
    PYVWGSIYRFEGQASVFWEDAPNGRGLNYRDLYPEAPPPGMVPS
    CAEGGVLGVLCASIGSIMATEAVKLITGIGESLLGR
    LMVYDALDMTYRTIALRRDPARTPVTELIDYDAFCGVVSDEGQAAAAGSTITATELRDLLDSGKEIELIDVREPVEWDIV
    HLPGAVLIPKDRILSGEALSELPQNKPIVLH
    CKTGVRSAEALAALKKAGFSDATHLQGGVIAWAKQVDTSLPVY

    >gi|226365851|ref|YP_002783634.1| glutaredoxin family protein [Rhodococcus opacus B4]
    MTATDTPALTIYSTTWCGYCRRLKTQLDESGIGYVEIDIEDDPASAEFVGSVNGGNHVVPTVKFADGSTATNPSLAQVKQ
    LLGV

    >gi|226365882|ref|YP_002783665.1| hypothetical membrane protein [Rhodococcus opacus B4]
    MSSKNKYNPQPESSRSTYILGGLAVLVIAVLVIGGVIWQSNRSKPRNDGYGGVQNSEVQVALQADGVVLLGKPDAATTVD
    LFEDPM
    CPYCAELENKNGQELAQSIDDGKVAVRYHVLNFLDRLSASGDYSTRAVAASECVAETGDAVAYSAFHAALFSPA
    NQPKENGSSDHTNEELAQIARDAGASDAAAQCITTGASVEQARAHAEAGRQALAASGATGTPAVVKDGTVIDALSNENWV
    SQL

    >gi|226365901|ref|YP_002783684.1| NrdH-redoxin [Rhodococcus opacus B4]
    MSITVYTKPACVQCNATYRALDKAGIEYSVVDITEDPEARDYVMALGYLQAPVIVAGDEHWSGFRPDRIKTLSANAA

    >gi|226366054|ref|YP_002783837.1| mycothione reductase [Rhodococcus opacus B4]
    MTHFDLAIIGSGSGNSLPDDRFADKKIAILEEGTYGGTCLNVGCIPTKMFVYAAEVARTVTGSAKYGVDAQLEGVRWPDI
    VKRVFGRIDPISAGGERYRAEDSPNTTLFRGHATFVGPRTLDTGTGEVITADQVVIAAGSRPIIPGVVRESGVRYYTNDD
    IMRLPELPERMVIIGAGFIAAEFAHVFSALGTRVSLIARSSRLLRHLDDDVSRRFTDLAERKWDVHRGHAVAAVRRDGDG
    VAVELADGTVVSGDVLLVATGRQSNGDAIGAAAGGVDLDDEGRVVVDEFQRTGAEGVFALGDVSSPYQLKHVANHEARVV
    QHNLLQGAWTDTSGLRSSDHRFVPAAVFTDPQIAHVGLTEAEAREAGWDVTVKVQAYGDVAYGWAMEDDEGLCKVVAERG
    TGRLLGAHVIGAQAPTVIQPLIQAMSFGQTAQQMARGQYWIHPGLPEVVENALLGLDLPSE

    >gi|226366256|ref|YP_002784039.1| peptide methionine sulfoxide reductase MsrB [Rhodococcus opacus B4]
    MSSQQQDPTQSAPKVALSDSEWREKLTPEEYAVLRQAGTERPFVGEYTDTKTEGVYHCRACGAELFRSSEKFESHCGWPS
    FFDPSDSDAVILREDTSLGMRRVEVVCATCHSHLGHVFEGEGYPTPTDQRY
    CINSISLTLEPAGE

    >gi|226366596|ref|YP_002784379.1| thioredoxin [Rhodococcus opacus B4]
    MATQSLTQHTFDEVVAGHDLVLVDFWASWCGPCRAFAPTFEASSDKHTDVVFAKVDTEAEQGLAAAANIRSIPTVMAFRE
    GLLVFSQAGVLPPEALDELVTKVKGLDMDEIRRKVAEQTTAQK

