Rhodococcus erythropolis PR4 uid59019

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|77404487|ref|YP_345063.1| putative glutaredoxin [Rhodococcus erythropolis PR4]
    MAVTVYSKPACVQCNATYRALDKAGIDYAIIDITEDVEARDYVMGLGYLQAPVVVAGEEHWGGFRPDRIKALDAA

    >gi|77454693|ref|YP_345561.1| putative oxidoreductase [Rhodococcus erythropolis PR4]
    MKLTTNAKFSIALVAVFAVVLGALLLGNRSGTGTTSAGASDATVLRADTHLLSTAPDNDVVLVEFLDFECEACLAMYPTM
    ERIRTEYADRITFGVRYFPIPSHTNSGLAARVVEAASRQGKFVEMYQRMYDTQTEWGESSESQEPLFRTFAQDLGLDMAT
    FEADLKDPTVAERVERDFNEGIDLGVQGTPTLFLDGVQLPAMPTYEELTGRIDAALAR

    >gi|77454701|ref|YP_345569.1| putative cytochrome c biogenesis protein ResA [Rhodococcus erythropolis PR4]
    MNAPALPRKSRQRVLGKPTRILPLVAILTAIVVAASGCATGTDAVASGANFDFVSPGGQTDILYDPPESRNMIGVLAGPD
    LMADGSDISLTDYAGQVVVINLWGQW
    CAPCRSEADDLERAYEATESLGVQFLGINVRDPQRDKAQDFVVDNNVSYPSIYD
    PSMRTLTALGGNYPTSVIPSTLVLDRRQRVAAVFLRALLTEDLQPVIERVAAER

    >gi|77454702|ref|YP_345570.1| putative cytochrome c biogenesis protein [Rhodococcus erythropolis PR4]
    MQAQSRWFLLFLVVIGLLVVAIWPRSTSTETHSSTRPQVPPAAQADEDRVDSGFSSKSAAAAVPCPVAPAVPPAGGELLG
    IKATCLGENTVVDLGAALSGEPTLINLWASW
    CGPCRSEIPVLNDYAGTPGSIRVVGINVQDDMSTALALLTAAGVHYPSF
    AAVDDIGIALSAPPVLPLSFLVQQDGSVEQITTPMVFENTDQIRSAVSELMK

    >gi|77454710|ref|YP_345578.1| hypothetical protein pREL1_0143 [Rhodococcus erythropolis PR4]
    MSTTDPDIAIIETSSLGDRSYLISHDGIAVVIDPQRDIDRVRALAAEKNAVITHVLETHIHNDYVTGGLELARATGAEYV
    VPDGDPVEYERRAVVDGDVVDAGSTTFEVMHTPGHTHHHVSYVLHRRGEPIAIFTGGSMLYGSTGRTDLLGSEHTDELTH
    AQYHSVRRIAAELAAEVEVYPTHGFGSFCAATPTSGDSSTIGEQQQSNPALTQDEHTYVDELIAGLSAYPAYYAHMGVIN
    TKGPAPIDLSMPEPVDPDELRRRIDAGQWVVDLRARTAFAAGHVDGSLGFELSTSFVTYLGWLYQWGVPLTLIGETTDQI
    AEATRELARIGIDSPSGSAVGEIHSLVGDGKVRSYDVSDFAGLAAATGEREISVLDARQQSEYADSHLPGAVNIPLHELP
    HRLEEVSAAEVWVH
    CASGYRASIAASLLDREHRTVVLIDDDYEHAVQLGLHTSPA

    >gi|77454728|ref|YP_345596.1| thioredoxin reductase [Rhodococcus erythropolis PR4]
    MTIPSAVHDVIIVGSGPAGYTAGVYTARAELAPLLFEGTQFGGALMTTTEVENFPGFREGIMGPDLMEQMREQALRFDTD
    IRTEDVEEIDLSGPIKTVVANGETYAAHAIILAMGAAARYLGIPGEERLLGRGVSA
    CATCDGFFFRDQDIVVVGGGDSAM
    EEATFLTRFARSVTLVHRREEFRASRIMLERAKANEKIRFLTNAEPVEVLGENSVTGLVVRDTVTGETSTLEITGMFVAI
    GHDPRSELVKDQVDLDDAGYVRVAPGSTATSVDGVFAAGDLVDHTYRQAITAAGTGCSAAIDAERWLADRGDITANTLDA
    AGHTVDAV

    >gi|77454787|ref|YP_345655.1| hypothetical protein pREL1_0220 [Rhodococcus erythropolis PR4]
    MLLERIYDEDLAQAGYFIGCQAKGEAVVVDARRDIGVYLDLADRHGMTITAVTETHIHADYLSGTRELAKATGATTYVSG
    EGGDDWQYGFEAERLHDGDTLTLGNITVQAVHTPGHTPEHLSFLVTDGAFADAPGYMLTGDFVFAGDLGRPDLLDEAADG
    VDTRFEGAKQIFRSLKRSFVTQPDHIQVFPGHGSGSACGKALGALPSTSVGYERRFAWWAGYVERDDEQGFVDEMLDGQP
    DAHAYFGRMKRQNKQGPVVLGPLSPLHEYDSAELARALDSDEVVLLDTRGQDEVHVGTVPGALNIPGLSKAASFGAWVYD
    PEREDTPLVVLAED
    CNAADELRDHLLRVGIDTVTGYVTSLRGLPMTTPETIGADELDSFDPAMVLDVRNKTEHADGHIPG
    SEQLSGGRLLWNLDGLPTGGPIVTY
    CQSGVRNAVAASALRRAGYHVVELEGSYAAWAEHNLETV

    >gi|77454799|ref|YP_345667.1| putative disulfide bond formation protein [Rhodococcus erythropolis PR4]
    MTSSSRSTRRRDTWLLGIAVLVAAVLVGVLVVGMHDSDEPEATAGATSSAEPEVGATPATGPLGDLSRRTVDDPMAIGAV
    DAPVVMIAFSDFR
    CPFCAQFSRETEPQLIDRYVDEGTLRIEWRDLPIFGQQSFDAARAGRAAAAQDKFWEFTNAVYAGAP
    ETGHADLTIEALEAYAQQAGVPDLERFTTEATGTSFDSAITSDSDEAQSLGIPATPAFSVNGDPVLGAQPLSTFVDLIDT
    AAGA

