Rhodococcus jostii RHA1 uid58325

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|111017034|ref|YP_700006.1| glutaredoxin-like protein [Rhodococcus jostii RHA1]
    MTITIYSKPACVQCTATYRALDNEGLDYTIVDITRDPDAHDYVLGLGYLQAPVIVVGDDHWAGFRPDRIRALAAA

    >gi|111017299|ref|YP_700271.1| hypothetical protein RHA1_ro00277 [Rhodococcus jostii RHA1]
    MSNKAVVSLTTGLEDAEKVTVAFLVAVGAAEQQRETLMFLTKEAVRLALDGTIQGVACEGCPPLPDLAARFATAGGIYMV
    CPICFEAKHLDKDALVSNAELAGTVPMWKWIGDEGAVTFSY

    >gi|111017335|ref|YP_700307.1| hypothetical protein RHA1_ro00313 [Rhodococcus jostii RHA1]
    MTVMTHNHRTAPLGDRASSMGQALAAFNASVFTGPGEIPRKYRELMAVAVALTTQCEGCIKVHTNDAVACGASDEELAEA
    TYIAASLRAGGAVVYGLKSLASAERIRNS

    >gi|111017351|ref|YP_700323.1| thiosulfate sulfurtransferase [Rhodococcus jostii RHA1]
    MSRSNFLVDAEWVVEHGHDPDVVLVEVDEDTAQYETNHIDGAVRIDWKRDLQDPVRRDVIDRRSFEKLLSERGIANGDTV
    ILYGGNNNWFAAYAYWYFKLYGHRDVRLLDGGRKKWELDGRPLSSEEVTRPATDYVASEPVSGIRAHRDEVIEQIGSKNI
    VDVRSPDEFSGRILAPAHFPQEQPQVPGHVPTAVNVPWSKAAADDGTFLGEDELRALYGDAGLDETKDIIVY
    CRIGERSA
    HSWFVLHELLGYPDVRNYDGSWVEYGSLVGAPVER

    >gi|111017598|ref|YP_700570.1| hypothetical protein RHA1_ro00577 [Rhodococcus jostii RHA1]
    MRGGPCGGYPRRMTAIPDSTVGTNTAVAGLESTFADELGALTVPWQGAHAPDPTLLVLNEQLAASLRLDVQTLRSEDGVG
    VLSGSTAPAGAKPVAMAYAGHQFGGYAPLLGDGRALLLGELTSSDGQRVDLHLKGSGPTPFSRGGDGFAVIGPMLREYLV
    SEAMYALGIPTTRALSVVATGQNVHRYGAEPGAVLARVAASHLRVGTFEYAVRQGEVLQPLADYAIARHYPELTELPPGR
    DGNRYLSFFEAVVEAQASLVAKWMLTGFVHGVMNTDNTTISGETIDYGPCAFLDAFDPAAVFSSIDHGGRYAFGNQPVVL
    KWNLARLAETLLTLFDSTPDDAITAVSAVLATFDERYDGHYAAGMAAKLGLAGELVDRALVDDLLTLLEEHGADWTGTFR
    ALADELRGHSTPLDGLVPREHIGPWLERWRGDLTKHGRGAAETADAMDCVNPLYIPRNHQLDAALRAATDGRLAPFEKLL
    EVVTHPFDRRDEWSDYTTPAPPSFSKSFQTF
    CGT

    >gi|111017876|ref|YP_700848.1| hypothetical protein RHA1_ro00857 [Rhodococcus jostii RHA1]
    MAVPKIVLFYVFTPLADPEAIRLWQYTLAEANNLTGRILVSEHGINATVGGDIRDVKRYVKGTRSYAPFKDADIKWSDGL
    GDDFPRLSVKVRPEIVTFGAPGELKVDADGVVGGGTHLAPDEVHRLVEGRGDDVVFFDGRNGFEAEIGRFRDAVVPDVST
    TREFVHELDSGKYDHLKDKAVVTY
    CTGGVRCEVLSSLMRSRGFGEVYQLDGGIVRYGEAFGDTGLWEGSLYVFDKRMSIE
    FSDQAKTLGRCSTCGGPTSRYENMPDDRGRELVLVCADCTENRAG

    >gi|111018003|ref|YP_700975.1| thioredoxin [Rhodococcus jostii RHA1]
    MATKTLTQQNFDETVTGNDVVLVDFWASWCGPCRSFAPTFEASSEQHPDVVHAKVDTEAEQGIAAAANIRSIPTIMAFRE
    GVLVFSQPGALPPAALEDLLTQVKALDMDEVRKQIAEQAPAE

    >gi|111018030|ref|YP_701002.1| bacterioferritin comigratory protein [Rhodococcus jostii RHA1]
    MKPGQLAPEFTLPDQDGIARSLSSLLEDGPLVLFFYPAASTPVCTAEACHFRDLGIEFSAVGASRAGISTDAVEKQASFA
    QAQSFDYPLLSDADGAVAEMFGVRRGLLGKLAPVKRSTFVIDTDRTVLEVISSEFRANTHGDQALAFLRTRQST

    >gi|111018153|ref|YP_701125.1| hypothetical protein RHA1_ro01140 [Rhodococcus jostii RHA1]
    MTVQNETAVHGVKMTEAASAKAKALLDQEGRDDLALRIAVQPGGCAGLRYQLFFDDRNLDGDLIVDFGGVALAVDRMSAP
    YVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|111018206|ref|YP_701178.1| thioredoxin-dependent thiol peroxidase [Rhodococcus jostii RHA1]
    MPLEVGTTAPDFTLKDQNNQEVTLSDYRGKKNVLLVFYPLAFTGTCQGELCKVRDELPKFENDETAILALSVGASPTHKI
    WSAEQGYTFPLLADFWPHGAVAQQYGVFNEKLGFANRGTFVIDKEGVIRFAEMNGPGEARDQEAWEKALATLES

    >gi|111018388|ref|YP_701360.1| hypothetical protein RHA1_ro01380 [Rhodococcus jostii RHA1]
    MSAGTNAGTARDVADFWFDPLCPWCWITSRWILEATQVRDLQANFHVMSLAVLNEGRDLPEEYRELMTKAWGPVRVLIAA
    AQKHGDEILLPLYTAMGTLIHNEGNKDFGDVIVKSLAEVGLPAELAEAAESEEYDTALRESHAAGMDAVGPDVGTPTIHV
    NGVAFFGPVLSRIPRGEDAGKVWDGAVALAGYPHFFELKRTRTEDPQFD

    >gi|111018428|ref|YP_701400.1| bacterioferritin comigratory protein [Rhodococcus jostii RHA1]
    MTDNNRLAPGDTAPAFTLPDADGNDVSLADYRGRKVVVYFYPAASTPGCTKQACDFRDNLADLNGAGLDVIGISPDKPAK
    LAKFRDNEELTFPLLSDPDKATLEAWGAFGEKKMYGKTVQGVIRSTFLVDEDGKIEVAQYNVRATGHVAKLRRDLSV

    >gi|111018457|ref|YP_701429.1| thioredoxin [Rhodococcus jostii RHA1]
    MDVTRPGSRPSARSSAVAAAMSGAVDLSALKERAAAPPPPVSAPSGDGAAPAAPGSTGLAPVIDVTEATFEAEVLVRSQQ
    VPVVVDLWATW
    CEPCKQLSPLLEKLAREAGGTWVLAKVDVDANPRIAQAFGVQSVPTVVAIAGGQPLADFQGAQPEPQLR
    QWLAAVQQATAGKLSGPPAADGNADEPEPEDPRFVAAEAALDEGDLSAAEAEFQKILDEEPANAEAQGAIRQVRFLARVQ
    SVDPGAVAAADAAPDDIDAQLQAADVEVYSQAPDAAFARLIGVVARSAGDDKTRVRTRLLELFELFDPAEPVVMTARRKL
    AAALY

