Rhodobacter capsulatus SB 1003 uid47509

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|294675593|ref|YP_003576208.1| thioredoxin [Rhodobacter capsulatus SB 1003]
    MATVAVTDATFDAEVRQSDLPVVVDFWAEWCGPCKMIGPSLEDLSTELAGKVKIVKVNVDENPDSPAALGVRGIPALFLF
    KDGQVVSNKVGAAPKAALQAWIEASL

    >gi|294675755|ref|YP_003576370.1| glutaredoxin [Rhodobacter capsulatus SB 1003]
    MKRVEIYTTRTCPYCLAAKELLTTKGVAFEETDVGADPALRAAMRDRANGRHTVPQIFIGGVHVGGCDDIHALDAAGKLD
    PMLAE

    >gi|294675785|ref|YP_003576400.1| DSBA family oxidoreductase [Rhodobacter capsulatus SB 1003]
    MNRRSLLLGLAGGAVVAAAGGGYAVLRQAPAETLIATPAEAAPGGTILPDVALGRADAPVTLIEYASFTCSHCARFHETV
    FGALKRDYIDTGKVRFILREVYFDKFGLWAGQVAQCGGDLKYYGIAGMLFSEQKSWIGDGTEPVIAENLRKIGIKAGLTK
    DQIETCLNDTARAEAMVMTYQKNASADAIEGTPTLVINGEKHDNMGYAELKKILDAKLGG

    >gi|294676011|ref|YP_003576626.1| molybdenum cofactor biosynthesis protein B [Rhodobacter capsulatus SB 1003]
    MTGLILLTVIAALGWKLRAPAGLVWGMLALLWGAFVLVHGLFPGPGHPLPALIGGSLPGWIGLGVVAALVQAYRWALARL
    RARAVVPEAPAEGPFSKAELGRYSRHLLLREIGGTGQRRLKSARVLVVGAGGLGSPGLLYLSAAGVGTLGVIDHDTVSNS
    NLQRQVLYCDDDIGKPKVFAAAAALTALNPFITVKPYHRRLTEDIAADLIAGYDLVLDGCDDFETRQLVNRACVTAGKPL
    ISAAISQWEGQISLYHPASGGPCLACLFPKAPAPGLAPT
    CAEGGVMAALPGILGTMTAAEAIKEITGAGTSLRGKLQLID
    ALYGENRTIEVKRDPACPVCGG

    >gi|294676085|ref|YP_003576700.1| carboxymuconolactone decarboxylase family protein [Rhodobacter capsulatus SB 1003]
    MSYKTKIETMRGELRVMRKIIPEAMRGFGEMEKAITENGVMDKRQKEWIALAMGIAQRCEPCIGFHIGAMMRAGGTREEF
    ADICAVAIQMGGGPAMMYAAHALACWDELAAEQAGTPTTA

    >gi|294676104|ref|YP_003576719.1| glutaredoxin family protein [Rhodobacter capsulatus SB 1003]
    MTALDQIKADIAGNDVILYMKGTKEMPQCGFSSRVAGVLNYLGVTYKDVNVLADAEVRQGIKDYSDWPTIPQLYVKGDFV
    GGCDIVTEMMLSGELDKLFDDKGIAYDKGRADQIRAANA

    >gi|294676258|ref|YP_003576873.1| glutathione peroxidase [Rhodobacter capsulatus SB 1003]
    MKLKLMAAAVLTGFGAFAAPAARATEAAAPSFTFASIEGGVIDTAAYRGHPVLVVNTASLCGFTPQLEGLQALHKAWGPK
    GLIVLAVPSDDFKQELESGKEVSEFCTLTYGLTVPMTDITPVLGEGAHPFFKWLKETQGFVPRWNFNKVLLDGEGRVVAT
    WGSMTKPESSAIRAAFEPLLPGA

