Rhodococcus equi 103S uid60171

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|312137558|ref|YP_004004894.1| glutamate synthase small subunit gltb1 [Rhodococcus equi 103S]
    MGDPNGFLKHTSRELPIRRPVPLRLMDWKEVYEDFSSDTLKTQASRCMDCGIPFCHNGCPLGNLIPEWNDLVYKDRWREG
    IDRLHATNNFPEFTGRLCPAPCEASCVLGINQDAVTIKQVEVEIIDRAFDEGWVQPVRASHITGKKVAVVGSGPAGLAAA
    QQLTRAGHSVTVFEREDRIGGLLRYGIPEFKMEKRHIDRRLAQMEAEGTVFRTGVNVGVDITAEQLREQFDAVVLAGGAT
    EARDLPIPGRELDGIHQAMEFLPIANRVQLGDLAEPTITAKGKKVVIIGGGDTGADCLGTSHRQGAESVHQFEIMPRPPA
    ERAGSTPWPTYPLMYRVSSAHEEGGERVFSVNTEEFVGRDGKVTALKAHEVEMVNGRFQKVEGSDFELEADIVFLAMGFV
    GPEKPGLLTDLGVDLNERGNVARSSEWATNVDGVFVAGDMGRGQSLIVWAIAEGRSCAAAVDKFLEGSTALPTPISTTSA
    PQR

    >gi|312137660|ref|YP_004004996.1| peptide-methionine (s)-s-oxide reductase mrsa [Rhodococcus equi 103S]
    MMVTQDQALPGRDAVMPVPDAHYVNGHPLRPPFPDGMQTAVVGMGCFWGAEKEFWELDGVYSTAVGYAGGFTPNPTYEEV
    CSGRTGHSEVVLVVFDPAKISYEGILKQFWENHDPTQGMRQGNDRGTQYRSVIYTESDEQAETARATAEAFGKRLAAAGY
    GEITTEIAPLDTFYYAEDYHQQYLAKNPGGYCPVHATGVSCPVGLGA

    >gi|312137663|ref|YP_004004999.1| hypothetical protein REQ_01600 [Rhodococcus equi 103S]
    MTSPHVPTVHVTDLPVERDGTVVLLDVREDDEWSLGHAPGAQHIPVVDLPARMDEIDIDAEVYVVCRQGGRSIVAVEFLN
    SVGFDAYHVDGGMVAWQVAGLPLTSDDHPDTPKIF

    >gi|312137992|ref|YP_004005328.1| thioredoxin [Rhodococcus equi 103S]
    MRMSSGARWSLVALVVVVGLIVAIWPRGDDESVDVGGYPGADRSASQQERRAADTPEALAAARADAELEPCPAPGGPAPD
    GSVLEGITLECVGDGSRVDLAAALAGKPVLLNLWAYW
    CGPCREELPYLQQYADRAGSAVTVLTVHTDPNEANALARLAEY
    DVHLPGVQDGSARVQAAVGSPAVLPVSVLIRPDGTVAKILPQPFRSVDEIADVVQQYLGVAA

    >gi|312138039|ref|YP_004005375.1| alkylhydroperoxidase ahpd [Rhodococcus equi 103S]
    MSSVNLGKQHPDAYKQLIALNGQADAAVEASGLGPLVGDLVKIRISQLNGCAFCLRMHTRDALEKGETTDRVAVLAAWWE
    SQYFSPQERAALALAEQVTRLSVPDARAWDDGSLTDEQVSAISWLAIVMNAWNRVAITSHYPVAP

    >gi|312138064|ref|YP_004005400.1| hypothetical protein REQ_05960 [Rhodococcus equi 103S]
    MTIDQMLEDARSQLDRMYVFELVEAHRRGAIFVDIRPQAQRAREGTLPGALAVERNVLEWRLDPSSDAHLALAVDHDVEW
    VIV
    CSEGYTSSLAAASLRQLGLHKATDLVGGYKAIKAAGLLGALMGERHCTRELASVSAH

    >gi|312138074|ref|YP_004005410.1| osmotically inducible protein [Rhodococcus equi 103S]
    MPTRTARTAWNGTLEKGSGQVELTSSGVGTFEVSFPKRAADDAGGTTSPEELIAAAHSSCYAMQLSALIGEAGGTPQSLD
    IRADVSLGPDDPGFKLTGIVLTVRAEVDGLDAAGFARVAQAAKES
    CPVSKALTGVAITLDAALE

    >gi|312138085|ref|YP_004005421.1| dithiol-disulfide isomerase [Rhodococcus equi 103S]
    MFECVVTIESNVGAEPAENEPAAPTALIEVWSDVACPWCYIGKRRFTAALDRFEDRDRVSVVWRSYQLAPDTPVGARRGE
    LEALVELKGMPADQVRQMFQHVAATAAADGLVMDFDTVIAANTFDAHRLLHLAGERRDALLEALFRAHFTDGKVIDDRNV
    LADLAASVGMDAAEVAAALAGDAGADLVRADLTAAGQLGVSGVPFFVANRRLAVSGAQPQDVFTGLLRRAVADADTEGAD
    SGAAPGGDAEGCADDSCAV