    >gi|111019028|ref|YP_702000.1| thioredoxin [Rhodococcus jostii RHA1]
    MSRGRFAGLLAVICTAAVSLTACASGDDAVAQGGTFDFVSPGGQTEIFYDPPADRGTIGTVSGPDLMTEGKTTSLDDFEG
    QVVVLNVWGQW
    CGPCRGEANDLEQVYEETKDQGVSFLGINVRDNQQDKAQDFVIDNKVSYPSIYDPAMRTMIALGQNYPT
    SVIPTTIVLDREHRVAAVFLKELLAEDLKPVVERVAQES

    >gi|111019048|ref|YP_702020.1| hypothetical protein RHA1_ro02055 [Rhodococcus jostii RHA1]
    MSTGGHEVTLLTRAGCGACAPARELLLVLCEEFGLELTCIDVDEVAATDPELRAEFGDRLPVVLLDGREHSYWEVDEERL
    RSDLRK

    >gi|111019133|ref|YP_702105.1| dihydrolipoamide dehydrogenase [Rhodococcus jostii RHA1]
    MTSHYDVVVLGAGPGGYVAAIRAAQLGLSTAIIEQKYWGGVCLNVGCIPSKALLRNAELAHLFTKEAKTFGISGEASFDF
    GAAYDRSRKVADGRVKGVHFLMKKNKITEYDGKGSFTDANTLSVELSKGGTETVTFDNAIIATGSTTKLLPGTSLSENVV
    TYEEQILTRDLPESILIVGAGAIGMEFGYVLKNYGVDVTIVEFLDRALPNEDADVSKEIEKQYKKLGVTIKTGAAVQSID
    DDGSKVTVSIKNNKSGDIETVVVDKVMQSVGFAPRVEGYGLEKTGVQLDRGAIGITDTMQTSVPHIYAIGDVTMKLQLAH
    VAEAQGVVAAETIAGVETLPIEDYRMMPRATFCQPQVASFGLTEQQAKDEGYDVKVATFPFTANGKAHGLGDPTGFVKLI
    ADKKYGELLGGHLIGPDVSELLPELTLAQKWDLTVNELARNVHTHPTLSEALQEAIHGLAGHMINF

    >gi|111019322|ref|YP_702294.1| methylated-DNA--[protein]-cysteine S-methyltransferase [Rhodococcus jostii RHA1]
    MNIPDIVYALSTSDSAVEQKLRERLAALAAEAGLLDVAYRTLDTPVGSLLLAATDRGLVRVAFPSQDHDAVLQTLAEQIS
    PRILRAPARLDRVAHEIDEYFLGERTSFDIPLDFRLSKGFRLEVLHHLPEIDYGHTASYAAVAAAAGSPKAVRAVGTACA
    LNPLPVVVP
    CHRVVRSDGSMGQYAGGPEAKSILLTLEAAA

    >gi|111019324|ref|YP_702296.1| methylated-DNA--[protein]-cysteine S-methyltransferase [Rhodococcus jostii RHA1]
    MNADRAAHTVIDSPIGPLTLVSVDGVLSGIYMVEHRHQPNPATFGERDTAGFDEAITQLTEYFDGRRTEFTVPLAARGTL
    FQQRVWDALRTIPYGETWTYGQLADSLGTPTAVRAVAAANGRNPISIIVP
    CHRVIGSNGSLTGYAGGLDRKRFLLEREAE
    RASG

    >gi|111019918|ref|YP_702890.1| dihydrolipoamide dehydrogenase [Rhodococcus jostii RHA1]
    MSHRSADVVILGGGSGGYAAAIRSAELGRSVILVEENELGGTCLHQGCIPTKALLHSAEVADSARTASQFGIDVTFDGVD
    LEKVLSYQNTIVTRLHKGLQGLVDSYGITVVNGRGRLVGPNGVEVDDELITGAAVVLATGSSPKTLPGISIGGRIVTSEQ
    ALVLPSVPKKAIILGGGVIGVEFASVWASFGASVTIVEAMPRLVPNEDETTSKYLERAFRRRKIAAKTGVRVTEVTQDED
    AVSVTLDSGDVLDADVVLVAVGRGPNTASMGYEETGVMLDKGFVVTSDRLRTTVPNVFAVGDIVPGLQLAHRGFQQGIFV
    AEEIAGLRPDVVDETGIPRVTYSHPEVASVGLTETAAREKFGENVETVTYDLAGNGRSQILKTSGAVKLVVAPTGVVVGV
    HMVGDRVGELIGEAQLLYNFEVDAAQAAKFVHAHPTQGEALGEALMAVAGKPLHVHG

    >gi|111020170|ref|YP_703142.1| glutaredoxin-like protein [Rhodococcus jostii RHA1]
    MTVTVYTKPDCVQCNSTYRALDKKGIDYSIVDLTENLSARDRVMGLGYLQAPVVVAGDQHWSGFRPDRIAALANWELLQP
    IQQIVP

    >gi|111020264|ref|YP_703236.1| alkyl hydroperoxide reductase [Rhodococcus jostii RHA1]
    MALINTQIKPFAANAFKDGAFITVSADDIKDKWAVFYFYPADFTFVCPTELGDLADHHEELQRLGVEVFSVSTDTHFTHK
    AWHGSSDTIGKIKYAMIGDPTQEISKNFEVLRENEGLADRGTFLVDPDGVIQFTEVTAEGIGRNAAELVRKVKAAQYVRS
    HPGEVCPAKWEEGEETLAPSLDLVGKI

    >gi|111020265|ref|YP_703237.1| alkyl hydroperoxide reductase subunit F [Rhodococcus jostii RHA1]
    MLEASLAGQLKSLLEKLTLPIELVSSLDDGPKSVELAELLTQIAAMSEKITYERRDDDTRRPSFAVRRSGTDIEVRFAGI
    PLGHEFTSLALALLQVGGHPSKEAPELLEQVRDLDGDFHFETYFSLS
    CQNCPDVVQALNLMCVLNPRISHVAIDGALFQD
    EVDGRQIMAVPTVFLNGELFGSGRMSLEEIVGKLDVGAADRAAAAIAQKDPFDVLVVGGGPSGAAAAVYAARKGIRTGIA
    AERFGGQVLDTMAIENFISVPYTEGPQFGSALENHVRQYGVDIMNTQRAAKLVPAATENGLVEVELESGASLLARTVILS
    TGARWRSMNVPGEDAYRNKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGLVEHVTLVEFDSVLRADEVLQRKLR
    SLPNADILLSTLTTEVLGDGNKVTGLTYQDRTTDTSHTLDVEGVFVQIGLLPNTEWLAGSVELSDRGEIAIDDRGQTSVP
    GVFAAGDCTTVPYKQIVIAAGAGATAALSAFDRLIRTGVPAEESTAATVA

    >gi|111020307|ref|YP_703279.1| dihydrolipoamide dehydrogenase [Rhodococcus jostii RHA1]
    MADAHSDVLILGGGSGGYACAFRAAQLGLSVTLIEADKIGGTCLHRGCVPTKALLHSAEVADTARTGAAFGVRTTFDGID
    IEAVHQYKNGTIDRLHRGLQGLVAHHKISGVSGHGKYAGDRTIEVDGTRYTGTSVVLATGSYARTVPSIELGERIVTSDD
    ALNLGFVPKKAIVLGGGVIGVEFASVWASFGAEVTVVEALPRLVAAEDPWCSKQLERAFRKRGIAARAGVTVAAAKETAD
    GILVELDGGETLEAEILLVAVGRAPRTGDSGFAEHGITLDRRFVVTDERLRTDVDGVYAVGDVVAGLQLAHRGFQQGVFV
    AEEIAGLDPVPVAEHLVPRVTYSHPEVASVGLTEDAARERYGDVTSVVYDLAGNGKSQILKTSGGIKVIRAGDAGPVVGV
    HMVGDRVGELIGEAQLTVAWEALPTDVAPFVHAHPTQNEALSEAMLALSGKPLHAHG