    >gi|294676283|ref|YP_003576898.1| dihydrolipoyl dehydrogenase [Rhodobacter capsulatus SB 1003]
    MAEFDVIIIGGGPGGYVCAIRCAQLGLKTACVEGRGALGGTCLNVGCIPSKALLHATHELHEVHENFEKMGLMGAKVKVD
    WAKMQSYKQDVIDGNTKGIEFLFKKNKVTYLRGWGSIPAPGQVKVGDEVHTAKNIVIATGSESSGLPGIEIDEQTVVTST
    GALSLAKVPKSMVVIGAGVIGLELGSVYARLGAEVTVVEYLDAITPGMDAEVAKGLQRILTRQGLKFVLGAAVQGVDKAK
    GKNTVRYTLRKDESAHAIEAEVVLVATGRKPFTKGLGLEALGVEMLPRGQVKADSHWATNVPGLYAIGDAIVGPMLAHKA
    EDEGMAVAEVIAGKHGHVNYDVIPGVIYTTPEVAAVGKTEDALKQEGRAYKVGKFSFMGNGRAKAVFQAEGFVKILADAA
    TDRILGAHIIGPSAGDMIHEICVAMEFGASAQDLALTCHAHPTYSEAVREAALACGDGAIHA

    >gi|294676713|ref|YP_003577328.1| cbb3-type cytochrome c oxidase biogenesis protein CcoI [Rhodobacter capsulatus SB 1003]
    MTAAPLASVAPPAGVTEDHLSASACPACLAAPSAEDLAKSGDIKGARIMLSLPTAHCAVCITDVEREMEAQPGVRSARVN
    LTLKRVSVDAEAGVSAETLVEALAKIGYEAYELDPGMLSATETDKRGRDLLMRIGVAGFAMMNIMLLSIAVWSGAEAATR
    DMFHWISAAIALPTVVFVGQPFFASAWGGLKHGRVNMDVPISLALILASSISIFETMHHGHHAYFDAAVMLSFFLLVGRY
    LDYRTRAVARSAAEELAALEVPRAHLLREGVETIVPVADLKPGDLIRVRPGGRIPADGEVTSGTSETDRSLLTGETLPVY
    VGPGTMLSAGEVNLTGPLTLRVTAAGKDSSLHRMADLVAMAESAKTRYTTLAERAARAYSPLVHALSFSAFGYWMWATGG
    DLRFAVNISAAVLIITCPCALGLAVPAVITAASGKLFRKGLLIKDGTALERLAEVDTVVFDKTGTLTMGAPVLEGLDTIE
    EETLSVAAALAQASSHPLARALVAAAEARDIRPVVLDDLREVPGFGIEGRLGALALRLGRADWVGAAPCDSTATHLRLGA
    AEPVTFRFSDHLRLGAAEAVALLTAQGKRVLMVSGDVETAVSALAGKLGITEWHSGALPAEKAALVADLMGQGRRVLMVG
    DGLNDTAALAAAHVSISPASALDAARTASDIVLLGADLAPVGDALRIAGQARRRIKENFVISAAYNVVAVPLALVGLATP
    LAAALAMSTSSITVSLNSMRLK

    >gi|294677088|ref|YP_003577703.1| peroxiredoxin [Rhodobacter capsulatus SB 1003]
    MIAIGEKAPDFTLPVTRTGAEPEELTLSALAPRKVVLYFYPKDDTPGCTTEALDFTRLGPDFDAAGAIVVGISKDSAKSH
    AKFCAKHALGVGLVSDEAGTVCDAYGTWVEKNMYGRTSMGIQRATFLIDATGTVAQVWPKVSVKGHAEAVLAAVQALG

    >gi|294677093|ref|YP_003577708.1| dihydrolipoyl dehydrogenase [Rhodobacter capsulatus SB 1003]
    MAAKSFDMIVIGAGPGGYVAAIRGAQLGLSVAVVEREHLGGICLNWGCIPTKALLRSAEVFHLMHRAKEFGLKAEGLGYD
    LDAVVARSRAVAKQLSGGIGHLLKKNKVTVLMGEATLPRPGVVAVKTGAGTEEITAKNIILATGARARVLPGLEADGDLV
    WTYKHALTPKRMPKKLLVIGSGAIGIEFASFFNTLGADTTVVEVMDRVLPVEDAEISAFAKKQFVKQGMKILEKTTVVKL
    DRSPGKVVAHLQDAKGTVTADFDTVISAVGIVGNVEGLGLEALGVKIDRTHVVVDEFCRTGVPGLYAIGDIAGAPWLAHK
    ASHEGVMVAELIAGKHAHPIKPGTIAGCTYCTPQVASVGLTEEKAKAAGHEVRVGRFPFIGNGKAIALGEPEGMVKTVFD
    AKTGELLGAHMVGAEVTELIQGYVIGRTLETTEEDLMHTVFPHPTLSEMMHEAVLDAYGRALHM