    >gi|312138237|ref|YP_004005573.1| oxidoreductase [Rhodococcus equi 103S]
    MVVTERTTGRIKVSEQLSNGYDVVVVGGGAAGLEGALMLARSRRSVLVIDAGEPRNAPAEGVHGFLSRDGIAPADLTRLG
    ADEVRRYGGEIADGAVSDIRRVDDGFSLVLADGRSVDARRVLVTTGLTDELPDVPGVRERWGRDVLH
    CPYCHGWEINDEP
    VGVLGTGPMSVHQALMFRQWTDDVTLFLHTAPQPTDDEREQLAARGIRIVTGRVAELVIDDDRLAGVRLDDGTVVDRRAL
    VVAPRFVARVDALTSLGVETELEPMSGGRFVPSDWSGLTKVPGLWVAGNVTDVKAQVLAAAAGAATAAVAINNDLIAEDT
    ARAVAERRAQNEKGPQR

    >gi|312138265|ref|YP_004005601.1| hypothetical protein REQ_08010 [Rhodococcus equi 103S]
    MTSPARVTITYCTQCNWLLRAGWMAQELLNTFGTELGEVAMIPGTGGIFQVTAGDTLVWDRKRDGGFPDIVTLKKLVRDA
    VVPDRNLGHADRARSD

    >gi|312138285|ref|YP_004005621.1| thiol peroxidase [Rhodococcus equi 103S]
    MTTPLQNLEINTLGGVPTSLGEYGGRALLVVNVASKCGLTPQYTALEKLASEYAERGLTVIGIPCNQFMGQEPGTPEEIQ
    TFCSTTYGVTFPLMEKVDVNGENRHPIYAELTETADADGEAGDIQWNFEKFLIAPDGTVVNRFRPRTEPDAPEVIAAIEA
    VLPR

    >gi|312138319|ref|YP_004005655.1| thiosulfate sulfurtransferase [Rhodococcus equi 103S]
    MARSDVLVSADWAEQNLDAPKTVFIEVDEDTAAYDASHIEGAIKLDWRKDLQDGVRRDFLNQEQFSALLSAKGVANDDTV
    VLYGGNNNWFAAYAYWYFKLYGHQDVKLIDGGRKKWELDGRPLSKETVTRPATEYKAAAPDTSIRAFRDDVIAAIGSANL
    VDVRSPDEYSGKILAPAHLPQEQAQQRGHVPGAINIPWSTTANEDGTFKSDADLEKLYADKGFDETKDTIAY
    CRIGERSS
    HTWFVLQEILGKQNVKNYDGSWVEYGSLVGAPIELGA

    >gi|312138321|ref|YP_004005657.1| thioredoxin [Rhodococcus equi 103S]
    MTALIILVVAIAATVAVGLILQSRAGKVRATAPAATAAVDDERATQLAAAGVTATGRPIVLHFSADWCGPCAAVRRVVGQ
    VLARFEADPDGTPAATEVEVDIDEHPALAKTLGVLSLPTTFILDGALTERFRISGVPSAPDLETALAPLLETGRPNS

    >gi|312138569|ref|YP_004005905.1| dihydrolipoyl dehydrogenase [Rhodococcus equi 103S]
    MAPEDFDVIVIGGGPAGENAAAYAIAGSDRTAALVEHELVGGECSYWACMPSKALLRPVEVLGTARHMPGVEEKVNAYGL
    DTEAVLARRDGFTHNLDDSSQVLWADSVGIDVIRGTARITGVREVTVGDRVLRARHAVVLATGTRASVPDLPGLRDALPW
    TSRDATNVREVPPRLAVVGGGVVACEAATWMHELGADEVTLLVRGSALLERTEPFAGELVAEKLRKHGVNVRFGTSLQTA
    SRPGAADTGVGRIHGGPVTLTVSGDGSDSELTVDEVLVATGRTPATAGLGLDQFGLPDHGYVGVDDHLTVTGVDGEWLYA
    VGDVNGRALLTHMGKYQARVCGDVIAARAEGRPLDGPRFVASADHGQVPQVVFTTPEVAAVGRTESQARADGLDTEVVTV
    DIDVAGAALSRDDYSGRASLVIDRATDTVVGATFVGSGVAELVHAATVAVVGKVPLESLWHAVPSYPTVSEVWLRLLEAR
    RDR

    >gi|312138636|ref|YP_004005972.1| arsenate reductase arsc2 [Rhodococcus equi 103S]
    MAGTAKNATIYHNPRCSTSRNTLKLIEEAGLEPTVVKYLETPPSRDGLRKLLDEAGLRPSEAIRKKEAVYKELGLASASE
    DELLDAMVDNPILIERPIVVTDRGTVLARPYEKVRDIL