    >gi|226366597|ref|YP_002784380.1| hypothetical protein ROP_71880 [Rhodococcus opacus B4]
    MPTPNNHRHSPLGTNLAPEMGAALAAYNAAVFTGPGEIPRKYRELIGIAVALTTQCEACIRFHTEDAVALGASEQELAEV
    TYLAAAMRAGGAVVHGMKALSVAARAAKPLASTGA

    >gi|226366599|ref|YP_002784382.1| hypothetical protein ROP_71900 [Rhodococcus opacus B4]
    METKQTVNGVDLQALNETIEAVRGDRALGKVSFAVNGEWQGGFRVNSQTGGLTQAGQVDNSRLGKFTMSSDEPAPLLGTD
    TAVSPAEYVLQALAG
    CYTVTLAANAASRGIELESYKLELEADFDLASFLGVAPEEAPGAREIRVKVDLSAPGATREELQD
    LVDTVQKRSPIRDTLVRPVDVVTTLA

    >gi|226366600|ref|YP_002784383.1| thioredoxin [Rhodococcus opacus B4]
    MPTVALTQSNFDDTIASNDIVLIDFWASWCGPCRAFAPTFG

    >gi|226366622|ref|YP_002784405.1| hypothetical protein ROP_72130 [Rhodococcus opacus B4]
    MTSTSSATTINGVDKQALHATIDAVRETPALAQVTFSLGSEWLDGCHQRSTTGELHQNGGLVSSREASYVLESDEPAALL
    GTDKAASPAEYVLQALAG
    CYAVTYATNAAVRGIELSSLRLEMQTDFDLQGFLNLDDSVRPGAQEIRIDVHAESPNASTEQ
    LQELTDAVQKRSPIRDTLANPVQVVTTLVK

    >gi|226334828|ref|YP_002784500.1| glutaredoxin-like protein [Rhodococcus opacus B4]
    MSVQVYSKSSCVQCTATHRALDKEGIEYSVIDLEGDPHAVNALRALGYSQAPVVIAGDQHWGGFRPDRIKALVAA

    >gi|226349477|ref|YP_002776591.1| putative copper chaperone CopZ [Rhodococcus opacus B4]
    MSTTTATVTGMTCGHCVSSVREEIGSIPGVTGVDVDLASDRVDIDSDTPIEQEALAQAVDEAGYQLAG

    >gi|226359616|ref|YP_002777394.1| hypothetical protein ROP_02020 [Rhodococcus opacus B4]
    MSVLGQMDSFRRVFPTARRNRADLFRWLRRRPQLLAAVGFHEVALAASARVDPRLKALAEIKAAALTNCEYCLDIGSAFS
    RALGVSDAQLRALPAFRESSAFDDTEKLVLEFADAMTRTPAHISDDLRGSLLAAFSESQVTELAAAIAWENHRGRLNQAL
    GVRPSGFSDSDFCAVPEQ

    >gi|226363920|ref|YP_002781702.1| hypothetical protein ROP_45100 [Rhodococcus opacus B4]
    MRLSVLDHGHRRRATLFLTLTSTMSRVDSPDIVKMLLYRPGFLTRPLLDLTADAMRGPSYWTAGEREYLAMCTAQLYRCP
    F
    CIDTHAELTRIAGRGEIDPADPASARPPLRAVREFLDQLNRTPDRVDATGIADLPEPAVLDALHVNLVWNIVNRLANAF
    GFTLREGQLHSGTRALHRFGYRFPGFLLAEGKTTDHGDVAANLRQSVLNSPATTDPPLRAAAAAGGPLPEPWQSYVTAVR
    DASYTITDTDVTRLTAAGHTEDQIFEVTAAAAVGAALRSFDAGRNALGRRVTD