    >gi|294677094|ref|YP_003577709.1| rhodanese domain-containing protein [Rhodobacter capsulatus SB 1003]
    MFNFLRSAVSGGARVQKIDPREAVAKAAAGEITLIDVRDGMELRASGTAKGALHVPLATVKMKCDPSSPECLKELSVDKP
    VVLF
    CAMGGRSAGAAQMLVEMGYKEVYNLGGFNDWVSGGGAVVRV

    >gi|294677136|ref|YP_003577751.1| iron-sulfur cluster assembly accessory protein [Rhodobacter capsulatus SB 1003]
    MFALPGKPPVTLTPAAVAQIAELMAREGAAGFRIGVKKGGCAGMEYTMEIASEADPMDIVVEEGPARVLIAPLAQMFLLG
    TEIDYEETMLESGFKFRNPNVVESCGCGESVKFRDAPAG

    >gi|294677280|ref|YP_003577895.1| DSBA family oxidoreductase [Rhodobacter capsulatus SB 1003]
    MKHLSLAALTMAAVLGTPAAALDLSAMSAADKARFGEAVKAYLMENPEVLVEAINKLEERQQAAQADNDKVLVQTNADDI
    FHFAGDWVGGNPEGDVTMVEFIDYK
    CTYCKKAYEVVDEVLKKDGKIRFVVKEFPILSDQSVLAARFAVATRQVAGDAAYE
    KVHDALMAVRGDITLDSLQRLAEEQKIDAKAVLAQMNSEEVTSVLRANAQLAERMAIAGTPAFVVGGQLLRGYAPAEVMA
    QIVADERG

    >gi|294677326|ref|YP_003577941.1| thiol:disulfide interchange protein [Rhodobacter capsulatus SB 1003]
    MAKPLMFLPLLVMAGFVGAGYFAMQQNDPNAMPTALAGKEAPAVRLEPLGAEAPFTDADLRDGKIKLVNFWASWCAPCRV
    EHPNLIGLKQDGIEIMGVNWKDTPDQAQGFLAEMGSPYTRLGADPGNKMGLDWGVAGVPETFVVDGAGRILTRIAGPLTE
    DVITKKIDPLLAGTAD

    >gi|294677349|ref|YP_003577964.1| DSBA family oxidoreductase [Rhodobacter capsulatus SB 1003]
    MITLDIFADPTCPWCYLAKAQLDRALEARPGHPFLISWQPFQLNPTLPAEGMDRGAWLRARFGVQADRVDLPVLEAARTA
    GVALNLPIITRMPNTLNAHRLLHWAGIEGAQTAVMSGLLRAYWRDGQDIGQPDILVTIAADAGLDAVLIRRLLATDADAE
    TIRSRAAHARERGVTSVPTFILDNTHVITGAQPAKLWMQVIDEIAAT

    >gi|294677364|ref|YP_003577979.1| AhpC/TSA family protein [Rhodobacter capsulatus SB 1003]
    MGVSPPVCDFGWKAPDFRLPDTSGRFWSLDDIRGPKGLLIMFICNHCPYVQAILDRLQRDAEALMDLGIGVAAISSNDVG
    TYPQDGPEHMARLAAERGFRFPYLFDETQAVAKAYDAICTPDFFGFNAEDALQYRGRLDASGRQPGPADARRELYEAMVR
    VAETGQGPRDQIASLGCSIKWKD