    >gi|312138656|ref|YP_004005992.1| cation transporter atpase p-type [Rhodococcus equi 103S]
    MTTADLTTGRNDTIELAIGGMTCASCAARVEKKLNKIEGVTATVNYATEKAKIAFPEGVSTDDLVTAVQNAGYTATLPTP
    PSADESGPTDDPRDRELTALRTRLIVSAILSVPVIAMAMVPALQFDNWQWLSLTLAAPVIVWAGLPFHRAAWTNLRHGTA
    TMDTLISLGTTAAFAWSLYALFFGTAGTPGMKHAFELTVDRMDGAANIYLEVAAGVITFVLAGRYFEAKSKRTAGAALRA
    LLELGAKEVSVLRDGVESRIPADQLRVDDLFVVRPGEKVATDGVVVEGNSAVDMSMLTGESVPVEVGVGDDVVGATVNAG
    GRLVVRARRVGGDTQLAQMAALVEDAQNGKAEVQRLADRIAGVFVPIAIAISVAALGYWIGTGNPLQMAFTAAVAVLIIA
    CPCALGLATPTALLVGTGRGAQLGVLIKGPEVLETTRGVDTIVLDKTGTVTTGKMTLIDVVTTDGVDRDEALRLVGALEN
    ASEHPIAQAVAAGAAEGVGSLPSVEDFVNVEGKGVQGIVDGHAVVAGRESLLADWSQHLPDDLARAKREAEKLGRTAIAA
    GWDGQARAVFVVADAIKDTSADAVRRFKQLGLNPVLLTGDNETVARTVAAQVGIDTVVAEVLPGDKVDAVKNLQAEGKVV
    AMVGDGVNDAAALAQADLGLAMGTGTDVAIEAADITLVRGDLRSAADAIELSRKTLRTIKGNLFWAFAYNAAAIPLAAAG
    LLNPMLAGAAMAFSSVFVVSNSLRLRRFSPSA

    >gi|312138658|ref|YP_004005994.1| heavy-metal detoxification protein [Rhodococcus equi 103S]
    MSTAEYTVTGMTCGHCVSSVKEEVGAIGGVSDVAVDLKSGRLTVTSAAPLPVDAVTAAVEEAGYTAQPI

    >gi|312138733|ref|YP_004006069.1| hypothetical protein REQ_12910 [Rhodococcus equi 103S]
    MTSPGGRERNTLGEATSPYLRQHADNPVHWHQWGPDALAWARERDVPVLLSIGYAACHWCHVMAHESFEDDATAAVMNEH
    FVCIKVDREERPDLDAVYMNATVAMTGQGGWPMTCFLTPDGAPFYCGTYYPREPRGGMPSFVQLLHAVTDTWRSRRGDVD
    DAAASVVAELRRSSGALPAGGAPIDVPLLSGAVANVLRDEDRDHGGFGGAPKFPPSMLLEGLLRSYERTSAGPTLRAVER
    TAEAMARGGIYDQLGGGFARYSVDTQWVVPHFEKMLYDNALLVRFYAHLARRTGSALARRVTEETVDFLLRDLRTAAGAF
    ASALDADTDGEEGLTYAWTPQQIADVVGDDDGRWAAETFAVTDTGTFERGTSVLQLPADPLDADRLADVRSRLLAARTRR
    PQPARDDKVVTAWNGLAITALAEAGAALGRADWVEAAEECAHMVLSTHLVDGRLRRASLGGTVGEPAGILEDYGALAAGL
    STLHQVTGAAEWLEAATGLLDTAIDHFADPDEPGSWFDTADDAETLVARPRDPLDGATPSGASVTTEALLTASSLVAADR
    SARYAVAAADSLNRASVALQRAPRSAGHWLAVAEAFVRGPLQIAVSEDAPSELSMQARVLAPGGAVVVAGRADSTPLLAD
    RPQIDGAPTAYVCRGFVCDRPVTDPEDLRAQIER

    >gi|312138786|ref|YP_004006122.1| thioredoxin [Rhodococcus equi 103S]
    MWMPGWRNGRAIAAAGLAAMLLSGCATGTDAVAQGGTFDFVAPGGQMDIFYDPPESRGTIGNLAGPELITDQQVGVADFP
    GQVVVINLWGQW
    CAPCRAEADDLERVYQATRGSGVQFLGINVRDPQRDKAQDFAVDFGLTYPSIYDPPMRSLLALGGKYP
    TSVIPSTIVLDRQHRVAAVFLRELLDVDLQPVVERIAAE

    >gi|312139105|ref|YP_004006441.1| dsba oxidoreductase [Rhodococcus equi 103S]
    MATDRGTDAEPITSVDFHFDPMCPFAFHASRWIRHVRAETGIDIAWRFFSLEEINRRDDQKHPWEREWSYGWSLMRVGAL
    LRRESMDLLDRWYFATGHLLHVDGGKPHDPTVARGLLERLGLDPALLDAALADPTTHDDVRADHDRVVAAGGFGVPTLFV
    QGTAFFGPVLIDPPSGEAAVRLWNTVTELLEFPHVYEIQRIKGASDAADIGRALEPYVRGRDWQSVDRGEVVDLPAAETE
    SDR