    >gi|111020366|ref|YP_703338.1| dihydrolipoamide dehydrogenase [Rhodococcus jostii RHA1]
    MSDQPDVLILGGGSGGYACAFRAAQLGKTVTLIEEDKVGGTCLHRGCIPTKALVHAAEVADTVTHASALGLGATLDGIDL
    GGVHAYKNATVERLYKGLQGLVRSHKIEVVHGTGRYGGGRTVHVGDRTITGASLVLATGSQVRGLPGLEIGGRILTSDEA
    LTFPELPKRVVVLGGGVIGVEFASIWASLGADVTIVEALPRLVAAEDEWSSKQLTRALRKRGITIMTATRFAKAVQDEST
    VSVTVESGDTIEADLLLVAVGRGPRTPDIGLTENGVVLDSRGFVTVDDSLRTSQPDVYAVGDIVAGPQLAHRGFQQGIFV
    AETIAGLTPTPIEDSGIPRVTYSKPEVASVGLTEDQARERHGDVATVVYDLAGNGKSQILGTSGGVKLVRAGATEGPVVG
    IHMVGERVGELIGEAQLIVNWGAYPDDVATLVHAHPTQAEALGEAHLALAGTPLHSHS

    >gi|111020524|ref|YP_703496.1| Cu(2+)-exporting ATPase [Rhodococcus jostii RHA1]
    MSTSSVTVSGMTCNHCVSSVTEEISALPGVTNVNVDLATGKVVIDSTTDLDPSAVAGAVEEAGYSVAG

    >gi|111020526|ref|YP_703498.1| cation transport ATPase [Rhodococcus jostii RHA1]
    MTRGTDIAAPPDSQIELAIGGMTCASCANRIERKLNKLDGVTATVNYATEKARVHYDAADVSPEDLVATVEQAGYTARLP
    EVKPPAPEEEDPAAELRQRLLASAVLTVPVIAMAMIPALQFTNWQWLSLTLAAPVVVWGAWPFHKAAWTNLRHGTATMDT
    LVSMGTLAAFGWSLYALFWGTAGMPGMTHPFELTIARVDGTGNIYLEAAAGVTTFILAGRFFEARAKRRAGAALRALLEL
    GAKEVSVLRDGTEQLIGIDQLDVGDLFVVRPGEKIATDGVVVEGSSAVDASMLTGESVPVEVSPDSQVAGATVNVGGRIV
    VRASRIGADTQLAQMAWMVEDAQTGKAEVQRLADRISGIFVPIVIALSVATLGFWIGTGGSIAAAFTAAVAVLIIACPCA
    LGLATPTALMVGTGRGAQLGILIKGPEVLESTRRVDTVVVDKTGTVTTGTMSLHDVVAADGQDEEQVLRYAGALEDASEH
    PIARAITRGAKERLTTLPAVEQFTNIAGLGVQGMIDGHAVVIGRAKLLRDWSLQLTTELQRVADAAESEGKTAVGIGWDG
    KARGVLVVADTVKPTSREAVAQFRELGLTPIMLTGDNTSAARAIAAQVGIGEVVAEVLPQDKVDVIKRLQADGKVVAMVG
    DGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLRAAADAIRLSRRTLSTIKGNLFWAFAYNVAALPLAAAGLLNP
    MLAGAAMAFSSVFVVSNSLRLRRFQPLTTPTRGEHS

    >gi|111020639|ref|YP_703611.1| thioredoxin-disulfide reductase [Rhodococcus jostii RHA1]
    MTTPSTVHELIIVGSGPAGYTAAVYAARAELEPLQFEGTQFGGALMTTTEVENFPGFREGIMGPDLMDQMREQAKRFGTD
    IRTEDVEELDLTGPIKKVVVNGETYQAHAVVLAMGAAARYLGIPGEEKLLGRGVSA
    CATCDGFFFKDQDIVVVGGGDSAM
    EEATFLTRFARSVTVVHRREEFRASRIMLERAKANAKIRFVTNAAPVEVLGENSVTGLVIRDTVTGETSTLDVTGMFVAI
    GHDPRSELVKGQVDLDDAGYVLVKTPTTATSVDGVFAAGDLVDHIYQQAITAAGTGCSAAMDAERWLAERGDITANTVAA
    AGLPVDA

    >gi|111020640|ref|YP_703612.1| thioredoxin [Rhodococcus jostii RHA1]
    MSNTVTITDDSFQQDVISSDKPVLVDFWATWCGPCKMIAPVLEEIAGEHSEKLTIAKLDIDANPGAARDFQVMSIPTLIL
    FKDGKPINTIVGTKGKAALLKELADVL

    >gi|111020884|ref|YP_703856.1| hypothetical protein RHA1_ro03898 [Rhodococcus jostii RHA1]
    MSSTAPENEYVHIDKQSPAVYQAQIAVAKAVRHATTEVGMDRRFVELINVRVSQINRCAYCLDVHVAAVLAAGETQQRLA
    VLPAWRETTLFSDREVAALTLAESITTLPDAHTQEADYAFARQFLSDPEISTVSWIAVTMNAFNRISIVSRHPVRPKQ

    >gi|111020994|ref|YP_703966.1| protein-methionine-S-oxide reductase [Rhodococcus jostii RHA1]
    MVTAEDALPGRSQPIPVPATHFVNGHPLQPPFPEGMQTAVLGMGCFWGAEKEFWQLDGVYTTAVGYAGGYTPNPTYEETC
    SGRTGHTEVVLVVFDPKVISYAEILKEFWENHDPTQGMRQGNDQGTQYRSAIYTIDEQQVEIAEATGEAFEKRLAQAGYG
    AITTEIAPLTQFYYAEDYHQQYLAKNPGGYCPVHATGVSCPVGLLKQDEVPAQTDILPPS

    >gi|111021087|ref|YP_704059.1| thioredoxin-disulfide reductase [Rhodococcus jostii RHA1]
    MEDSYDVVVVGGGAAGLGGALALSRARRSVLVIDAGAPRNAPAGHIHNYLGREGTPPGELLAIGREEVAGYGGEIVTGTV
    TSADRVGDGQFRVTLADGATVRARRLLVTTGLVDVLPDIPGVAERWGRDVLH
    CPYCHGWEVRDQPVGVLAGSPPAVHQAL
    MWRQWTDNVTLFLNDANEPTGEEYEQLAARGIAVIDGGVAGLEVQDDRLTGVRLRTGQVFSLTAVVVPPLFRARADFLTS
    LGLDTTEMEMAGHVIGTAVAADATGATAVPGVWVAGNVADPKAQVIVAAGASLSAAAALNADLIAEDTRLAVAGALSR

    >gi|111021300|ref|YP_704272.1| thioredoxin [Rhodococcus jostii RHA1]
    MSSAARWSLAALVVVVALVVAIWPRGDDAETPSYQDRFGSGGRTPTAVSADPDALAALRTQAGLASCPAATATSEPSPGS
    VLSGITLECVGDGSQVDLAAALGGKPALLNLWAYW
    CGPCAEELPYMQQFSDRAGDAVTVLTVHTDPNEASALSRLVDYSV
    TLPGVQDADGRVRAAVGAPPVLPVSVLIRPDGTVAKVLPQPFRSVDEIADAVEQNLGVAA

    >gi|111021398|ref|YP_704370.1| osmotically inducible protein C, OsmC [Rhodococcus jostii RHA1]
    MPTRTARTAWNGSLEQGSGQVELTSSGVATFDVSFPKRAAEEAGGTTSPEELIAAAHSSCYAMQLSALIAEAGGTPQSLE
    VKADVSLGPDNPGFKLTGIKLTVRGEVDGLDADGFAKAAQAAKES
    CPVSKALTGVEITLDAALEA