    >gi|226303655|ref|YP_002763613.1| peptide methionine sulfoxide reductase MsrA [Rhodococcus erythropolis PR4]
    MSWYDDILGRASAKSTLIAPEDALPGREQKMPVPTAHYVNGHPLTPPFPAELQTVVVGMGCFWGAEKEFWQLPGVYTTAA
    GYAGGFTPNPTYEETCSGRTGHTEVVLVVFDPAVISYEQILAHFWENHDPTQGMRQGNDQGSQYRSAIFTTSAEQEEIAH
    ASAVAFGERLAEAGYGAITTEIGPLRDFFYAEDYHQQYLAKNPGGYCPVHATGVSCPVGLLRQDQVPAQTDILPPSE

    >gi|226303668|ref|YP_002763626.1| oxidoreductase [Rhodococcus erythropolis PR4]
    MSRSMKISAALIALFAVALITFITVDPIRADNESTDRAAQSTAVLTDDAYRLTSAADDKVNLVEFLDFECEACLALYPTM
    ERIRAEYEDRITFGIRYFPIPSHTNSTLAAQVVESASRQGKFVEMYQRMYETQSQWGESAESQEALFRSYAQDLGLDMTR
    FESDLSSRGVRERVERDFNEGKRLGVQGTPTLFLNDVKLAQMPSYEDLKAQIDSALEQ

    >gi|226303972|ref|YP_002763930.1| thiol-disulfide oxidoreductase [Rhodococcus erythropolis PR4]
    MTSAGRWSLAALVVVAALVVAIWPRGGDDTTPTSTGPSSSAYQPPTFTPSSESLDQLRSQASLAPCPTPTGEAPAGSALA
    GITLDCVSDGRPVDLAAAVGGKPTLLNLWAYW
    CAPCAEELPYLQEFAERAEGSINVLTVHSDPNQENALTRLIDYSVRLP
    GVQDGDGKVRIAVGAPPVLPVSVLVRADGTVAKVLPQPFRSADEIAAAAAQYLGVVV

    >gi|226304057|ref|YP_002764015.1| hypothetical protein RER_05680 [Rhodococcus erythropolis PR4]
    MSRLASLTPTTAVGASKDLLAELVNRHGQVGDMVAAMAHSPAVLGGYLQLSRAMKRAKLSRKITERISIAVQVQQGCAVC
    LEAHVAAAHANGVEADEIERARAGTSADPAIAAMIDLGLRVYREPASISDEHITGLRAHGYGDREIADVVGIVALNVLTG
    AFNLVAGVKPNEPDR

    >gi|226304141|ref|YP_002764099.1| hydroperoxide peroxidase OsmC [Rhodococcus erythropolis PR4]
    MPTRTARTAWNGTLEAGSGQVELTSSGVATFDVSFPKRAAEEAGGTTSPEELIAAAHSSCYAMQLSALIAEAGGTPQSLD
    ITADVSLGPDTVGFKLTGIKLTVRAEVDGLDADGFAKVAQAAKET
    CPISKALTGVDITLDAALD

    >gi|226304146|ref|YP_002764104.1| hypothetical protein RER_06570 [Rhodococcus erythropolis PR4]
    MTDQIVIDQDVTIEVWSDVACPWCYIGKTRFLSALDRFENKDRVNVIWRSYQLAPETPVGEGRTELDALVEMKGMAPDQV
    RQMFAHVSATAAEVGLTLDFETVIAANTFDAHRLLHLAGERQNELLEALFKAHFSDGLVIDDREVLVELAVSVGLDADVV
    REQLGSDAAAEAVREDLSMARQLQVSGVPFFVANRAVAVSGAQPEEVFLQLLTQASEPA

    >gi|226304531|ref|YP_002764489.1| glutathione peroxidase [Rhodococcus erythropolis PR4]
    MTTPVQNIAINTLGGVPTSLGEYDGRAVLVVNVASKCGLTPQYSALEKLASEYADRGLTVIGIPCNQFMGQEPGTAEEIE
    TFCSTTYGVTFPLLEKIEVNGENQHPLYAELTKAADAEGAAGDIQWNFEKFLIGPDGTVVNRFRPRTEPDAPEVVAAIEA
    ALPKN

    >gi|226304683|ref|YP_002764641.1| ABC transporter substrate-binding protein [Rhodococcus erythropolis PR4]
    MGRSRVRIPAGSRGQQAPVHTVTGSANEPLRERDSMRLSRLRLPAAAVVALLSASLVACSSDDSAAQQSNSSEQSRVTVQ
    NCGRDVTVERPIERAIAVNQPAAEMLFALGVQDRMAGYAMSDDDVLPELREARSQVQAFDTEFPSFESVLEREPDMVYTT
    FNYTFTSEGIADRTKFTDLGVATYQSPSE
    CTGQDAEQSKALTLDDLYAEIGDVATLFDVKDKGVELTESLKDRAATATAS
    LGAENVTLAWWYAATKTPYFAGCCGAPGIMTDAVGAKNAFDDDKQYWPEIGWESVLDRDPTVLVLADLDRGGDGDSAADK
    IAFLESDPVASKLTAVKNKRYIILEGTTMDPSIRNVGGIEQLSDGLRQLGVV