    >gi|312139190|ref|YP_004006526.1| thioredoxin [Rhodococcus equi 103S]
    MTRPGSRPSPAIAAAMAGAVDLSGLKDRAPAPPSPSVGPPADGSAPVNPTGLAPVVDVTEATFQTEVLDRSNQVLVIVDL
    WATW
    CGPCKQLSPVLEKLAHEGGGNWVLAKIDVDANPGIAQAFGVQSVPTVVAIAAGRPLADFAGAQPEPQLRQWIAALQ
    EAVAGKLSGPPSADGEPEPEPEDPRFVAAENALDEGDFAGAEAAYNLILNSEPANQQAQAALRQVRFLARVQDLPADAVA
    VADAQPDSIDAQFAAADAELYSQQPEAAFDRLVALVKRTFGDDRTTVRTRLLELFELFDSAEPIVVAARRKLASALY

    >gi|312139285|ref|YP_004006621.1| mycothiol disulfide reductase mtr [Rhodococcus equi 103S]
    MNHFDLAIIGTGSGNSILDERYDGKKVAILEESTFGGTCLNVGCIPTKMFVYAAEVARTITASSKLGIDATLDDVRWSDI
    VKRVFGRIDPISAGGERYRTEDCDNVTVFRGHARFVGPRSIDTGTGEVITADRVVIAAGSRPSIPNEVLEGGVRYHTNDD
    IMRLPELPERLVILGSGFIAAEFAHVFSALGVQVSIVGRSDRLLRHLDKDVSTWFTELAQRKWDVHLGNPMVAARPAGNG
    IELELADGTVVSGDELLVAVGRIPNGDRLDAALGGVAVDEAGRVIVDEYQRTTAEGVFALGDVSSPYQLKHVANHEMRVV
    QHNLLHDAWASTAHLRRTDHRFVPAAVFTDPQIADVGMTEEQAREAGLDITVKLQNYCDVAYGWAMEDDEGFCKVIAERG
    TGRLLGAHVIGAQAPTVIQPLIQALSFGLSAQDMATGQYWIHPALPEVVENALLGLDI

    >gi|312139472|ref|YP_004006808.1| peptide-methionine (s)-s-oxide reductase mrsb [Rhodococcus equi 103S]
    MSSTQDSGLPEPKFRRNDGEWRAQLTPEEYRVLRQAGTEPPHVGEYTDTKTEGVYNCRACGAELFRSTEKFESHCGWPSF
    FDPADSDAVILRADDSLGMHRVEVLCSNCHSHLGHVFEGEGYPTPTDQRY
    CINSISLTLQPTEPNE

    >gi|312139707|ref|YP_004007043.1| hypothetical protein REQ_23130 [Rhodococcus equi 103S]
    MATPKIVLFYRFTPLADPEAIRLWQQTLAASNNLTGRILISEHGINATVGGDIADVKRYVRGTRSYAPFKDADIKWSDGT
    GDDFPRLSVKVRPEIVTFGAPDELKVDADGVVGGGVHLSPDELHELVEQRGDDVVFFDGRNKFEAEIGRFRNAVVPDVAT
    TRDFLSELDSGRYDHLKTKPVVTY
    CTGGVRCEVLSALMRNRGFEEVYQIDGGIVRYGEAYGDEGLWDGSLYVFDKRMNLQ
    FSGNAVTLGTCTLCQEPTSRYRNYPDTGGRELVLVCESCVPDA

    >gi|312139713|ref|YP_004007049.1| sam dependent methyltransferase [Rhodococcus equi 103S]
    MASGGLGRSGPFQVGDRVQLTDAKGRKYTVVLEPGKEFHTHRGGILHDALIGTDEGTVVTSTNGTPYLALRPLLTDYVLS
    MPRGAQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTCSLLRAVGPTGRVTSYEVREDHAEHAVRNVETFFGGRPENW
    DLTIADLAEYEADVDGKVDRVVLDMLAPWDVLPAVSKALVPGGVLVVYVATTTQLSKVVEAMREQE
    CWTEPRSWESMVRG
    WHVVGLAVRPEHRMQGHTAFLVTARRLAEGTVTPKPQRRPSKG

    >gi|312139905|ref|YP_004007241.1| thioredoxin [Rhodococcus equi 103S]
    MATQTLTQQNFKQTVEDNDIVLVDFWASWCGPCRNFAPTFDASSEKHPDVVHGKMDTEAEQEFAAGAGIRSIPTIMAFRE
    GVLVFNQAGALPPAALEDLITQVKALDMDAVRAEIASQTGN

    >gi|312139925|ref|YP_004007261.1| alkyl hydroperoxide reductase [Rhodococcus equi 103S]
    MKPGERAPEFDLSDQDGIRRTLASLLADGPLVLFFYPAASTPVCTAEACHFRDLAREFAAAGGSVAGISRDAVEKQASFA
    RAQEFDYPLLADVDGTVAQQFGVRRGLLGRITPVKRSTFVIDTDRTVLEVISSELRANLHADRALEFLRSRA