    >gi|111021404|ref|YP_704376.1| dithiol-disulfide isomerase [Rhodococcus jostii RHA1]
    MKTQQNTDSDIEIEIWSDVACPWCYIGKHRFLSALAEFEGGDRVNVVWRSYQLSPETPVGERRSELDALVESKGMPAEQV
    RQMFGHVARTAADEGLSLDFDTVIAANTFDAHRLIHLAGDERDAVVEALFRAHFGEGAVIDDREVLVDIASRAGLDADTV
    RAELESDAGADAVRADLETARRLQVSAVPFFVANRRVAVSGAQPKDVFLQLLTQASAVPVN

    >gi|111021794|ref|YP_704766.1| glutathione peroxidase [Rhodococcus jostii RHA1]
    MVRMTTPVQNIGINTLGGTPTSLGEYDGRAVLVVNVASKCGLTPQYKGLEKLATDYADRGLTVIGVPCNQFMGQEPGTAE
    EIETFCSTTYGVTFPLLEKIEVNGENRHPLYEELTKATDAEGAAGDIQWNFEKFLVAPDGTVVKRFRPRTEPDAPEVVEA
    IEAVLPK

    >gi|111021827|ref|YP_704799.1| thiosulfate sulfurtransferase [Rhodococcus jostii RHA1]
    MARSDVLVSADWAEQNLNAPKTVFVEVDEDTSAYDGGHIEGAIRLDWRKDLQDGVRRDFLNQQQFSDLLSAKGVANDDTI
    VLYGGNNNWFAAYAYWYFKLYGHQDVKLIDGGRKKWELDGRPLSKETVTREATQYKAEAPDLSIRAFRDEVIDAIGSKNL
    VDVRSPDEFSGKILAPAHLPQEQAQQRGHIPTAINIPWSTTANEDGTFKSDDDLEKLYSEKGYDESKPTIAY
    CRIGERSS
    HTWFVLKEILGKSDVKNYDGSWVEYGSLVGAPIELEVH

    >gi|111021829|ref|YP_704801.1| thioredoxin [Rhodococcus jostii RHA1]
    MTGITLLLIALFAAVAFGLVWQRREGTVRSTGGTTGVVTDQRRLLLEAAGVGPASPEHPRRATVLHFSADWCGPCAAVRR
    VVGQVVADLAGEPEPPVEVEVDIDEYPALAKELGVLSLPTTFILDADLQQRFRVSGVPAATDLRAALEPLTRPPASNS

    >gi|111021865|ref|YP_704837.1| organic hydroperoxide resistance protein [Rhodococcus jostii RHA1]
    MKIVYTAEALATGEGRNGHARTSDGRLDLNLAIPTEMGGSGDGTNPEQLFAAGYAACFHSALQLVARQAKANVADSAVGA
    RVGIGATDGGGFGLAVTLEVSLPHLPRAEALELTEKAHQV
    CPYSNATRGNIDVTLEVTED

    >gi|111022037|ref|YP_705009.1| hypothetical protein RHA1_ro05070 [Rhodococcus jostii RHA1]
    MTTASVSHLASVIGVTRDAVSEDSANAHVVFRASAQAHDAVASTVTLGKYSVEVDEPPALGGDNSAANPVEYYLASLLSC
    QVVTYRFWAEKLGVRVDDISARAEGDLDVRGFFGFDDAVRAGFGEVRVVVTLTGPESRERYLELQEAVDAHCPVLDLTRN
    QTPVHTVVETLTGDN

    >gi|111022321|ref|YP_705293.1| hypothetical protein RHA1_ro05355 [Rhodococcus jostii RHA1]
    MTTSSTDGRVAITYCTQCQWLLRAAWMAQELLGTFGQELGEVALVPGTGGIFRITVDDELIWDRKEQGGFPDITVLKQLV
    RDRVAPDRHLGHSDRKSP

    >gi|111022339|ref|YP_705311.1| thiosulfate sulfurtransferase [Rhodococcus jostii RHA1]
    MVTIDALAESLSGDAPPVLLDVRWALGDTEGRRHYLDAHIPGAVFVDLDTELAAPGSPELGRHPLPTVADLQDAARRWGV
    RAGSPVVVYDATGNLAAARAWWLLRWAGVADVSMLDGGLGAWMSAGRPVRSGDEHPPLPGDVVLTAGHLPTLTADEAAEF
    AADGCLLDARAAERYSGATEPIDPRAGHIPGARSVPTSENLGPDGRFAPAEALRERFAVVGAEPGRPVGVY
    CGSGVTAAH
    QVAALALAGVDAALYPGSWSQWSSDPGRPVATGPDRR

    >gi|111022519|ref|YP_705491.1| methylated-DNA--[protein]-cysteine S-methyltransferase [Rhodococcus jostii RHA1]
    MTTGIALFDTALGTCAIAWRAAGIVGVQLPEGSPESTRQRLEHCFPDAVEHQPPAPVQRAIDGIREHLGGALDDLRWIDL
    DFEGVPEFDCTVYDIARAIDPGTTLTYGDIAAELGKPGAAQAVGQALGRNPLPIVIP
    CHRVLAAGGQVGGFSAGGGTLTK
    RELLALEHTPGFDDPVLF

    >gi|111022528|ref|YP_705500.1| dihydrolipoyl dehydrogenase [Rhodococcus jostii RHA1]
    MTDSGSGAEEFDVIVIGGGPAGENAASYAIAGSDRTAALIEHELVGGECSYWACMPSKALLRPGEVLGAARNMPGVSAGP
    LDVDAVLARRDSFTSNHDDSSQVMWADSQGIDVIRGSARITGDRTVTVGDSRQLRARHAVVVATGTTAAVPDTPGLRASL
    PWISRDATNLREIPRRVAVIGGGVVACESATWLLDLGVEELTMVVRGRALLPKNEPFAGERVARSLEKKGARILFGADLR
    GVERADARDTGIGRIHGGPVTLDVAGQDPLVVDEVVVATGRTPATSALGLDARLLNSHGFLTTDDHLTTADEWLYAVGDA
    NGRALLTHMGKYQARVCGDVIAARAEGRPLEGARFRATADHGQVPQVVFADPEVSAVGITEKEARDAGVDVETVEVDIAV
    AGSSLARDDFSGHAKLVIDRATDTLVGATFAGTDVGELIHAATIALVGKVPLDTLWHAVPSYPTVSEVWLRLLEARS

    >gi|111022620|ref|YP_705592.1| arsenate reductase [Rhodococcus jostii RHA1]
    MSGMANTATIYHNQRCNTSRTVLGLIRDAGIEPTVVKYLETPPSRDGLRKLLDDAGLKPSEAIRTKETVFKELGLAEASE
    DELLEAMVDNPILIERPIVVTDKGTVLARPAEKVREVL

    >gi|111022817|ref|YP_705789.1| hypothetical protein RHA1_ro05854 [Rhodococcus jostii RHA1]
    MDPRAQNTLGGSTSPYLRQHADNPVHWQQWGPEATEWARERDVPILLSIGYSACHWCHVMAHESFEDEAVASLMNEHFVC
    VKVDREERPDLDAVYMNATVAMTGQGGWPMTCFLTPDGAPFYCGTYYPAAPRGGMPSFTQLLGAIADTWRDRRGDVDDAA
    ASVVAELRRGAGGIPEGDVQVDAALLDAAAGAVLRDEDADRGGFGGAPKFPPSALMEGLLRTYERSGAEEVLGVVARTAS
    AMARGGIYDQLGGGFARYSVDAAWVVPHFEKMLYDNAQLLRAYAHLGRRTGSDLAVRVTEETVEFLLRDLRTDNGSFASA
    LDADTEGVEGLTYVWTPAQLVEVLGPEDGEWAARVFAVTADGTFEAGTSVLQLPRDPDDWDRWSRIRGTLLAQRATRPQP
    GRDDKVVTAWNGLTITALAEAGAGLGRPEWVAAAADCARAVLGLHVVDGRLRRASLGTSVGESAGVLEDYACLATGLLAL
    YQATGDSEWLTHAQALLDRALIHFADYERPGSWFDTADDAESLVTRPRDPVDGATPSGASCLVEALLTAAAVADGEASGR
    YATAAAESLDRVALLLERAPRSAGHWLAVAEASVRGPIQVAVATDGDSVLLREARRLAPGGAVVVGGEPDSSPLLADRPL
    VGGASAAYVCRGFVCDRPVSTVADLGAALSR