    >gi|294677712|ref|YP_003578327.1| heavy metal translocating P-type ATPase [Rhodobacter capsulatus SB 1003]
    MAEVSKMESCEWQVGGMDCAACAGKVRSAVERLPGVEAVEIALMSERLRARLTPGATSPGELERTVTRLGYTITRIGAAP
    PLPLLKPRHDHGHDHGHDGHDHGGAPACGCGGCGCGAAAPAPAPAPEVTAEVTAAPLPPAAPWLRGPKAARLFWSAGGLA
    LAWGVALMLPALAAPAFALACLGALFPVARQALALARVGQPFSIEMLMTVAAIGALMIGAAAEAAMVVVLFALGELLESI
    AAARARDGLRALARQMPETALLERDGQTREVAAATLQPGQILRLRPGDRAPVDAEIVEGVSGLDESAVTGESVPVTRGPG
    DRVLAGSINTEALLRLRVTRAAADSTLARIARMVAEAEAAKAPVERFIDRFSRWYMPLIVGLAALVAVLPPLLTGADWGV
    WIYRALALLLIGCPCALVISVPAAMAAALSTGARRGLLVKGGAVIEALARLRLVALDKTGTLTPGRPLVTDLRPAAGVAV
    ADLLAHAAAVEAGSSHPLARAILARAAAEGVTAPAATAARVIPGVGAEAQIAGALWRIAAPAAGNPQAAALQAEAKTVVE
    LCRDGVPQGLIALRDEPRPEAGAALAALRALGLDSVMLTGDAEAPARALAAPLGLAVKAGLLPEDKCAEVTRLSAQGGVL
    MLGDGINDAPALRAADVGVAIGAGTDVAIETADAVLMRNDLTDLPALIRLSRQTLGNIRQNVAIALGLKAVFLVTSVFGI
    TGLWIAVLADTGATVLVTANALRLLRYDPRRAT

    >gi|294677769|ref|YP_003578384.1| rhodanese domain-containing protein [Rhodobacter capsulatus SB 1003]
    MTAVSAPLAPADALAQIRATARAAGLSYAGDVPPDLAQALAEAGQGLLIDIRSPEEIRFVGHVPGALHLPWASGLELTRN
    PRFLRGLETVAPREAVILLL
    CRSGQRSVQAAQAATAAGFTQVFNVLEGFEGDLDAAGHRGRVSGWRWRDLPWRQD

    >gi|294677847|ref|YP_003578462.1| HesB/YadR/YfhF family protein [Rhodobacter capsulatus SB 1003]
    MLLPPKVTPRAFARLAKLNAQEATPKALRVAVEGGGCSGFQYDLKLEAEAAPDDLVIEAEGQRVLIDPVSLPFLQDAVID
    YTQELIGARFVVQNPNATASCGCGISFSM

    >gi|294677920|ref|YP_003578535.1| glutathione-disulfide reductase [Rhodobacter capsulatus SB 1003]
    MSFDFDLFVIGGGSGGVRAARIAAGYGARVALAEEDRMGGTCVIRGCVPKKLMVFASTMPAAVAEARAYGWDAAIGGFDW
    GAFRAKLHAELDRLERIYRAGQQNAGVTVHDCRATVKGPHEVALADGRVISAKHILIAVGGRPFVPAFEGAEHVLTSNDL
    FHLPALPKRLLIVGGGYIASEFACVFNGLGVSVAQWNRSPLLRSFDTECRDLIVAQMKARGIDVHENVIIDRVTKTETGV
    VAHCGDGRSQEFDAVVYATGRVPNTAGLGLEAAGVKLAANGAVLVDAWSQTNVPSIFAVGDVTDRINLTPVAIREGHAFA
    DTVFGAKPRVSDHELVASAVFTRPEFGTCGQSEEAARKDGPIEVYTSAFKPMRSAFAGAEDRVLMKLIVCKATRKVLGCH
    IVAPEAGEMIQMAAIAMKMGATKEQFDATCAVHPTMAEELVTMRAPTRHS

    >gi|294677980|ref|YP_003578595.1| ArsC family protein [Rhodobacter capsulatus SB 1003]
    MIVYGIKTCGTVQKALAALTAAGKAPVLRDIRKAPLTEAEIAEFIAAFGEKLINRSSTTWRALPEAERAAPVATLLQAHP
    TLMKRPVIRGNGLTLGWDAAAQMAQL

    >gi|294677994|ref|YP_003578609.1| glutathione peroxidase [Rhodobacter capsulatus SB 1003]
    MSFRLNRRVFLAGGISLLADAAARADQAPAFRFDPIGGGEPIELARWRGHPVLVVNTASQCSFKAQLGDLQQFHEEWGPR
    GLRVLAVPSDDFGKEFDTAAETRAYCETVWGMTVPMSEPVLLLGEAAHPFYRWLRQTRGFVPNWNFNKVLLDGAGQVVTT
    WGAPVKPGSEEMKRIIAPLLPA