    >gi|312140086|ref|YP_004007422.1| alkyl hydroperoxide reductase [Rhodococcus equi 103S]
    MALINKQIKPFSATAYKNGAFVDVSDEDIKGKWAIFFFYPADFTFVCPTELGDLADHYEELQRLGVEVFSVSTDTHFTHK
    AWHDSSETIGKIQYAMIGDPTLEISTNFEVLRENQGLADRGTFLVDPDGVVQFMEITAEGIGRNAAELLRKVKAAQYVRS
    HPGEVCPAKWEEGEETLAPSLDLVGKI

    >gi|312140087|ref|YP_004007423.1| alkyl hydroperoxide reductase [Rhodococcus equi 103S]
    MLDAPLAAQLKSLLERLTLPIELVSSLDDGAKSAELAELLTEIAAMSDKITYERLDDDARRPSFAIRRVGTDIEVRFAGI
    PLGHEFTSLALALLQVGGYPSKEAPEVLEQVQGLEGKYHFETYFSLS
    CQNCPDVVQALNLMAVLNPGVSHVAIDGALYQD
    EVDGRQIMAVPTVYLNGELFGSGRMSLAEIVNKLDDGAADRAAAAIAEKDPFDVLVVGGGPAGAAAAIYAARKGIRTGIA
    AERFGGQVLDTMAIENYISVPYTEGPKFGAALENHVRQYDVDLMNTQRAAKLVPAATENGLVEVELESGASLLARTVILS
    TGARWRSMNVPGETEYRNKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVSHVTLVEFDSVLRADEVLQRKLR
    SLPNVTILLSTLTTEVLGDGSKVTGLTYTDRTTDESHTVDLEGVFVQIGLLPNTEWLDGSVDLSPRGEIVVDDRGQTSVP
    GVFAAGDCTTVPFKQIVIAAGAGATAALSAFDHLIRTSAPEEESAAAVG

    >gi|312140195|ref|YP_004007531.1| fe-s cluster assembly protein [Rhodococcus equi 103S]
    MTVQNETATHGVTMTEAASSKAKALLDQEGRDDLALRIAVQPGGCAGLRYQLFFDDRSLDGDLVVDFGGVNLAVDRMSAP
    YVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|312140217|ref|YP_004007553.1| hypothetical protein REQ_28540 [Rhodococcus equi 103S]
    MYKLSSVAWPLIQAEELAALLGEESAPVVLDVTVLLAPARFDGDYRPASGASAWREAHVPGSRHVDLLAVLSDGGSDLHF
    SRPRVGQLVEDLAGLGITADTDVVLYDQGTTTWAARVWWLLRSIGFHARVLDGGLARWRTLDLPVAVGDDAPVRPAAAPL
    DVTEYRPAWADRHDAVAIVEGSAPGTLVCALAPAQFSGAEQTRYSRRGHIPGSRNLSAKSLLDETGRLRPVEELRSLASA
    ALAGADDPVVLY
    CGGGISACLSALGLVLAGHHDIRIYDGSLEEWTADPALPLVTLPGGEP

    >gi|312140253|ref|YP_004007589.1| alkyl hydroperoxide reductase [Rhodococcus equi 103S]
    MVVTDVLPYPTLGTGMPLEVGAVAPDFTLKDQNNQEVALSDFRGKKNVLLVFYPLAFTGVCQGELCRVRDELPKFQNDDA
    EILAVSVGPSPTHKIWAAEQGYTFPLLSDFWPHGAVAEAYGVFNDKLGFANRGTFAIDKEGVIRFAEMNGPGEPRDQAAW
    EKALTALKS

    >gi|312140368|ref|YP_004007704.1| dsba oxidoreductase [Rhodococcus equi 103S]
    MQAQTPGTDDATDTVDFWFDPLCPWCWITSRWILEVTRVRDIEANFHVMSLAVLNEGRELPEEYRERMAQAWGPVRVLMA
    AAQQRGDEILLPLYTAMGTRIHNGGDQDLTNVVVEALAELGLPAELAAAADTDEYDAELRRSHHAGMDKVGDDVGTPTIH
    VNGTAFFGPVLSRIPRGEDAGRVWDGTVALASYPHFFELKRTRTEDPEFD

    >gi|312140426|ref|YP_004007762.1| alkyl hydroperoxide reductase [Rhodococcus equi 103S]
    MTDNRLAPGDIAPEFTLPDADGNEMSLADYRGRKVIVYFYPAASTPGCTKQACDFRDSLDELNGAGLDVVGISPDKPAKL
    AKFRDNEGLTFPLLSDPEKATLTAWGAFGEKKMYGKVVQGVIRSTFLVDEDGKIEVAQYNVRATGHVAKLRRDLSV

    >gi|312140445|ref|YP_004007781.1| thiol peroxidase [Rhodococcus equi 103S]
    MNAHNFPVQTADGATEDLSAHKGKLLLIVNVASKCGLTPQYEGLEALHRANKDKGLQVVGFPCNQFGDQEPGDDAEIQQF
    CSVNYNVTFPVYAKLEVNGDDAHPLYQYLRAQAPGDFGPDHGFLYEHVSKTRPEAIGTDEVKWNFTKFLVDRDGEVVRRF
    EPTVTPEQIADEIAALL