    >gi|111023186|ref|YP_706158.1| iron ABC transporter substrate-binding component [Rhodococcus jostii RHA1]
    MHGQLFRSTGLAALVAALVVAGCSRGESVGQTASAESFAEPVSVTNCDRTETFDAPPQRIVSMNDHVTEVLIEMGAGDRI
    VGTGYGDATPLPEFADAFGKIPKLAKEYPTREQILDLDPDLVVGGMRSAFDEKEGRSRESLGDQGIPTFLFSEY
    CGHGFP
    DIGLLRGDYQQLGEILGVPDRARAITDRVTSGLQAVRDEIAGTAPVPTFFYDSGEDVPLTIGGVGVGQLIADHAGAANLF
    AEGEKPYSKSTWEIIGERAPEAIVVLDYGTTSARAKIDFLKSHPIMSTTPAVKAGRFVVVPLDDFFESPRLVRSVETIAR
    ALHPDVVGAR

    >gi|111023192|ref|YP_706164.1| rhodanese-related sulfurtransferase [Rhodococcus jostii RHA1]
    MIEVDLNALDGALASGAPVIDVREADEYAQARVPGVTLIPLSEFVARVDEIPEAEVVYVICGVGGRSLQAAEYLNARGIN
    AVSVAGGTSAWMQSGRPVESGA

    >gi|111023225|ref|YP_706197.1| flavoprotein disulfide reductase [Rhodococcus jostii RHA1]
    MTRIVIIGGGPAGYEAALVAAQHGASVSLIDSDGVGGACVLFDCVPSKTFIASTGVRTDMRRASDLGIALDPEQATVALP
    QIHARVKSLAQAQSSDIRTRLQTVGVELLSGTAEIADPRLGMASHQVCATLENGEKKTLDADVVLIATGASPRVIPGAEP
    DGERILTWRDLYDLDELPTHLVVVGSGVTGAEFVSAYTEMGVKVTLVSSRDRVLPGEDADAALVLEDVLAERGVTLVKHA
    RADAVKRTEDGIVVVLADGRTVEGSHALMTVGSVPNTQGLGLEKVGIELDKGGYLRVDRVSRTPVSGIYAAGDCTGLLPL
    ASVAAMQGRIAMYHALGEGVSPIKLKTVASAVFTRPEIATVGVSQAAIDDGEVPARTVMLPLNTNPRAKMSGLRRGFVKI
    FCRPATGVVIGGVVVAPNGSELILPIAIAVQNNLTVNDLAATFSVYPSLTGSITEAARQLMRHDDLD

    >gi|111023248|ref|YP_706220.1| thiosulfate sulfurtransferase [Rhodococcus jostii RHA1]
    MPVAPDPTQSFAEYANPGRLVSTEWLSANLGTPGLKVVESDEDVLLYDVGHIPGAVKVDWHLDLNDPVTRDYIDGEQFAD
    LMSRKGISRDDTVVIYGDKSNWWAAYALWVFTLFGHEDVRLLDGGRDAWIAENRDTAFDVPETSPTDYPVVERNDAPIRA
    FKDDVLDHLGKGPLIDVRSPQEYTGERTHMPDYPEEGALRGGHIPSALSIPWAKAAAPDSRFRSRGELNEIYGGVSADDD
    IVAY
    CRIGERSSHTWFVLTHLLGYPSVRNYDGSWTEWGNMVRVPIVRGEEPGDVPGASS

    >gi|111023324|ref|YP_706296.1| molybdopterin biosynthesis-like protein MoeZ [Rhodococcus jostii RHA1]
    MSLDRSVKTTEALPPLVEPDAELSRDEVARYSRHLIIPDVGMAGQKRLKNAKVLVIGAGGLGSPALLYLAAAGVGTLGIV
    EFDEVDMSNLQRQVIHGRSDVGRPKAESARDSIREINDNVDVRLHEFRLEPDNAVELFEQYDLILDGTDNFATRYLVNDA
    AVLAHKPYVWGSIYRFEGQASVFWEDAPNGRGLNYRDLYPEAPPPGMVPS
    CAEGGVLGVLCASIGSIMATEAVKLITGIG
    ESLLGRLMVYDALDMTYRTITLRRDPARTPVTELIDYDAFCGVVSDEGQAAAAGSTITATELRDLLDSGKEIELIDVREP
    VEWDIVHLPGAVLIPKDRILSGEALSELPQNKPIVLH
    CKTGVRSAEALAALKKAGFSDATHLQGGVIAWAKQVDTSLPVY


    >gi|111023343|ref|YP_706315.1| glutaredoxin [Rhodococcus jostii RHA1]
    MTATDTPALTIYSTTWCGYCRRLKTQLDESGIGYLEIDIEDDPASAEFVGSVNGGNHVVPTVKFADGSTATNPSLAQVKQ
    LLGA

    >gi|111023378|ref|YP_706350.1| serine/threonine-protein kinase [Rhodococcus jostii RHA1]
    MSSKNKYNPQPESSRSTYILGGLAVLVIAVLVIGGVIWQSNRSKPRNDGYGGVQNSEVQVALQDDGVVRLGRPDAATTVD
    LFEDPM
    CPYCAELENKNGQELAQAVDDGKVAVRYHVLNFLDQLSASGDYSTRAVAASECVAETGDAVAYSAFHAALFSPS
    NQPKENGSSDHTNEELAQIAGDAGASDEAVQCITTGAKVEQARAHAEAGRQALAASGATGTPAVVKDGTVIDALSNENWV
    SQL

    >gi|111023400|ref|YP_706372.1| glutaredoxin-like protein NrdH [Rhodococcus jostii RHA1]
    MSITVYTKPACVQCNATYRALDKAGIEYSVVDITEDPEARDYVMALGYLQAPVIVAGDEHWSGFRPDRIKTLSANAA

    >gi|111023569|ref|YP_706541.1| mycothione/glutathione reductase [Rhodococcus jostii RHA1]
    MTHFDLAIIGSGSGNSLPDERFADKTIAILEEGTFGGTCLNVGCIPTKMFVYAAEVARTVGNSAKYGVDAELEGVRWPDI
    VKRVFGRIDPISAGGERYRAEDSPNTTLFRGHATFVGPRTLDTGTGEVITADQVVIAAGSRPIIPDVVRESGVRYYTNDD
    IMRLPELPERMVIIGAGYIAAEFAHVFSALGTRVSLIARSSHLLRHLDEDVSRRFTDLAQKKWDVHRGSTVAAVRRDGDG
    VVVELEDGTVVSGDVLLVATGRQSNGDAIGAAAGGIDLDDEGRVVVDDYQRTSAEGVFALGDVSSPYQLKHVANHEARVV
    QHNLLQDAWTDTSGLRVSDHRFVPAAVFTDPQIAHVGLTEAEAREAGWDITVKVQAYGDVAYGWAMEDDEGLCKVIAERG
    TGRLLGAHVIGAQAPTVIQPLIQAMSFGLTAQQMARGQYWIHPALPEVVENALLGLDLPAE