    >gi|226305028|ref|YP_002764986.1| dihydrolipoamide dehydrogenase [Rhodococcus erythropolis PR4]
    MTSHYDVVVLGAGPGGYVAAIRAAQLGLSTAIIEQKYWGGVCLNVGCIPSKALLRNAELAHIFTKEAKTFGMSGDVSFDF
    GSAFDRSRKVADGRVKGIHFLMKKNKIPEYDGKGTFVDANTISVELSKGGTETITFDNAIIATGSYTKLLPGTSLSENVV
    TYEEQILTRDLPGSILIVGAGAIGMEFGYVLKNYGVDVTIVEFLDRALPNEDADVSKEIAKQYKKLGVTIKTGAAVQSIS
    DDGSKVTVSIKDNKSGEIETVVVDKVLQSVGFAPRVEGFGLENTGVALTDRGAIAIDDYMRTNVPHIFAIGDVTAKLQLA
    HVAEAQAVVAAETIGGAETQTLGDYRMMPRATFCQPQVASFGLTEEQAKAEGYDVKVANFPFAANGKAHGLGDPTGFVKL
    IADKKYGELLGGHLIGPDVSELLPELTLAQKWDLTVNELARNVHTHPTLSEALQEAIHGLAGHMINF

    >gi|226305128|ref|YP_002765086.1| hypothetical protein RER_16390 [Rhodococcus erythropolis PR4]
    MTAATHEVTLLTRTGCASCVGAAEVLRRVCSEFELELTCIDVDEAAATDPELRAEYGDRLPVILLDGREHGYWEVDEERL
    RDDLRK

    >gi|226305157|ref|YP_002765115.1| cytochrome c biogenesis protein ResA [Rhodococcus erythropolis PR4]
    MISRRIAAAFAAAASAMLLLSSCATGDDAVAQGGTFDFVSPGGQTKIFYDPPSDRGTIGKLSGPDLMNEGQKVGVDDFEG
    KVVVLNVWGQW
    CGPCRAEADDLEQVYEQTKDSGVQFLGINVRDDTKNKAQDFVVDNKVSYPSIYDPSMRSLIALGDGYPT
    SVIPTTIVLDRQHRVAAVFLQELLAEDLLPVVQRVAQEDAQ

    >gi|226305461|ref|YP_002765421.1| ABC transporter substrate-binding protein [Rhodococcus erythropolis PR4]
    MRHPFVVVYEKEVQQELWPSISVRAELSVGFSFVAQSPYEVPVSLQFSPSRAAAVLIAVALVSAGCSKGETAGGSSTTES
    FAQPVSVTNCDREVTFDSPPQRIITMNDHVTEVLIEMGVGDRIVGMGYGDSTPTPETAEQFAKITNLAKEYPTAEQILDL
    DPDFVVGGMSSAFQEKEGRSRDLFAERGINTFLFSEY
    CGQGFPNISMLENDYAQLGRILGVEDQAAEVTDQVTQGLDAVK
    AAVGDAPPVPTFFYDGGKDVPTTIGGVGVGQLVAGYAGATNIYSEGERPYVKTTWEVVGERAPQAIVVLDYGSENAQAKI
    DFLKSHPVMATTPAVQQNRFVVIPLDDFFESPRLVRSAQTIAAGLHPGVVPAQ

    >gi|226305472|ref|YP_002765432.1| sulfurtransferase [Rhodococcus erythropolis PR4]
    MLEVDLNALDTALAAGEPLIDVREPDEFAQVRVPGAALIPLSEFVSRVGEIPDAETVYIICAVGGRSLQAAEYLQARGIN
    AVSVAGGTMAWYQSGRQVETGA

    >gi|226305568|ref|YP_002765528.1| oxidoreductase [Rhodococcus erythropolis PR4]
    MTLVDGRPLPATRGLGGHMTRIVIIGGGPAGYEAALVAAQHGATVTLVDSDGVGGACVLFDCVPSKTFIASTGIRTDMRR
    ASDLGITLDPEQASVSLPKIHSRVKSLALSQSSDIRARLQTVGVEVLSGTAELTDPLLGMAAHQVRATLGSGEQKTIDAD
    VVLIATGASPRIIPGAEPDGERIMTWRQLYDLDELPEHLVVVGSGVTGAEFVSAYTEMGVKVTLVSSRDRVLPGEDADAA
    LVLEDALAERGVTLVKHARADAVERTEKGIIVKLSDGRTVEGSHALMTVGSVPNTNGLGLERVGIELDKGGYLRVDRVSR
    TTVSGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIKLKTVASAVFTRPEIATVGVSQAAIDNGEVPARTVMLPL
    NTNPRAKMSGLRRGFVKIFCRPATGVVIGGVVVAPTASELILPIAIAVQNNLTVNDLAQTFSVYPSLTGSITEAARQLMR
    HDDLD

    >gi|226305611|ref|YP_002765571.1| thiosulfate sulfurtransferase [Rhodococcus erythropolis PR4]
    MPVAPDPSTAFAEFAHPDRLVSTEWLSANLGTPGLKVVESDEDVLLYDVGHIPGAVKIDWHLDLNDPVTRDYIDGAKFAE
    LMNRKGISRDDTVVIYGDKSNWWAAYALWVFTLFGHEDVRLLDGGRDAWIAENRDTAFDVPDITSTDYPVVKRNDAPIRA
    FKDDVLAHLGDGPLIDVRSPQEYTGERTHMPDYPEEGALRGGHIPSALSIPWAKAAAPDSRFRTRTELGEIYGGLSADDN
    IVAY
    CRIGERSSHTWFVLTHLLGYPNVRNYDGSWTEWGNAVRVPIVQGEEPGAVPSSVSAS

    >gi|226305689|ref|YP_002765649.1| molybdopterin synthase sulfurylase MoeB [Rhodococcus erythropolis PR4]
    MSATPVVLPPLVEPAAELSREEVARYSRHLIIPNVGMTGQKRLKNARVLFIGAGGLGSPALLYLAAAGVGTIGIVEFDEV
    DMSNLQRQVIHGRSDVGRPKAVSAKESILEINEHVDVRLHEFRLDNSNAVELFSEYDLILDGTDNFATRYLVNDAAVIAG
    KPYVWGSIYRFEGQVSVFWEDAPDGAGLNYRDLYPEAPPPGMVPS
    CAEGGVLGVLPATVGSIMATEAVKLITGIGEPLLG
    RLMIYDALAMTFRTIRLQRDPTRVPVTALIDYDAFCGVVSEEASAAAVGSTITAPELEAMIGEGRSIELVDVREPVEWDI
    MHLPGAVLIPKDRILSGEALATLPQNKQIVLY
    CKTGIRSAEALAFLKNAGFSDAVHVQGGAIAWANQVDASLPVY