    >gi|312140542|ref|YP_004007878.1| redoxin nrdh [Rhodococcus equi 103S]
    MSITVYTKPACVQCNATYRALDKAGLEYDIVDISENPEARDYVMALGYLQAPVVVAGEEHWSGFRPDRIKDLTANAA

    >gi|312140571|ref|YP_004007907.1| lipoprotein [Rhodococcus equi 103S]
    MRRTLPGNRFPGRLFPGRLAAAAACAGIGATLLAGCGTDGGDAPATSPRLVDVREFADIAASDDTFVLNVHVPDEGTIAG
    TDGAIPFDALAAEAAALPSDHGTTIAVY
    CMSGNMSATAVQDLADLGYTDVVELDGGMMAWMADGRELLPPAA

    >gi|312140575|ref|YP_004007911.1| protein [Rhodococcus equi 103S]
    MSSKKPKSAKYNPQPTSSKATYIVGGIAVVVIAALVIGGILLTRDSNKPRNEGYGAVQNSAVQVTMGEAGVVRLGLPDVT
    NTIDVFEDPM
    CPYCAQLEEKHGQEVAQAIDEGKVAVNYHILNFLNRLSVSGDYSTRAVAASQCVAQTGDAIAYSKFHAEL
    FSPTNQPAENGKSDLSNEQLATLAKDAGADEAAVNCITSGERMQQAAADAETGRQALAASGATGTPAVVHNGQVIDALSD
    PDWVSQVSQ

    >gi|312140613|ref|YP_004007949.1| mycoredoxin mrx [Rhodococcus equi 103S]
    MTTEAPALTMYSTTWCGYCRRLKKQLDENGISYVEIDIELDPASAEFVGSVNGGNHVVPTVKYADGSTATNPSLAQVKQA
    LGL

    >gi|312140638|ref|YP_004007974.1| molybdopterin biosynthesis protein moeb [Rhodococcus equi 103S]
    MSAKSPLPPLVEPAAELSRDEVARYSRHLIIPNVGTTGQKRLKNARVLVIGAGGLGSPTLMYLAAAGVGTIGIVDFDVVD
    ESNLQRQVIHGTADVGRSKAQSAREKIVEINPHVDVRLHEFRLDASNAVELFGEYDLILDGADNFATRYLVNDAAVLAGR
    PYVWGSIYRFEGQVSLFWDAAPDGRGITLRDLYPEAPPPGTVPS
    CAEGGVLGVLCASIGSIMATEAIKLITGIGESLLGR
    LMIYDALAMNYRTVRLSRDPDRVAVTELVDYDAFCGVTSVPEAERDATITPRELRALLDAGADIAIVDVREPVEWDIVHL
    PGATLIPKDRILSGEALSELPQDKRIVLH
    CKTGIRSAEALAAVRKAGFADAVHLQGGVVAWANQVDPSLPVY

    >gi|312140728|ref|YP_004008064.1| thiosulfate sulfurtransferase [Rhodococcus equi 103S]
    MPVAPDPNPAFAAYAHPERLVSTEWLSINLGAPGVKVVESDEDVLLYDIGHIPGAVKIDWHLDLNDPVTRDYIDGAAFAD
    LMSRKGISRDDTVVIYGDKSNWWAAYALWVFTLFGHEDVRLLDGGRDAWMSENRDTTFDVPTPAPTEYPVVERDDSSIRA
    FKDDVLAHLGHGPLVDVRSPQEYTGERTHMPDYPEEGALRGGHIPTAVSIPWARAAAPDGRFRSRPELEEIYGDFSRDDD
    VVAY
    CRIGERSSHTWFVLTHLLGYPNVRNYDGSWTEWGNVVRVPIVRGDEPGTVPGAAVEAAS

    >gi|312140753|ref|YP_004008089.1| oxidoreductase [Rhodococcus equi 103S]
    MTRIVIIGGGPAGYEAALVAAQHGAAVSLIDSDGIGGACVLFDCVPSKTFIASTGIRTDMRRATDLGISLDPSSATISLP
    EINSRVKNLAQVQSSDIRARLQSVGVQLLSGKAELIDRQIGMAAHQVRATLTTGEEKILDADVVLIATGASPRVLPGAVP
    DGERILTWRHLYDLEELPSHLVVVGSGVTGAEFVSAYTEMGVKVTLVSSRDRVMPHEDADAALVLEDVLAERGVTLVKHA
    RADAVERTEDGGIVVKLSDGRTVHGSHALMAVGSTPNTEGLGLEKVGIELGQGGYLRVDRVSRTAVSGIYAAGDCTGLLP
    LASVAAMQGRIAMYHALGEGVSPIKLKTVASAVFTRPEIANVGVSQAAIDNGEVPARTVMLPLNTNPRAKMSGLRRGFVK
    IFCRPATGVVIGGVVVAATASELILPIAIAVQNNLTVNDLAQTFSVYPSLSGSITEASRQLMRHDDLD

    >gi|312140801|ref|YP_004008137.1| hypothetical protein REQ_34660 [Rhodococcus equi 103S]
    MREIDVNELEAVLTTGAPLVDVREADEYAEARVPGAASIPLSEFVARVDEVPADGTVYVICAAGGRSAQAAQYLEARGVD
    AVNVVGGTMAWLQSGRAVESGS