    >gi|111023662|ref|YP_706634.1| thioredoxin [Rhodococcus jostii RHA1]
    MGSDKVKCPHCGKVNKVPAAGDGKPRCGNCHEPLPWIAAAGDDDFAEVADKSSVPVLVDLWATWCGPCRMVSPALEQLAR
    ERAGQIKLVKVDVDAAPQTAERFTVRAVPTLLVMDRGEVLARQAGAAPVPQLRTWLDQALSENAGKEAKS

    >gi|111023820|ref|YP_706792.1| methionine sulfoxide reductase [Rhodococcus jostii RHA1]
    MSSQQQDPTQSAPKVALSDSEWREKLTPEEYAVLRQAGTERPFVGEYTDTKTEGVYHCRACGAELFRSTEKFESHCGWPS
    FFDPADSDAVILREDTSLGMRRVEVVCGTCHSHLGHVFEGEGYPTPTDQRY
    CINSISLTLEPTGE

    >gi|111023896|ref|YP_706868.1| hydrolase [Rhodococcus jostii RHA1]
    MIFKQYVLGCLSQLSYLVGDQTTGRAVVVDPHRDVSVYLADAEQAGLRIERVIETHFHADFLSGHLELAALGATICYGEG
    AQADFDIEVLADGQRLDLGEVQLEIRATPGHTPESISVVIHAHPADAEPYGVLTGDALFIGDVGRPDLLGSVDLSADMMA
    RQLYRSISEKFLTLPDRTRVFPAHGAGSACGKNLSTSNSSTIGEQRRTNYALAPMTEDQFVAVVTEGQPVTPPYFSFDAR
    RNRELRPLLDDHQLPPALSLSTALSLRERGAVVLDTREPADFAAGHLRGSVNVGLGGRFAEWAGDVLRPDTAIVLV
    CEPG
    RELEAKVRLGRIGFDNVAGYLEEPTRALGHPQLVERSSRLTADELDVRRAELGDLVVVDVRSRGELERGVIDGSVHIPLA
    RLLDRVGEFAYGTPTVVY
    CASGYRSMIAASLLSLVGLADVSDLLGGYEAWAGATRI

    >gi|111023898|ref|YP_706870.1| peroxiredoxin [Rhodococcus jostii RHA1]
    MTLQLGDTAPDFHADTTEGRIGFHDWLDGSWAVLFSHPKDFTPVCTTELGYLARIKPEFDRRAVKIIGLSVDHVDKHRDW
    ATDIEQTQGVAPNYPVIGDSDFAVSKLYGMLPASTTGDPATRTPADNQTVRNVFVIGPDRKIKLILVYPMTTGRNFDEVL
    RVIDSLQLTANHKVATPVNWRQGDDVIIAGAVSNSEAKQIFGTWEEPKPYIRIVPQPV

    >gi|111024060|ref|YP_707032.1| hypothetical protein RHA1_ro07110 [Rhodococcus jostii RHA1]
    MTSVNLGEQHPSVYQNLMMLDAGVKAALETAGVDPLLVELVKIRVSQLNGCAFCLRLHTRAALAKGESADRLAVVAAWWE
    SQYFSDKERAALALAEQVTALAVPDRRAWDDGSLTDVQVSAIGWLATVMNAWNRVAITSHYPVAP

    >gi|111024922|ref|YP_707342.1| cyclohexanone monooxygenase [Rhodococcus jostii RHA1]
    MTASQADTATRTGKHSNNDVLDVLIIGGGFSGLYALDRIRDLGFTAKVWDAAGGLGGIWWWNCYPGARTDSTGQIYQFSH
    KDLWKKYDFAELYPGHDGVRNYFEYVDSQLDLTRDVVFDTFAESCTWDEETRQWTARSADGKVQNARQVIVATGFGAKPL
    YPNLEGLDLFAGD
    CYHTARWPQEGVDMTGRKVVVMGTGSSGVQVVQEAGHVAEHVTVFQRTPNLAIPMQQRALTHDDNEQ
    FRKGLPERFEARYKAFAGFDFDFLPQNAADLSMEERDAIYEKMWAEGGFEMWLGNFQDILVDEDANRTFYDFWRNKVLER
    VTDPKKAAIVAPETPPHPYGVKRPSLEQDYFDVINQSNVEVIDSNLTPIRRVLPHGIETDDGVIECDLLVLATGFDNNSG
    GIMAIDITGVDGLSIQDKWKSGVDTCMGLSTRGFPNMMFLYGPQSPSGFCNGPTSAEYQGEIVVEFLQHLRDNGITRFEN
    TEESEKQWRAHVDELFVNSMFTKARSWYWGANVPGKPAQMLNYSGGVPQYFARWDKIKANGYAAFETN

    >gi|111025047|ref|YP_707467.1| carboxymuconolactone decarboxylase [Rhodococcus jostii RHA1]
    MPESLYQPTTPEISERRKTLAPGIHEAFENFSRSVFADGALPEKTKQLIAVAVAHVTQCPYCITGHTKLARRTGAEPEEI
    MEAIWVAAEMRAGGAFAHSTLALNAMNHSGHTTTGEPEP

    >gi|111025097|ref|YP_707517.1| dehydrogenase [Rhodococcus jostii RHA1]
    MPRHINDVVVIGSGPNGLAAAVLCARAGLDVQVLEDQPTPGGGCRTEEIALAGAALPHDLCSAVHPMAAASPFFTAFDLP
    ARGVQLNVPAASYAHPLDHRPAGIAYPDLTRTTTELAEYGTPGDAAAWQNLMHPLVDDFTTLVALCLGDMRSIPPAARDV
    PGIRTALGFATRVLEQGTRAWNRRFTDDLAPAMLTGIGGHVPAPMPSLAGAATMLLLGSAAHTVGWPIPTGGSQAITNAL
    INDLHAHGGHLDCEQGVSDWRLLPPARAYLFDTSPWMLAHILGNRLPSRYRRAINRYRPGLGIAKVDFVLNDAVPWADPR
    VQQAGSVHCGGTRAEITAAETAIAAGHHPPRPLVLVSQPAVVDPTRVNREARPLWTYTHVPNGSDTDVTETITAQIERFA
    PGFRDTVVTSRCTPAARLSAHDLNYRGGDIAAGRVSMYRMIARPAPKWNPYRTPLDGVYLCSASTPPGPSVHGMPGYYAA
    RQVLKDKFGITTLPHLGPTPEQRATAPTNTDDRNRRSSP

    >gi|111025660|ref|YP_708080.1| thioredoxin [Rhodococcus jostii RHA1]
    MATQSLTQRTFDDVVASNDVVIVDFWASWCGPCRAFAPTFEASSDKHPDVVFAKVDTEAEPGLAAAANIRSIPTVMAYRE
    GVLVFNQAGMLPPEALDDLVAQVKGLDMGEVRRKVVEQATATK

    >gi|111025662|ref|YP_708082.1| hypothetical protein RHA1_ro08880 [Rhodococcus jostii RHA1]
    MPTPHNHRHSPLGADLAPEMGSALAAYNAAVFTGPGEIPRKYKELIGIAVALTTQCEACIRFHTEDAVALGASEQELAEV
    TYIAAAMRAGGAVVHGMKALSVAARAAKPLASTEA

    >gi|111025664|ref|YP_708084.1| hypothetical protein RHA1_ro08882 [Rhodococcus jostii RHA1]
    METKQTVNGVDLEALNQTIDAVRGDRALGNVSFAVNGEWQGGFRVNSETGGLTQAGQLDNSRLGKFTMSSDEPASLLGTD
    TAVSPAEYVLQALAG
    CYTVTLAANAASRGIELESYKLELEADFDLASFLGVAPEEAPGAREIRVKVDLTAPGATREELQD
    LVDTVQKRSPIRDTLVRPVDVVTTLA