    >gi|226305710|ref|YP_002765670.1| hypothetical protein RER_22230 [Rhodococcus erythropolis PR4]
    MTSTENAPALTIYSTTWCGYCRRLKTQLNASGIEYTEIDIENDPAAADFVGSVNGGNHVVPTVKYGDGSVATNPSLNQVK
    QALGL

    >gi|226305802|ref|YP_002765762.1| oxidoreductase [Rhodococcus erythropolis PR4]
    MTQNSFDVAVIGAGAAGLNAALILGQARRSVIVFDNGSPRNAAADHMNGFLSRDGMNPAELLTIGRGEVRKFGGEFHDGT
    VVSVTRDGEKFSVELADGSKIQVCKVLVATGLTDRLPDELEVFGERWGRDVLH
    CPYCHGYSVRDQPLGVIAKSAEFAMHQ
    ALMVRQWSDDVVLFLHRITELSSEDREKLAARDISIVEGEVVGPVVEDDRLVGVRLADGTVVARSAVFVGGALTMDPNDA
    ILRAFGAQRAETMMGDFVTVDMMGATSVPGVFAAGNVVDPGAQVIMAAAAGAKAGAGINMMLTNDDLEVALALRS

    >gi|226305837|ref|YP_002765797.1| NrdH-redoxin [Rhodococcus erythropolis PR4]
    MSITVYTKPACVQCNATYRALDKAGLEYNIIDITEDAEARDYVMALGYLQAPIVVAGEDHWSGFRPDRIKTLTVAA

    >gi|226306089|ref|YP_002766049.1| mycothione reductase [Rhodococcus erythropolis PR4]
    MTHYDLAIIGSGSGNSLPDERFDGKKIAILEEGTFGGTCLNVGCIPTKMFVYAAEVARTITTAEKYGVDATLDGVRWSDI
    VKRVFGRIDPISAGGERYRSEDSPNTTVYRGHATFTGDKTIDTGTGETITADQVVIAAGSRPIIPEEIASSGVKYYTNED
    IMRLPELPEHLVIVGSGFIATEFAHVFSALGSRVSIIGRSQRLLRHLDDEISERFTELAEQKWDVHLGSPLTSVRGDGDN
    IAVELANGTVVSGDVLLVAVGRQPNGDLLGLDKAGVELDDKGSVVVDEYQRTTAEGVFALGDVSSPYQLKHVANHEARVV
    QHNLLQDAWKDTSGLRSTDHRFVPAAVFTDPQIADVGMTEKQARDAGLDITVKVQAYGDVAYGWAMEDQEGICKVIAERG
    TGRILGAHVMGTQAPTVIQPLIQAMSFGLSAQDMARGQYWIHPALAEVVENALLGLDI

    >gi|226306100|ref|YP_002766060.1| hypothetical protein RER_26130 [Rhodococcus erythropolis PR4]
    MMAAFQESTADTVTIVAGLESTFADELGALTVPWQGAAAPDPQLLVLNEQLAASLRLDVEALLSVDGIGVLSGSTVPVGA
    TPVAMAYAGHQFGGYAPILGDGRALLLGELVSSDGQRVDLHLKGSGRTPFSRGGDGYAVVGPMLREYLVSEAMNALGVPT
    TRALSVVATGRDVRRNGAEPGAVLARIASSHLRVGTFEFAARQGEVLQPLTDYAIARHYPELTELPATGTHNRYLKFLEA
    VVEAQASLVARWMLIGFVHGVMNTDNTTISGETIDYGPCAFLDAFDPAAVFSSIDSGGRYAFGNQPAVLKWNLARFAETL
    LPLIDSTPDDAISAASAVLDTFDERYEGHYAAGMAAKLGLAHPIVDPALVDDLLTLLAEHGADWTGSFRALADELRGNSA
    PLDGLVPRDHIASWLQRWHDALAEHGRGAAETASAMDRVNPLYIPRNHRLDAALRAATDGDLAPFEKLLEVVTHPFDRRD
    EWADYTEAAPQSFSETFQTF
    CGT

    >gi|226306273|ref|YP_002766233.1| alkyl hydroperoxide reductase AhpD [Rhodococcus erythropolis PR4]
    MSVENLKNSLPEYAKDLKLNLSSIARTTVLNEQQLWGTLLATAAATKSASTLKEIASEAADNLSAEAYNAALGAASIMGM
    NNVFYRTKGYLDGKYDDLRAGLRMNIIGNPGVDKADFELWSLAVSAINGCNH
    CLEAHENTLRQEGVDREVIFEAIRAGSI
    VAGVAQAVEANEILSAAQV

    >gi|226306274|ref|YP_002766234.1| alkyl hydroperoxide reductase AhpC [Rhodococcus erythropolis PR4]
    MALLTIGDQFPAYNLTAVIGGDLSKVDAQQPDDYFTTVTSDDYAGKWRIVFFWPKDFTFVCPTEIAAFGKLNEEFADRDA
    QVLGASVDNEFVHFQWRAQHEELKTLPFPMLSDLKRELAEATGVLNADGVADRATFIVDPNNEIQFVSVTAGSVGRNVDE
    VLRVLDALQSDELCACNWKKGDPTINAGELLTASV

    >gi|226306341|ref|YP_002766301.1| peptide methionine sulfoxide reductase MsrB [Rhodococcus erythropolis PR4]
    MSSSHDRIESTPEVTYTESEWREKLTPEEFAVLRQAGTERPFVGEYTDTTTEGVYSCRACGAELFRSTEKFESHCGWPSF
    FDPADSDAVILKEDSSLGMRRVEVICKKCHSHLGHVFEGEGYPTPTDQRY
    CINSISLVLKPAQ