    >gi|294678011|ref|YP_003578626.1| methylated-DNA--[protein]-cysteine S-methyltransferase Ada [Rhodobacter capsulatus SB 1003]
    MSDPIPLEDRYHYRLIARAITEIDAAQAEARAAGRPVQIPLDALAARLGLSAAHFQRVFSAWAGVSPKRYTQYLSLTLAR
    ELLAQKLPLDQVAETAGLSAPSRLHDLILRWEAMTPGEFAAGGAGLVIRWGRFDSPFGPVLGFGTDRGLCGLAFTEEMGP
    EAAFADMVARWPGARLTEDPAPLAGWVAAAFGTGGEARLCVLGAPFQIKVWEALLAIPSGEVRSYSDIAARIGSPRAVRA
    VGTAVGRNPVAVLIP
    CHRVLRASGGLGGYHWGLGLKRALLAREAARHEAGHGARHEAGL

    >gi|294678039|ref|YP_003578654.1| thioredoxin [Rhodobacter capsulatus SB 1003]
    MMGAKMAESLRLTCLACGQANKVPSDRLAAGPKCGICGAGLITGKVAGIDPAILARAERDDLPLLVDFWAPWCGPCRQMA
    PQFQAAAATLAGQVRLAKIDTQAHPAVAGRHRIQGIPAFILFHKGRELARAAGARPASELVGFVRGKLGARA

    >gi|294678171|ref|YP_003578786.1| selenide, water dikinase [Rhodobacter capsulatus SB 1003]
    MTDTAPKTEPRLTSLSHGGGCGCKIAPGVLERILSDTVVPLVPKDLMVGIATADDAAVWRLNDGQALVATTDFFMPIVDD
    ARDFGRIAATNALSDVYAMGGRPILALAIVGMPIKVLSEATIGAILKGGAEVCAAAGIPVAGGHTIDSAEPIYGLVALGL
    VHPDRVKTNAGARPGDVLVLGKRIGVGILSGALKKGQLPPFAEAELIASVTQLNTPGADLGEIAAVHAMTDVTGFGLGGH
    GLEMARGSGCDIEICWAAVPRLPGVMEAAAEGHLTGASGRNWASYGAGIDLPADLGDLDRGILTDPQTSGGLLVACAPEA
    LGEVLATFRRHGFDHAAAVGRVLGESATPRLRIV

    >gi|294678335|ref|YP_003578950.1| thioredoxin-disulfide reductase [Rhodobacter capsulatus SB 1003]
    MSDTKHTKVLIIGSGPAGYTAAVYASRAMLKPILVQGMQPGGQLTITTEVENWPGRTEVQGPELMVQMEEHARAMGAEVI
    TDIITKLDLGTRPFVATGDSGTVYTADTVILATGAQARWLGLPSEQKFQGFGVSA
    CATCDGFFYRGKEVVVVGGGNAAVE
    EAMFLTNFASKVTVIHRRDSFRAEKILIERLKKNPKIEVIWNATVEEVLGTEAPLGVTGCRIRDVQTGAEREIPCHGFFV
    AIGHAPASELVKDQLELHHGGYVKVEPGTTRTGIPGVFAAGDLTDHTYRQAITSAGMGCMAALDAERWLAEQG

    >gi|294678691|ref|YP_003579306.1| thiol:disulfide interchange protein [Rhodobacter capsulatus SB 1003]
    MLRLFVLYTALALCANAAPAADLSALKQGEMKKLAVFTEPLALPEIPFVDETGTRHRLADYRGKVVLLNLWATWCAPCRK
    EMPDIAALQAEIGGDDFTVLTVASSNRDTQAKVGAFFEKQGITQLPRMIDETERLPRALGVPGLPASFLIDRQGQIVAQL
    LGPADWSSPEAKAVIAALRAE

    >gi|294678773|ref|YP_003579388.1| peptide-methionine-(S)-S-oxide reductase [Rhodobacter capsulatus SB 1003]
    MRRLVLALALALATPAFAEEFRVIPPPAVDAAALTGPETAIFAGGCFWGVQGVFQHLNGVISATSGYAGGTAATAHYDQV
    SGGETGHAEAVQVVFDPKQISYGDLLQVFFSVAHDPTQLNRQGPDVGPQYRSALFPVTEDQARIAKAYIDQLGRARAFDA
    AIVTQLDPGAAFYPAEAYHQNFLTLNPDHPYIVQVDMPKIAALERMFPQDWREVPVLLPVAD