    >gi|111025679|ref|YP_708099.1| hydrolase [Rhodococcus jostii RHA1]
    MILEQYYLECLSHASYLIGDEQTKRAIVVDPRRDVTDYIDEAERRGLRIEGVINTHFHADFVSGHLELVAATGAWIGFGE
    AADTDYPIRRLQHGEHISLGNVDIEILTTPGHTWESISLLLRDGADTEPTAVLTGDSLFIGDVGRPDLANLGTGTNTDLA
    RAMYKTIHHTLLALPDHVQVMPAHGAGSSCGKNMSTDLVSTIGQQRLTNPSVQPMAEADFVDLVTTGQPAIPQYFSTDAD
    LNRRNRAVYDRSRQLRELSAEQMVRGVQDGTRVIDTRSPEEFAAAHLQGAVNVGLEGRFAETCGMVTHVDEPIILVTRPG
    DEAEAAMRLARIGYDNVQGYFNTLTTDRVTPFPSPLIGLLEQTERLTVAELATALQDGRITLLDVRNQGERDSGYIAGSL
    HIPLPELAKRHNTLPQGRPLVVH
    CRSGWRSSVAASLLRANGYEGTTDLLGGYNAWQETETPVCDGAR

    >gi|111025695|ref|YP_708115.1| hypothetical protein RHA1_ro08913 [Rhodococcus jostii RHA1]
    MTANAALATTIQAAVDHVKQNPSAAMATFKAKVLQDKGVQCSAFVRKHPAIIVDEPASLGGNDAGPSPVEYLLVSLGACQ
    EILYQITASMMGIELDSVTVYLKGNLDVRGFMGEEGIPPGYQQITFETRIESQADAKAIEALVHTVEAN
    CPTMDTIRRPV
    DVHGKAFLNGEPIVTV

    >gi|111025723|ref|YP_708143.1| hypothetical protein RHA1_ro08941 [Rhodococcus jostii RHA1]
    MTANAALATTIQAAVDHVKQNPSAAMATFKAKVLQDKGVQCSAFVRKHPAIIVDEPASLGGNDAGPSPVEYLLVSLGACQ
    EILYQITASMMGIELDSVTVYLKGNLDVRGFMGEEGIPPGYQQITFETRIESQADAKAIEALVHTVEAN
    CPTMDTIRRPV
    DVHGKAFLNGEPIVTV

    >gi|111025729|ref|YP_708149.1| hypothetical protein RHA1_ro08947 [Rhodococcus jostii RHA1]
    MKSRFPLCPLAELSGLPDDVAASILKIQEKSGFVPNVFLMLARRPAEFRAFFDYHDAIMYRSESSLTKGEREMVITTISA
    DNHCLY
    CVVSHGAILRVYEKNPIVADQVAVNYRHADITPRQRAILDFAVKVNKSAWEIADSDFESLHHYGLDDEDAWDIA
    AITALFGLSNRMATVGKLEPNLEFYILGRTPRD

    >gi|111025844|ref|YP_708264.1| thioredoxin-disulfide reductase [Rhodococcus jostii RHA1]
    MRQIIIIGSGPAGYTAAVYAGRANMRPLLIASSVEAGGELMNTTEVENFPGFPDGIMGPDLMSNMQAQAEKFGTDIIYED
    VTGVDLSGPVKKVTLGSGAVHEALSVIFAAGSAYRKLGLADEDRLSGRGVSW
    CATCDGFFFRDRTIAVIGGGDSALEEAL
    FLTRFADKVYLVHRRGSLRASKIMQDRAFANDKIEFVWNSEVVSINGEDQVESITVRDTETGVQQNLDVRGLFIAVGNDP
    RVHLVHGQLELTPGGTIAVEGRSSRTAVPGVFAAGDVTDPTYRQAITAAASGAVAALDAEHYLVTLSPDLLGSIAVDPAS
    SLETTTA

    >gi|111025845|ref|YP_708265.1| hypothetical protein RHA1_ro09063 [Rhodococcus jostii RHA1]
    MTETNTLSTEAFADLEAIEATVAAVTEQRELGKVTFSMLSESAGGLTAKTVTGPLTQAGTADESRRGKFTLHSDEPVSLL
    GTDTAVSPAEYILKGLAA
    CYIATLASLAAGRNIPLKHVALTLDFDVDLSGFLGIDNSVRKGAQQITVDVRIDSPGTSRED
    LEDLIVALEATSPIRDTLANPVPVITRLG

    >gi|111025847|ref|YP_708267.1| carboxymuconolactone decarboxylase [Rhodococcus jostii RHA1]
    MAYHEHTDHRYLRNLRTAAPDAVKSFLAFDQEVLNGASKVISRKNTELMAVAVALTTQCAYCIEAHVKAAKAEGASAEEL
    AETVMIASALRAGGSFAHGFMAMKFFDGAPDAATADHAHAPAGVS

    >gi|111025848|ref|YP_708268.1| thioredoxin [Rhodococcus jostii RHA1]
    MSVRSTTTAAFQADVLQNDLPVLVDFWAPWCPPCRAVGPVLDQLAQEQAGKVDVIKVNVDENPELAQKYGVTSIPAFRVF
    NNGDVTGSFVGAMPKKAFEDRLAPYLGAAATN

    >gi|111026851|ref|YP_708829.1| dihydrolipoyl dehydrogenanse [Rhodococcus jostii RHA1]
    MSDAFDLVVIGSGPGGYVSAIRGAQLGLRTAVVEGNALGGRCLNYACIPAKAVLRAADVLDEVRHASQFGIHVGTPRVSF
    DEVRARRDEVVASLTGGVRGLLKKNGVEVKHGWARLAGDGAVTVDGETVHGRAIVLATGSVARPLPGLDFHGRVIGTEQA
    WALDALPDTIAVVGAGASGVELASAYARLGSKVRLIEASDRILPAEDADISAIVHAKLRRQGIAISTGVTVSDTEQSTDA
    VSFTVDGRTEQTTWLVVAAGRSPDTDSLALDTAGVELDDRGLIRVDERLRTTAPGIWAIGDLVRGPALAHKASEEGIIAA
    EDAAEHIPEPLLHNLIPRATFCSPSVASVGLTEEQARQQGYEVVVGTARYGAVGAGTVLGERDGLVKLVGDAKYGELLGA
    HIVGAKATELIQELVTARALEAGLPEIATIIHGHPTLSEAVSEAARDAQGWMIHG

    >gi|111027033|ref|YP_709011.1| Cu(2+)-exporting ATPase [Rhodococcus jostii RHA1]
    MTPRPRGVDHPPLTAPEENTVSTTASYQVSGMTCAHCGQAVTEELGHLDAVTSVDIDLVPGGDSRVRVTSSRPLSLDEVR
    DAVDEAGYSLAEPPT

    >gi|111027039|ref|YP_709017.1| copper ion binding protein [Rhodococcus jostii RHA1]
    MTVTTYKVEGMTCGHCVSAVRAAVGSVPGVTGVEVDLAAGTATIAGVPIDGAVAQAISDAGYDVVAAGRNTESHDTVVGT
    ALPLVGDAGGCCCS