    >gi|226306674|ref|YP_002766634.1| hypothetical protein RER_31870 [Rhodococcus erythropolis PR4]
    MAIPKIVLFYQFTPLADPEAIKLWQHSLAESNNLTGRIIVSPHGINATVGGDIEDVKRYVRGTRGYEPFRTADIKWSDGL
    GNDFPRLSVKARSEIVTFGAPDELKVDENGVVGGGVHLAPKELHELVDSRGDDVVFFDGRNAFEAEIGRFRDAVVPDVAT
    TRDFVDELDSGKYDHLKGKAVVTY
    CTGGVRCEVLSSLMRSRGFDEVYQLDGGIVRYGETFGDRGLWDGSLYVFDKRMNIE
    FSSEAKTLGVCVDCGTPTPRYRNRIDGDGRTLELLCESCSPDLEQD

    >gi|226306808|ref|YP_002766768.1| thioredoxin [Rhodococcus erythropolis PR4]
    MERTPVATQTLTQQNFDETINGSDVVLVDFWASWCGPCRQFAPTFEASSEKHADVVHAKVDTEAEQGIAAAANIRSIPTI
    MAFREGVLVFNQAGALPAAQLEELVTQVKALDMDEVRKQIAEQTASAE

    >gi|226306844|ref|YP_002766804.1| hydroperoxide peroxidase [Rhodococcus erythropolis PR4]
    MKPGQLAPDFSLPDQDGTPRSLTSLLANGPLVLFFYPAASTPVCTAEACHFRDLGSEFAAVGASRAGISTDTVEAQSTFA
    TAQSFDYPLLADTDGKVAEQFGVKRGLLGKLAPVKRSTFVIDTDRTVLKVISSELRANTHGDQALEFLRNRS

    >gi|226307092|ref|YP_002767052.1| iron-sulfur cluster assembly protein IscA [Rhodococcus erythropolis PR4]
    MTVQNETATHGVKMTEAASAKAKALFDQEGRDDLALRIAVQPGGCAGLKYQLFFDDRTLDGDLTVDFNGVNLVVDRMSAP
    YVEGASIDFLDTIEQQGFSIDNPNATGSCACGDSFN

    >gi|226307128|ref|YP_002767088.1| thiosulfate sulfurtransferase [Rhodococcus erythropolis PR4]
    MAGETASPLVSAVELDAMLREGGVAVLDATVHFPPARFDGDYRPESGYGGWVSSHIPGSRHVDLLDVFSEREAALHFTRP
    STEQLISDLHSSGIEPGATIVIYDQGSITWASRLWWVFRNAGIEARVLDGGLAGWTRRGFALASGDDETHTSASTRWSVT
    DLGLWVDLPRVASLSSGGEAGTLVCALAPEQYEGTEKTRYSRRGHIPSSVNLSAKSLLDSDSRMLPVEKVLSKSADVLPT
    ATGPVVIY
    CGGGVSACLTALALIRSGYADVKVYDGSLEEWTADPVLPMVVGSEPGGANPDVRCPRS

    >gi|226307154|ref|YP_002767114.1| peroxiredoxin AhpE [Rhodococcus erythropolis PR4]
    MPLEVGAQAPDFTLKDQNNQEVSLADFRGKKNVLLVFYPLAFTGTCQGELCKVRDELPKFENDDTAILAISVGASPTHKI
    WSAEQGYTFPLLSDFWPHGEVAQKYEVFNDKLGFANRGTFVIDKDGVIRFAEMNGPGEARDHGLWANALAALES

    >gi|226307308|ref|YP_002767268.1| hypothetical protein RER_38210 [Rhodococcus erythropolis PR4]
    MSATSSKTTDTADFWFDPLCPWCWITSRWILEAQQVRDIEAKFHVMSLAVLNEGRDLPDEYREMMTKAWGPVRVAIAAAQ
    LKGDEILLPLYTAMGTKIHNEGNKDFADVIKSSLAEVGLPPELAEAADTDKYDEALRESHHKGMDAVGPDVGTPTIHVNG
    VAFFGPVLSRIPRGEDAGKVWDGAVALAGYPHFFELKRTRNEDPQFD

    >gi|226307356|ref|YP_002767316.1| hydroperoxide peroxidase Bcp [Rhodococcus erythropolis PR4]
    MTENSRLSAGDVAPDFTLPDADGNEVSLHDYRGRKVIVYFYPAASTPGCTKQACDFRDSLAELNGAGLEVVGISPDKPAK
    LAKFRDTEELTFPLLSDPEKATLEAWGAFGEKKMYGKTVQGVIRSTFLVDEEGKIEVAQYNVRATGHVAKLRRDLSV

    >gi|226307473|ref|YP_002767433.1| 3-mercaptopyruvate sulfurtransferase [Rhodococcus erythropolis PR4]
    MTLPVLIDVEELSALIEAGAAPRLLDVRWALGDSNGEQHFRDGHIPGAVFVNLDEELASPSSPDKGRHPLPSLEDLQDAA
    HRWGIDDGDSVVLYDATGNTAAARGWWLLRWAGLSDVRLLDGGLQAWESAGLPLAAGIGESVTPGNVTFTGGNMPTVDID
    GVGDWTRAGGVLLDARAGERYRGEVEPMDPVAGHIPGAVSAPTAENITGDGRFLDATRLRERFAGLGAGDSVAVY
    CGSGV
    TAAHEIAALAIAGYDATLFPGSWSQWSNDSTRAVDTGA