    >gi|312140802|ref|YP_004008138.1| oxidoreductase [Rhodococcus equi 103S]
    MKVVIVGGVAGGMSAATRMRRLDESAEIVVFERGAHVSFANCGLPYYAGGVIEDRDELLLQTPESLGARFRLDVRVRSEV
    AAIDPDARTVTVHDLASGDTYVESYDELVLSTGASPIVPPLPGVERALILRDVEDVDRLVEQIESAQTSGAPSAVIVGAG
    FIGVELAENLRHRDLAVTVVELADQVLAPLDPEMAAPVADRMRENGVRLELGTQLTSIGATTAELADGRTLPADIVVMAI
    GVRPENTLAKMAGAELGERGGVVVDDRMRTSVPHIFAVGDAVEKRDAVGGGVAMIPLANPANRQGRLVADVIAGRPVRAT
    SSSGTAVVGVFGLIVAATGWNEKRLRAAGRPYRAIHTHPQSHAGYYPGAQQMAIKLLVDPETDAILGAQAVGGEGVDKRI
    DIIATAMAGGLTASDLADLELAYAPQFGSAKDPVNMLGYIADNLRTDSTRTVQWHELDTLVAGGASLVDVRTADEFAAGA
    VPGAVNVPLDELRDRVGELPAGDLIVH
    CQVGQRGHTAVRLLAGLGRPAANLDGGYKTWDAGQRAKAPAGVS

    >gi|312141074|ref|YP_004008410.1| cytochrome c assembly protein [Rhodococcus equi 103S]
    MKFPSLRLAAAACSLVVAATVAGCATGDDAVAQGGTFVFVSPGGKTELFYDPPSERGAVGKVSGEDLMTDGKTTSLTDYE
    GQVVVLNVWGQW
    CGPCRGEADDLEKVYENTKDMGVQFLGINVRDHTKDKAQDFVVNNKVGYPSIYDPEMRTLLTLGKNYP
    TSVIPTTIVLDREHRVAAVFLKELLVEDLQPVVERIAQEPQDQG

    >gi|312141083|ref|YP_004008419.1| cation transporter atpase p-type [Rhodococcus equi 103S]
    MTTTAPRTVELDVGGMTCASCAARIERKLGKLDGVTATVNYATEQAHVEYPDGMPLQDLIDVVEKTGYTAAVAAPEEPAE
    TDEGRDRLGARLTIAAAASVPVVVVSMIPSLQFDYWQWIAFALTTVVVFWCGYPFHRAAAVTARHGMATMDTLVSLGTLA
    AYGWSTWALVFGTAGRIGMTHAFTFRPGAHDPSGQIYLEVAAGVTTFLLAGRYAESRAKRRSGAALRALLEVGAKDVSVL
    RDGVEQRIPVSALRVGDEFVVRPGEKIATDGQVVRGRAAVDTSMLTGESVPVEVGEGDTVVGGTLDNDGLLTVRADRVGS
    DTRLAHIAKLVTEAQSGKAHAQRLADRVSAVFVPVVLTVAAATLTVWLLLGHQATEAFTAAVAVLIVACPCALGLATPTA
    LLVGTGRGAQMGILIKGPEVLEQTRRIETVVLDKTGTVTTGRMEFEDVIAARGEDRDRVLALAAAVESGSEHPVAQAIVR
    AVPAPLTVTGFVNRPGVGVEGVVDGHDVRVGRAQGAVPAEVQSRLPDGRTSVIVSWDGRVRGALVVADAVKPTSAEAIRE
    IRGLGMTPVLLTGDSEAVATAVAREVGIDRVIAEVLPDRKAATIARLREDGAVAMVGDGVNDAAALATADVGIAMGTGTD
    AAIEASDLTLVRGDLRSVPDAIRLSRRTLATIKGNLFWAFAYNVAAIPLAATGLLNPMIAGLAMALSSLFVVGNSLRLRR
    FR

    >gi|312141096|ref|YP_004008432.1| hypothetical protein REQ_37660 [Rhodococcus equi 103S]
    MDQSRHRITLLTRAGCGACQPAREVLDVVCRDFELELTCVDVDEAAAENPDLRAEYGDRLPVVLLDGKEHSYWDVDEDRL
    RADLSAG

    >gi|312141183|ref|YP_004008519.1| dihydrolipoamide dehydrogenase/branched-chain alpha-ketoacid dehydrogenase [Rhodococcus equi 103S]
    MTSHYDVVVLGAGPGGYVAAIRAAQLGLKTAIIEEKYWGGVCLNVGCIPSKALLRNAELAHIFHKEAKAFGMSGDVSFDF
    GAAFDRSRKVADGRVKGVHFLMKKNKIDEFDGRGTFVDAKTISVALSSGGTETVTFDNVIIATGSVTKLLPGTSLSDNVV
    TYEEQILTRDLPKSIVIVGAGAIGMEFGYVLSNYGVDVTIVEFLDRALPNEDEDVSKEIAKHYKKLGVKIKTGAAVQSIV
    DNGSDVTVSIKDNKSGEIETVTVDKVMQSVGFAPRVEGYGLENTGVALTDRGAIAIDERMRTNVDGIYAIGDVTAKLQLA
    HVAEAQGVVAAETIGGAETMELGDYRMMPRATFCQPQVASFGLTEAQAKAEGYDVKVATFPFTANGKAHGLNDPNGFVKL
    IADKKYGELLGGHLIGPDVSELLPELTLAQKWDLTVNELARNVHTHPTLSEALQEAIHGLAGHMINF