    >gi|294678774|ref|YP_003579389.1| cytochrome c biogenesis protein transmembrane region [Rhodobacter capsulatus SB 1003]
    MTLALLAWLGGVLTILSPCILPVLPFVFARAGKPFLTNGLPMLAGMALAFAAVASLAAVGGGWAVAANGWGRGLALTLLA
    VFGLMLLFPALSERLTRPLVALGNRAAGRGEGVFGSAVLGVATGLLWAPCAGPILGLILTGAALNGASVATTGLLFAYAL
    GAATALAVALLAGGRVFALMKRSLGLGEGLRRGLGALVLAGVAAIALGLDTGLLTRLSTASTNRLEAALLTRFGPEGSTV
    MQAAPAMTGPAMTAPAMTGGPAMTGGPAMTGGPAMTGGPAMMAGPAMVAKGQPEALPVEGQMPDLTGAVQWLNSPPLTAA
    QLRGKVVLIDFWTYS
    CINCLRALPHVQAWDAAYRDKGLVVIGVHAPEFAFEKNPANVEKAVRDLGITYPVALDNDYALWR
    AFSNRYWPAHYFIDAKGQIRHHHFGEGGYAESEQVIRTLLAEAGASPDTTAQVQAAGVSAPADMRAVFSPETYLGHERAS
    GNLNAEGLIADQPHRYTAPDLRLNEWALAGDWTVGVEAAQLTAPSGSVTMRFHARDLHLVLAPGAAPVPFTVTIDGQPPG
    ADAGLDVDAAGRGIVTEDRLYQLYRAKGPVTDHLFEIRFDAPGVQAFAFTFG

    >gi|294678775|ref|YP_003579390.1| peptide-methionine (R)-S-oxide reductase [Rhodobacter capsulatus SB 1003]
    MNRRHLLLSVGLAAVGLAPHKAAAETFEVVHSDEEWRKLLSPEAYSVLRKEGTEYPYTSPLEQEHRKGTFACAGCGQALF
    ASETKFDSGTGWPSFYQPIRPEVVGTRIDGALMMTRTEVHCARCGGHLGHVFEDGPPPTGLRY
    CMNGVAMTFTPET

    >gi|294678788|ref|YP_003579403.1| HesB/YadR/YfhF family protein [Rhodobacter capsulatus SB 1003]
    MIEITQPAQEAIKAAIEGAGQPVAGLRLMVQAGGCAGLKYGMALELEAQPDDASLTFGEVTVLIDPLTREHIEGTKIDFV
    SNLEGAGFTFDNPNAKSACGCGKSFC

    >gi|294678797|ref|YP_003579412.1| peroxiredoxin [Rhodobacter capsulatus SB 1003]
    MKTNSKLPDVTFHTRVRDESVGGPNPYRWQDMTTADYFAGKRVILFSLPGAFTPTCSTYQLPGFEKGFPEFAAQGIDEIY
    CLSVNDSFVMNQWAKAQGLENVQVIPDGSGEFTRRMGMLVRKDNLGFGLRSWRYAAIVTNGVIEAWFEEPGLMDNCPEDP
    YGVSSPENVLAWLKTAKAA

    >gi|294678803|ref|YP_003579418.1| electron transport complex protein RnfA [Rhodobacter capsulatus SB 1003]
    MQDFLLVLLSTALVNNVVLVKFLGLCPFMGVSRKTDAAIGMGLATTFVITVASAACWLVEALILEPLDLKFLRILSMILV
    IAAIVQFIETVMRKVTPDLHKALGIYLPLITTN
    CAVLGLPLMYIQGHLSLAMSTLSGFGASVGFTLVLVIFAGMRERLAQ
    LSVPAAFAGTPIAFVSAGLLGLAFMGFAGLVHV

    >gi|294678808|ref|YP_003579423.1| electron transport complex protein RnfE [Rhodobacter capsulatus SB 1003]
    MSESYAKIARDGLWDKNIVTGQMLALCPTLAITGTATNGLGMGLATTVVLILSNVVISALRKTIAPEIRIPAFILIIAAI
    VTVVDLALNAWLHDLHKVLGLFIALIVTN
    CAILGRAEAFASRFGVLASALDGLMMGIGFTLALVVVGAIREILGSGTLFA
    QASLLLGPHFAFMELQIFPDYPGFLIMILPPGGFLVVGGLFALKRIIDARKPTIEQEIKQMRTERVFTAAGVLKPKLETG
    EEA