    >gi|226307744|ref|YP_002767704.1| hypothetical protein RER_42570 [Rhodococcus erythropolis PR4]
    MDPRLRNNLGGSSSPYLRQHADNPVHWQQWGEEAMEWARERNVPILLSIGYSACHWCHVMAHESFENDEIAAVMNANFVC
    VKVDREERPDIDAVYMNATVAMTGQGGWPMTCFLTPDGSPFYCGTYYPPTPRGGMPSFTQLLEAIADTFTNRRDEVDNAA
    QSIVTELQRASGGIPYGGAPIDAELLNAAGRSILGVEDIPRGGFGGAPKFPPSALLEGLLRQFERTGSGEILGGIERTAE
    AMARGGIYDQLGGGFSRYSVDAEWVVPHFEKMLYDNALLLRFYAHWARRTGSDLATRIAKETAGFLLSDLLTENGCFASA
    LDADTDGIEGLTYVWTPTQLVEVLGAEDAQWAADLFRVTDTGTFEEGASVLQLLRDPDDWSRWQTVSDALRAARAQRPQP
    GRDDKVVTAWNGLTVTALTEAGLALDRSDWIAAAAECAGALLDLHLVDGHLRRASLGGAVGAPTGVLEDYAMLATGLLAL
    YQATGFARWLDAAQQLLDVTLDHFADPAEPGSWFDTADFAESLVTRPRDPLDGATPSGASSVAEALLTAAALTDAGRSSR
    YAQAAADALARATLPLERAPRSAGHWLTVAEASLRGPIQVAVVGEGSLLADARRLAPGGAVVVGGAPDSSPLLADRPLVD
    DGEAAYICRGFVCDRPVTTVVELANQLNTTSHTAM

    >gi|226307846|ref|YP_002767806.1| copper-transporting ATPase CopA [Rhodococcus erythropolis PR4]
    MTSPTAVDNAANSSSVELAITGMTCASCASRIEKKLNKIDGVTATVNYATEKAKVTFPDGVPVEDLVTAVENAGYAAALP
    KPPSAPDTVDPDAETPQDRDLRELRTRLIISTLLSVPVIAMAMIPALQFDNWQWLSLTLAAPVIVWAALPFHRAAWVNLR
    HGAATMDTLISLGTIAAFVWSLYALFFGTAGEAGMKHAFRLTVDRMDGSANIYLEVAAGVITFVLAGRYFEHKSKRTSGA
    ALRALMELGAKDVAVLRNGVEVRIPAEELAAGDSFIVRPGEKIATDGIITEGRSAVDMSMLTGESVPEEVGVGDTVVGAT
    VNVGGTLTVEATRVGSDTQLAQMAALVEDAQNGKAEVQRLADRIAGIFVPVVIAIAVATLGYWLGTGNPIEMAFTAAVAV
    LIIACPCALGLATPTALLVGTGRGAQMGILIKGPEVLESTRAVDTVVLDKTGTVTTGQMTLLDTVVGEGTTVDEVLRLAG
    ALEHRSEHPIAAAIAKGATEAVGELLAVEDFVNVAGRGVQGMVEGHAVVAGRDALLADWSMPLPENLRDAKAEAEKAGRT
    AIAVGWDGKAHGVLVIADAVKDTSAEAIAQLKALGLEPVLLTGDNATVARTVADQVGISTVFAEVMPADKVDAVKKLQAE
    GRVVAMVGDGVNDAAALAQADLGLAMGTGTDVAIEASDITLVRGDLRSAADAIRLSRKTLKTIKGNLFWAFAYNTAAIPL
    AAAGLLNPMLAGAAMAFSSVFVVSNSLRLRRFK

    >gi|226307862|ref|YP_002767822.1| arsenate reductase [Rhodococcus erythropolis PR4]
    MASATIFHNQRCNTSRTVLGLIREAGIEPTIVKYLDTPPTRSELEELIADAGLEPSQAVRKRETQYKDLGLADASESEIL
    DAMIEHPILIERPFVVTDKGTVLARPAAKVEEIL

    >gi|226307929|ref|YP_002767889.1| NADH dehydrogenase [Rhodococcus erythropolis PR4]
    MSIHISNGKPRVVIVGGGFGGLYAARRLKKADVEVVLIDRGTSHVFQPLLYQCATGLLSEGQIASPLRHLLEDNKNTNVV
    LGEAKSVDADAGILTASRFDGSTFELPYDYLIVAAGMRQSYHGQDEFIKWAPGMKTLDDALAIRRSLIAAFEMAESLPTA
    EERRPWLTFAVAGGGPTGVELAGQIRELAMHALTNEFRSIDPDEARVLLFHGDDWVLPSFSRKLSAAAKRTLDGIGVETH
    LGVHVTDVCETSIETTDKKTKEKRQYETRTILWTAGVEAVPFAEALATALGVKQVGGGRIEVEADLTVPGHPNVYVVGDL
    MSRDKLAGVAEVAMQGGRHAGARIAATVENGVPSRKPFKYRDLGTAAYISRRHALLQAGPVQLSGFIGWVSWGIIHIAFL
    AGFRNRASTVLNWGATLASKTRRERAITYGDPETARQPYN

    >gi|226307931|ref|YP_002767891.1| oxidoreductase [Rhodococcus erythropolis PR4]
    MGATVTIFEFSYPAVTERTRTDPTYRGAMTDEFDVIVIGGGPAGENAAACAIAGSNRTAAIVEHELVGGECSYWACMPSK
    ALLRPGQVLEAADALPGIPAGPLDVEAVLKRRDSFTHNHDDSSQVDWATSAGITVIKGHGVIDGERAVTVDGTRKLRARQ
    AVVLATGTTATVPRTPGLREALPWTSRDATNLHEVPSRVAVIGGGVVATECATWLSSFGAHVTLLVRGDALLKSAEPFAG
    TMVAEALGARGVDVRLSTAVNSVSRPDAKDTGEGHIHGGPVSIETSSGVIEVDEVIVAAGRGPTSADLGLSVIGLEDGKY
    VTTDDHLCAQGEWLYAVGDINGRSPLTHMGKYQARVCGDVIAARAESRGLRGPRYTASADNGQVPQVVFTSPEIAWVGRT
    EKKARDDGYDVEVVEIELAVAGSSLLRDDYSGRAKLVIDKATDVILGATFAGPEVSELVHAATIAVVGAVPLETLWHAVP
    SYPTVSEVWLRLLEARR