    >gi|111027040|ref|YP_709018.1| copper resistance transporter, ATPase component [Rhodococcus jostii RHA1]
    MTTHLTESGDREHDLELSIGGMTCASCAARIEKKLNRMDGVTATVNYATEKAKVTFADRVAPDDLVATVEATGYTATLPV
    SPADAAGATTGAPAEPDEAAEWRQRLIVSTVLTMPVVLLSMIPALQFDNWQWLTLTLASPVVVWGALPFHRAAWANLRHG
    AATMDTLISVGVTAAYLWSLWALFFTHAGMTGMRMNFDLLTTGSTEPHIYLEVASAVTTFILAGRYFEARAKRQSGAALR
    ALLDMGAKDVAVLRGGSEIRVPIGQLAVRDQFVVRPGEKIATDGIVTAGTSAVDASMLTGEPVPVEVGPGDSVVGATVNA
    GGRIVVRASRVGADTQLAQMARLVTEAQNGKAQVQRLADRISAVFVPIVIGLALLTLAVWLLTGNTVTAAFTAAVAVLII
    ACPCALGLATPTALLVGTGRGAQLGILIKGPQILESTRRVDTIVLDKTGTITTGRMAVASVHATDGVSDTEVLRLAGALE
    HASEHPIAHAVAARAAEAGPLPAVEGFENHGGRGVSGVVEGHAVLAGRYSWLWEQWALTAPDTLQLVVDDAETQGRTPVW
    IAWDGAIRAVIVVSDTVKDTSAAAIGELRELGLSPVLLTGDNHRAAQSVANQVGIEEVISEVLPSGKVDVIKNLQDQGRV
    VAMVGDGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLRAAPDAIRLARATLRTIKGNLFWAFAYNVAALPLAAL
    GLLNPLIAGAAMAFSSVFVVSNSLRLRRFTPHQ

    >gi|111027046|ref|YP_709024.1| hydrolase [Rhodococcus jostii RHA1]
    MAGIDLVPLVDEGLGNSAYLVDLGDGRALVVDVSRDLRAVHAAAARRGLTVAFAADTHLHADFLSGAHQLGSKSGATVLA
    SAAGDREFPHTGLRDGDEVDLGGLRLRALTTPGHTHEHLCFLLLDGDTEVGVFTGGSLIVGSAARTDLISPERTEALTRA
    QYASLRRLAALPGEVAVWPTHGAGSFCSAPPGTDRTSIIARERATNPLLRAPDEDAFVHQLLGSLGSYPPYFRRLGEINR
    LGPPLLDRDPVLPALTVDTVRAQLAEGAALIDVRPLTRFAAAHIPGALSIPLRPVFASWLGWLAPTDRPLIIVRDEDQDP
    GEIVWQAMKIGYDNLIGELGGGIAAWRAADREVTATALTGPDAVGTNIRVLDIRQRPEYLAGHLPGAVHIELGALAGRVD
    DLPREPTVVM
    CGHGERAMGAASLLERAGHRQLTVLAGGPDDWAAATGRTLETGA

    >gi|111027047|ref|YP_709025.1| ArsR family transcriptional regulator [Rhodococcus jostii RHA1]
    MGDRLAKTELFDQFARVGKALGSGKRLELLDLLAQGERTVDALARAAGLGLTTASAHLQTLKQANLVATRREGTKVFYRL
    AGADVAQLFALVRTVANDHLPDVEAAAAAYLGPADTEQVSKDQLLERARSGTVTVLDVRPREEYRAGHIPGAVSIPLDEL
    ADHLADLPEDQEIVAY
    CRGAYCVLAHDAVRLLTDHGRRAARLTEGMLEWRLAALPVDTPA

    >gi|111027060|ref|YP_709038.1| hydrolase [Rhodococcus jostii RHA1]
    MCRPRDRAYPPGYLHTHGGIWQSVHKEKDPANLEETTMILEQYYIECLSHASYLIGDESTGRAVVVDPRRDITEYLDDAR
    THGLTIDGVINTHFHADFVSGHLELVEATGAWIGFGEAAETDYPIRRLAHGEHISLGRVDLEILSTPGHTWESISVLIRE
    TPDADPTAVLTGDSLFIGDVGRPDLVNLGDGSTTDLARAMYHTVHDTLLALPDGVTVMPAHGAGSSCGKNLSTELTSTIG
    EQRRTNASAQPMSEDAFVALITDGQPAVPAYFSVDAALNKSTHPALDQHRRIPELAADQVRAELAAGTRVLDARTVDDFA
    AGHLRGSVNVGFDGRFAETGGMVAEVGEPIVLITYPGEEQDAAMRLARIGSDNVIGYLNTGVDGSFPTALTDLVQTAPRT
    TVTELDRLRADDAIILVDIRNPGERDFGVIPGAIPVPLAQLRSRAHELPTGKPIVVH
    CAGGWRSSVAASLLRARGIEQVS
    DLVGGYNAWAAQQVPA

    >gi|111027061|ref|YP_709039.1| thioredoxin [Rhodococcus jostii RHA1]
    MTTKNLTHTDFASTIADNAIVLVDFWASWCGPCRAFAPTFEQSSRRHPDVVHAKVNTEAEQQIASAADIRSIPTIMAFRD
    GVLVYSQPGALPPAALEELISQIKELDMAAVHDTLARRHAAAGQA

    >gi|111027062|ref|YP_709040.1| carboxymuconolactone decarboxylase [Rhodococcus jostii RHA1]
    MDYGKAVQQELRGPARALRQAIPQVYAGYGQLHEAALAPGALDAKTKELIALAIAVSKQCDGCIAAHARGAAEHGSTPQE
    AAEAIGVAILMNGGPATVYGPRAFAAFNEFHTDQDPGHENDPAGR

    >gi|111027064|ref|YP_709042.1| sulfurtransferase, rhodanese related [Rhodococcus jostii RHA1]
    MREIEIDEFADAWAAGAPVVDVREPWEYRNAHVPGAQLLPLGQLGDRVTEIPAGAVVYVICASGNRSVQGARILMTAGRP
    AVSVAEGTSGWAAAGRPLDTGEDGSCPTADRPAPAPVSTKMFLSDRQGDRG

    >gi|111027070|ref|YP_709048.1| hypothetical protein RHA1_ro11243 [Rhodococcus jostii RHA1]
    MDVSIIETSGLGDRSYLVSDGAVAVVVDPQRDIDRVLDLARNRGVRITHVLETHIHNDYVTGGLELARTTGAEYVVPEGD
    DVGYQRRAVGDGDIIDAGPILLQVMHTPGHTHHHVSYVLRETTGGIRGVFTGGSMLFGTTGRTDLLGPEHTEELTHAQYH
    SVRRLAGELPADTQVYPTHGFGSFCAATPATGDSSTVGEQRSTNPALTQDEQRYVDELIAGLSEYPAYYAHMGVINIHGP
    APVDLSLPTPVDPDELRRRIEDGEWVVDLRKRTAFAAGHLGGTLGFELSDSFVTYLGWLYQWGAPLTLIGENEDQVADAR
    RELVRIGIDDLTGAAVGELHTLAAGTELRSYRVADFAALTKALPEQDITVLDVRQRNEYETSHIDGAINIPLHELADRLG
    TLPEGEIWVH
    CASGYRASVAASMIDRPDRTTVLINDDYDNAIDIDITSTT

    >gi|111020502|ref|YP_703474.1| hypothetical protein RHA1_ro03513 [Rhodococcus jostii RHA1]
    MDARFNLFDNEIALKFGKRFANASLVIDQSPLPKATQELVKIRASQINGCGFCTDMHTKDATAAGETPVRLNLVAAWREA
    TVFTEAERAALALSEEGTRLADAHHGVTDETWAQVRKHYDDDQIAALVSLVALINAANRINVIVRNPAGSYEPGMFASMT
    N

    >gi|111021907|ref|YP_704879.1| hypothetical protein RHA1_ro04940 [Rhodococcus jostii RHA1]
    MEDAMPRIPAVAPAVASPLVKVAYKYAAHKFDEVPEPFTVLAHHRKLFVASARHELAVQKASTVLPANVREIAVYRVAWT
    IGCSW
    CVDFGTMLQRLDGLDVERLQHIVDYADSPAYSEDERAAIAYADAMTSTPTTVTDEQVADLERRFGRAGVVELSYQ
    IGIENMRARMYSALGITEQGFGTDSCRVPWADDAAVTKEGPGA