    >gi|294678850|ref|YP_003579465.1| thioredoxin [Rhodobacter capsulatus SB 1003]
    MFGTDTKPAQTFVKDVTETTFMAEVVDASMAVPVIVDFWAPWCGPCKTLGPQLEAAVNALKGRVVMAKINVDENQRLAQV
    LAQQGLPLQSIPTVVAFYQGRPVDMFQGAVPASQVKAFVEKLAGLAGDGGLGEALAAAEEMLAEGAAVDAAETFAAILGE
    EPENAEAYGGLVRSHLAAGNLDQAELILAGAPAKIATAAPVEAARAQLALAKQAAKAGPLDELKAKLAADPNDHQARFDH
    ATALHAAGQVEEAVEELLELFRRDREWNEGAAKTQLFTIFDSLKPADPIVVKGRRRLSSMIFA

    >gi|294678897|ref|YP_003579512.1| 3-mercaptopyruvate sulfurtransferase [Rhodobacter capsulatus SB 1003]
    MALDDPKTLVSTDWLEAHLRDPDLRVLDASWFLPSMERDAKAGYAAAHIPGARFFDIDEISDTRSELPHMAPPVEKFMSR
    MRAMGVGDGHQVVIYDQMGIFSAPRVWWLFRLMGKTDVAVLDGGLPKWLAEGRETEDMAPIPRDRHMTVQRQAHLIKDVT
    QVAHASKLGDHEIIDARPRGRFLGTDPEPRPGLRSGHIPGAKNVPWNSVLTETNTMKSPEDLRAVFTAAGVDLAKPAIAT
    CGSGISAAVLVLALERIGHRNHALYDGSWAEWGMFNDLRVATGEA

    >gi|294678929|ref|YP_003579544.1| peroxiredoxin [Rhodobacter capsulatus SB 1003]
    MTLTVGEKLPAATLLKIGANGPEAVDLAALTAGRKVVIFAVPGAYTGVCTTAHVPSFIRTKPQFGAKGVDEILCVSVNDP
    FVMAAWGEATGATAAGITLLADAEAAFTKAIGMAFSAPPVGLIDRSARYAMLVEDGVVKVLNREESPGVCELSAGEGLLA
    AL

    >gi|294678993|ref|YP_003579608.1| peptide-methionine (R)-S-oxide reductase [Rhodobacter capsulatus SB 1003]
    MDKKYRKTPEALARLTAEQFRVTQESGTERAFTGAFWNTTDPGLYVDVVSGEPLFSSRDKFESGCGWPSFTRPVVPAHVT
    EHRDVSHGMIRTEVRSMHGDSHLGHVFPDGPRDRGGLRY
    CINSASLRFIPKDRMEAEGYGDWLAELEG

    >gi|294678994|ref|YP_003579609.1| peptide-methionine-(S)-S-oxide reductase [Rhodobacter capsulatus SB 1003]
    MQKAILAGGCFWGMQDLIRKLPGVMSTRVGYSGGDVAQATYRNHGTHAEAIEIVFDPAQISFRRLLEFFFQIHDPTTPNR
    QGNDIGLSYRSAIFFLDAEQERIARDTIADVDASGLWPGKVVTEVAPAGPFWQAEPEHQDYLERIPNGYTCHRIRPNWVL
    PKRQE

    >gi|294679134|ref|YP_003579744.1| rhodanese domain-containing protein [Rhodobacter capsulatus SB 1003]
    MTQVDLPEARDACPTTAQKRLAEGALLVDVREADEVAACGFAGCAVMTIPLSQFEARFAEIPRDREVILACATGDRSLKA
    TYFLMYQGYAKVTNMKHGLARWVARGFPVTGSATAVSAGGCGCGSGTCC

    >gi|294679135|ref|YP_003579745.1| thioredoxin family protein [Rhodobacter capsulatus SB 1003]
    MEIKVLGTGCAKCKATADLIAQVAAEAGKPVEIVKIEEMRQIVGYGVMTTPAVVVGEKVVHKGAVPSRDQVLVWLQEEA