    >gi|226308039|ref|YP_002767999.1| oxidoreductase [Rhodococcus erythropolis PR4]
    MRTHTETEILDAVIVGGGAAGLSAALVLGRARRSVAVIDSGKPRNTPAAHMHGFLSRDGMAPGELLAVGRSELQTYGVEF
    KRDDVVDISWRGIEPGFVVELSGGTTLETRTVLVATGLRDSLPKIPGIQELWGQSVLH
    CPYCHAYEISDQPIGVLGGDAR
    EMSLHQAFLLRQWSSDVTFFPDKISLTPDERARLAARGVTVADGSVSGLVCEKSKLKAVELDNGQLVARSALFVAPRFVP
    NDAHLTRLGCKASPMGFVAVDHSGATSVPGIWGAGNVVDPRAQVINAAAAGSTAAIAINGYLVEQDVESALRSTDPEGGF
    SAAMEQGVCEMNGGSALHGI

    >gi|226308081|ref|YP_002768041.1| dihydrolipoamide dehydrogenase [Rhodococcus erythropolis PR4]
    MVESNTSKKYDVLVIGGGPGGYVAAIRAAQLGLNVALVERDRLGGICLNWGCIPTKAMLHGADVAHTLSELDKYGFSSAS
    VQFDISKLVSFSRGVSEKLSGGVAYLMKKNGVDVISGTAKLVDKGVVSVEGQTYRADHVIIATGARPRSIPGVAPDGDRV
    WTYFDALVPKELPKSLLVIGSGAIGVEFASLYRDLGAEVTIVEMAPHIMPVEDEEISAFVRKQFEKRGITIHTGASVSAV
    TVGADAVEVNVQTSDGVQAVTVDRVLVAAGITGNVEDLGLETLGVEIERGAIITDQWCRTSAFGIYAIGDVAGAPCLAHK
    ASHEAVLCVEKLAGVPDVHPLDRDYVPGCTYARPQVASLGLTEKQCAGTGRTLRVGHFDLQANGKALAIGEAEGFVKTIF
    DADTGELLGAHMVGPDVTEQIQGFGIARSLEATGDDLAEVVFAHPTLSEAMHESVLSALGRPLNA

    >gi|226308223|ref|YP_002768183.1| soluble pyridine nucleotide transhydrogenase [Rhodococcus erythropolis PR4]
    MTDPMEYDLVVIGSGPGGQKAAIAAAKLGKRVAMVEKGNMLGGVCVNTGTIPSKTLREAVLYLTGMNQRELYGASYRVKE
    NITPADLLARTQHVITKEIEVVRSQLLRNRVELLVGVGSFVDEHTILVEDASRGDKMTITAKFVVIATGTLPARPAGVSF
    DSHRVLDSDGILDLTSIPTTMVVVGAGVIGIEYASMFAALGTKVTVVEKRTSMLDFCDPEVIESLRFHLRDLAVTFRFGE
    EVTAVDVGANGTLTTLRSGKQIPAETVMYSAGRQGLTAPLALENAGLEADERGRIYVDDNFRTKVEHIYAVGDVIGFPAL
    AATSMDQGRLAAYHAFDEPGAKLMDLQPIGIYSIPEVSYVGATEVDLTKESVPYEVGVSRYRELARGQIAGDTYGMLKIL
    VSTDDLKLLGVHIFGSGATDLVHIGQAVMGCGGTVEYLVDAVFNYPTLSEAYKVAALDVMNKIRALKQFH

    >gi|226308228|ref|YP_002768188.1| organic hydroperoxide resistance protein [Rhodococcus erythropolis PR4]
    MNIVYTAEALATGEGRNGHARTSDGRLDLGLAIPKEMGGSGEGTNPEQLFAAGYAACFHSALQMVARAEKANVADSAVGA
    RVGIGPNGAGGFGLAVTLEVSLPHLPHDQAVELTEKAHQV
    CPYSNATRGNIEVTLEVSKDDE

    >gi|226308295|ref|YP_002768255.1| thioredoxin [Rhodococcus erythropolis PR4]
    MTGITILLVALVAVVAVGFFLKSRNGKVRVTTPAAAGAADSRLELLSSAGVSSPNGGPVVLHFSADWCGPCAAVRRVVGQ
    VVVSMADAPRPPVEIELDIDKEPALAREMSVLSLPTTFILDGGLEEQFRVSGVPSAADLKAALVPLSGPHEPKSENSG

    >gi|226308297|ref|YP_002768257.1| thiosulfate sulfurtransferase [Rhodococcus erythropolis PR4]
    MARSDVLVSADWAEQNLNTPKTVFVEVDEDTSAYDGGHIEGAVKLDWRKDLQDGVRRDFLNQEQFSDLLSAKGIANDDTV
    VLYGGNNNWFAAYAYWYFKLYGHQDIKLIDGGRKKWELDGRPLSKDAVNREATQYKAETPDFSIRAFRDEVIDAIGSKNL
    VDVRSPDEFSGKILAPAHLPQEQAQQRGHVPGAINIPWSTTANEDGTFKSDDDLTKLYAEKGFDDTKETIAY
    CRIGERSS
    HTWFVLQEILGKNNVKNYDGSWVEYGSLVGAPIELGA

    >gi|226308651|ref|YP_002768611.1| hypothetical protein RER_51640 [Rhodococcus erythropolis PR4]
    MTTASISHLSSVVAANADAIDKDASKAHVVFKASAQAHDAVASTISLGKYTVEVDEPPALGGENTAANPVEYYLASLLSC
    QVVTYRVWADKLGIALDDISARAEGDLDVRGFFGFDDAVRPGFSEVRVVVTLTGPETRERYLELQETVDAHCPVLDLTRN
    PVPVHTVVETA

    >gi|226308723|ref|YP_002768683.1| methylated-DNA--protein-cysteine methyltransferase [Rhodococcus erythropolis PR4]
    MAYRTVDSPVGKLLLAATDVGLVRVAFAVEGHDLVLERLADTVSPRVLHYPRRLDAVARELDEYFAGARREFDLRLDFQL
    AKGFRREVLRHLPEIEYGDTASYSVVAAASGSPRAVRAVGTACAKNPLPLVVP
    CHRVVRSDGSLGQYAGGPELKAILLDL
    EAGR