    >gi|312141560|ref|YP_004008896.1| osmotically inducible protein [Rhodococcus equi 103S]
    MTTASVSHLSAIVSATADAVADDAAKAHVVFRAKAQAHDAVASTVALGKYTVEVDEPPALGGDNAAPNPVEYYLASLLSC
    HVVTYRFWAERLGIRVDDIKARAEGDLDVRGFFGFDDDVRPGFGEVRVVVTVTGPETRERYLELHAAAEAHCPVLDLTRN
    PTPVVSVLETPETN

    >gi|312141763|ref|YP_004009099.1| methylated-DNA-[protein]-cysteine s-methyltransferase [Rhodococcus equi 103S]
    MSVIPTPSVDPSDLSRLHARLVTAADRDGLLDLAYRSVDTPVGRLLLVATDVGLVRVAYPREDHDVVLAILARQVSPRIL
    EAPGRLDAAARQLDEYFAHRRTRFDVPLDLRLSSGFRRTVLTRLPDIAYGRTASYAQVAEAAGSPRAVRAVGSACATNPL
    PLFVP
    CHRVVRSDGSMGQYAGGVDTKRALLTLEAA

    >gi|312141765|ref|YP_004009101.1| methylated-DNA-[protein]-cysteine s-methyltransferase [Rhodococcus equi 103S]
    MDAEHTVVDSPVGPLTLVRNPEGLCGLYMHLQRHLPDGARFGPRTDTGFDDVTSQLTEYFAGERTEFTVPLAPRGTEFQQ
    RVWAALRTIPYGETWSYLQLAEHLGNVAAIRAVAAANGRNPIGIIVP
    CHRVVGSNGALTGYAGGLGRKQFLLDLESPAAV
    GIQDGLF

    >gi|312141803|ref|YP_004009139.1| methylamine utilization protein maud [Rhodococcus equi 103S]
    MNTFLLIAVVVLAVAVAVLFLMVLALAREIGRVQVRLGPLGARMMDTGPKVEQVAPSFRGLTDHLGRTVGVGGHRDKPQL
    LLFTAPT
    CSTCKSLLPGLRAMAKAERDLEIVIVSDGTPEEHAQFLAGSGIGSELSYVDGRDVGIAYQVGTTPYGVILDEH
    GKIRSKGLCNHMAQVESLLNALESGTPSLQHLHEQAKTNLAAHV

    >gi|312141975|ref|YP_004009311.1| osmotically inducible protein [Rhodococcus equi 103S]
    MNIVYTAEALATGEGRNGRARTSDGRLDLELAIPTEMGGSGNGTNPEQLFAAGYAACFHSALQLVARQAGADVTDSAVGA
    RVGIGPNGSGGFGLAVTLEVSLPHLERGEALALTEKAHEV
    CPYSNATRGNIEVTLTVADDE

    >gi|312141996|ref|YP_004009332.1| hypothetical protein REQ_47140 [Rhodococcus equi 103S]
    MGIFRKSYGTVDVHRAQSLVEGGAVLLDVRSRPEWDTGHVPGATHLPLHEVVDHGIDVVAGRPVVVICRSGGRSANAARQ
    LSRLGAETYLVRGGFDAWRRAGLAITTPD

    >gi|312142016|ref|YP_004009352.1| thioredoxin reductase [Rhodococcus equi 103S]
    MTTPTTVRDLIIVGSGPAGYTAGVYAARAELEPLLFEGTQFGGSLMTTTEVENFPGFREGIMGPDLMDEMREQAKRFGAD
    IRTEDVEEIELDGPVKKVVANGETYYARAVILAMGAAARYLGIPGEERLLGRGVSA
    CATCDGFFFRDQDIVVVGGGDSAM
    EEATFLTKFARSVTLVHRREEFRASRIMLERAKANEKIRFVTNAEPVEVLGENSVTGLVIRDTVTGEQSTLDVTGMFVAI
    GHDPRSELVKGQVDVDDAGYVKVQSPTTATSAAGVFAAGDLVDHTYRQAITAAGTGCSAAIDAERWLADQGDITENTLAA
    AGEPVAVDA

    >gi|312142017|ref|YP_004009353.1| thioredoxin [Rhodococcus equi 103S]
    MANTITINDDSFKQDVLDAEKPVLVDFWATWCGPCKMVAPVLEEIAGEHGDKLTIAKLDIDQNPGAARDFQVMSIPTMIL
    FQGGKPVKTIVGAKGKAALLKDLADVL