    >gi|226308725|ref|YP_002768685.1| methylated-DNA--protein-cysteine methyltransferase [Rhodococcus erythropolis PR4]
    MTAIRTHTVIDSPIGALTLVAAGDDLCGLYMAEHRHKPDESTFGDRSAAVFGEVESQLTEYFEGDRTEFSVPLAPVGTEF
    QKRVWDTLRTIPYGETWTYMELAQTLGNPLAIRAAAAANGKNPISIIVP
    CHRVVGSDGSLTGFAGGLERKRFLLDREHGG
    ESDVLF

    >gi|226308769|ref|YP_002768729.1| hypothetical protein RER_52820 [Rhodococcus erythropolis PR4]
    MSTRFPQAELTEVPEDIAAKILEIQEKSGFVPNVFLMFARRPAEFRAFFAYHDAIMLKEDSALTKGDREMIVTTISAANK
    CTY
    CVVAHGAILRIYEKKPLVSDQVAVNYRTAEISDRQRAMLDFATKVNSASHEIADADFDALREHGFGDEDAWDIAAIT
    AFFGLSNRMASFSGMLPNPEFYLMGRVPRS

    >gi|226308849|ref|YP_002768809.1| methylamine utilization protein [Rhodococcus erythropolis PR4]
    MTTFLLVATVILVIAVAVLFLMVLALAREIGRVQVRLGPLGARMMDTGPKVEQAGPSFAGLIDQDGRTVGVGGHRDKPQL
    LLFTAPS
    CSTCKSLLPGVRAMARAESDLDVIIISDGTPEEHREFLAGSGIGSELSYIDARDVGIAYQVGTTPYGVILDEH
    GKIRGKGLCNHMAQVESLLNALESGTPSLQHLHAQAKSGSAA

    >gi|226309427|ref|YP_002769387.1| organic hydroperoxide resistance protein [Rhodococcus erythropolis PR4]
    MTELKYTAEATADGNGRNGHVSSDDGLIDLNLGIPVGIGGAGGGSNPEQLFAAGYAGCFLSALSSVARVHKVRLVDPTVT
    SRVTIADSGEGFGLSVELLVNLPGVDEDQAREIAEGAHQK
    CPYSKAVRGNINVAITVQ

    >gi|226309468|ref|YP_002769430.1| dihydrolipoamide dehydrogenase [Rhodococcus erythropolis PR4]
    MTTAEPHSDVVILGGGSGGYACAIRAAQLGLSVTLIEADKVGGTCLHRGCIPTKALLHSAEVADSARTSEQFGVRASFDG
    IDIAQVHDYKNGTVERLYSGLQGLLAQHKITIVNGYGTYVGGRSIDVDGTRYTGTSLVLATGSYPRELPGIELGRRILTS
    DQALELDRVPTSATVLGGGVIGVEFASIWRSFGAEVTIVEALPRLIAAEDPWSSKQLERAYRKRGIVCKTDTKIVSAKEA
    ADSVRVELGDGTIFDTELLLVAVGRGPRTDGNGFEENGISLDKGFVVTDERLRTSVDGVYAVGDIVPGLALAHRGFQQGI
    FVAEQIAGKDPIPVAEHLIPRVTYSHPEVASVGLGEEAARTQYGDISTVVYDLSGNGKSQILRTTGGIKVIRSGTRGPVI
    GVHLVGDRVGELIGEAQLAVAWEALPDEVGRFIHAHPSQNEALGEAMLALAGTPLHAHS

    >gi|226309505|ref|YP_002769467.1| thioredoxin reductase [Rhodococcus erythropolis PR4]
    MTTQLETTPAVHDVIIVGSGPAGYTAGVYTARAELQPLLFEGTQFGGALMTTTEVENFPGFREGIMGPDLMEQMREQALR
    FDTDIRTEDVEEIDLSGPIKTVVANGETYAAHAIILAMGAAARYLGIPGEERLLGRGVSA
    CATCDGFFFRDQDIVVVGGG
    DSAMEEATFLTRFARSVTLVHRREEFRASRIMLERAKANEKIRFLTNAEPVEVLGENSVTGLVVRDTVTGETSTLEITGM
    FVAIGHDPRSELVKGQVDLDDAGYVRVAPGSTATSIDGVFAAGDLVDHTYRQAITAAGTGCSAAIDAERWLADRGDITAN
    TLDAAGHTVDVVGAP

    >gi|226309506|ref|YP_002769468.1| thioredoxin [Rhodococcus erythropolis PR4]
    MSNTVTITDDSFKQDVLGSDKPVLVDFWATWCGPCKMVAPVLEEIAGENSEKLTVAKLDIDANPAAARDFQVMSIPTMIL
    FKDGKPIKTIVGAKGKAALLKDLADVL

    >gi|226308160|ref|YP_002768120.1| hypothetical protein RER_46730 [Rhodococcus erythropolis PR4]
    MTRIPAVTPSEASPLIKVAYKFAARQYDEVPEPFAVLANHRKLFVAAARHEMAVQKASKVLPSNIRELAVYRVAWTVGCS
    W
    CVDFGTMLSRLDGLDIDKLKGIANYRDSPKYSEDERAAIAYADAMTGDPHGENGVTDEQVADLERRFGRAGVVELTYQI
    GLENMRARMYSALGITEQGFSTDSCRVPWAEE

    >gi|226305818|ref|YP_002765778.1| hypothetical protein RER_23310 [Rhodococcus erythropolis PR4]
    MSTKSSKNKYSPEPVSSRSTYIIGGLAVLVIAALVIGGVLWTNSKNKPQNDGYGSVQSSEVAVTVQDNGVVLLGKPSAAT
    TIDLFEDPL
    CPACAALEHLSGQALAAAVDNGDVAVRYHMLNFLNRASGSGDYSTRAGAALLCVAQGGDAIAYSAFHNKLF
    ATDTQPAEGGSSDHTNDDLAQIARDAGASEDVATCISSGTNVEAAAAHAAAASQALKDVGSNGTPTVVANGKIVDTGSSD
    WVSKLSS