Rhizobium etli CIAT 652 uid59115

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|190889665|ref|YP_001976207.1| thioredoxin protein [Rhizobium etli CIAT 652]
    MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISVEMEGKVKVAKLNIDENPELAAQFGVRSIPTLAIF
    KGGEVADISVGAKPKTALSNWISNAA

    >gi|190889809|ref|YP_001976351.1| molydopterin synthase sulfurylase protein [Rhizobium etli CIAT 652]
    MRKAAFPGVGHHDSIAAMEPLSPDEIARYHRHILLPEIGGAGQQRLKAARVLVIGAGGLGAPILQYLAAAGVGTLGIVDD
    DRVSLSNLQRQVIHDSGTIGELKIESAALAIARLNPHVRLIRFEERFCAETAQRQLSGFDLLIDGSDNFDTRYAAADAAE
    AARIALVTGAVGRFDGSLTVLKPYETSEDGTANPRYRDLFPEAPPAGLVPS
    CAEAGIIGALTGVIGTMMAMEAIKLITGA
    GEPLIGRLLLYDALSARFDTIRYKRRRERQGQAV

    >gi|190889907|ref|YP_001976449.1| hypothetical protein RHECIAT_CH0000277 [Rhizobium etli CIAT 652]
    MTEKPRVSILYCTQCNWLLRSAWMAQELLHTFSDSLGEVALIPGTGGNFEIRVNGDLIWERKRDGGFPGPKELKQRVRDI
    VEPGRDLGHVDRASLES

    >gi|190889948|ref|YP_001976490.1| glutathione S-transferase protein [Rhizobium etli CIAT 652]
    MSKLTLISHHLCPYVQRAAIALFEKNVPFERITIDLANKPDWFLEISPLGKVPLLRIEQADGSETVLFESSVICEYLEET
    QAGAALHPADPLTRARHRGWMEFGSSVLSDLWGYETAEDRLQLDVKRAALIAKFTTIEGALADGPYFSGSSFSLVDAVFA
    PVFRYFDLFDTLGDSGIFDGLERVRRWRKALAERASAKSAVGEDYPQRLMQFLKTHNSILLRPSVAA

    >gi|190889951|ref|YP_001976493.1| probable arsenate reductase protein [Rhizobium etli CIAT 652]
    MAVTIYGIKNCDTMKKARSWLEEHEVAYQFHDYKALGIDRARLEAWIDQAGLDTVLNRAGTTFRKLPDAERENLTRERAI
    ALMREQPSMIKRPILEAGGKLLIGFKPEIYAGTFDG

    >gi|190889953|ref|YP_001976495.1| probable methylated-DNA-[protein]-cysteine S-methyltransferase protein [Rhizobium etli CIAT 652]
    MAQTIHHYCIFETAGGFCGIAWSDAGIARFQLPTKTAEATERLLLRRLPDGEAGVPTPDVLATVAAVKRYFQGEETDFSG
    VELDLAGQDGFFREIYAAARRVGWGHTTTYGALAKELGAGPEAAREVGQAMAKNPVALIIP
    CHRVLAAGGKIGGFSAPGG
    SSSKTRMLELEGVNLAPPPPAQQSLGF

    >gi|190890096|ref|YP_001976638.1| methylated-DNA-[protein]-cysteine S-methyltransferase protein [Rhizobium etli CIAT 652]
    MLFERPDDDTLYDALIARSADYEGQAYVCVKTTGVFCRLTCPARKPKRENTLFFETIAACMHSGFRPCRRCRPLEQPGRE
    PIVDALLARLEEEPEVRWSEDELVRRGHDPSTVRRAFKRALGMTFHDIVCYIRLGEAARQLAAGARVIDAQIEAGYESPS
    GFRTAFQRLVGKAPALSQNRELLFADWFDTPLGPMIAVADKTHLHLLEFHDRKALPAELKALQKRVRSSVAIRRTPVIDQ
    IEAEIRDYFEGRLGVFRTPLALGGTPFEKHVWAKLMEIPVGQTRAYGDLAREMERPEVVRAVGRANGANQLAIIVP
    CHRV
    LGADGSLTGYGGGLWRKQWLLRHEEKISTETKMEETA

    >gi|190890244|ref|YP_001976786.1| hypothetical protein RHECIAT_CH0000617 [Rhizobium etli CIAT 652]
    MQPRFNFAKAAPDAYKAVAALEQYVQSSGLERRFIHLIKLRASQINGCAYCVDMHVKEARHDGLSEQWINLMCVWRESPL
    YDARERALLGWVDAVTNIAKTGAPDADYETLKAHFSEEEMTKITVTIGAINVWNRLAVGFRSQHPIDAVTKAA

    >gi|190890321|ref|YP_001976863.1| putative stress-induced protein [Rhizobium etli CIAT 652]
    MADLKARPRPTGATAILGRTGFPHVTSTTKGEIDIVTAPSQPGFSPLDLLYASLSGCLVLSARIAASQMGVLDRISEITA
    DVTGEKATEGLSRVAKFNIVFSIKGDIDEETRSKIVHAAEDEI
    CTVSNTIRGNPEFSTTIAASG

    >gi|190890684|ref|YP_001977226.1| putative thioredoxin protein [Rhizobium etli CIAT 652]
    MTIAIGDKLPAATFKEKTADGPVEISTEQLFAGKRVVLFAVPGAFTPTCSLNHLPGYLENRDTILGRGVDDIAVLAVNDW
    HVMGAWAQSSGGMGKIHFLADWDAGFTKAVGLDADLSAGGLGLRSKRYSMLVEDGVVKALNVEESPGQATVSGAAAMLEL
    L

    >gi|190890714|ref|YP_001977256.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli CIAT 652]
    MQMSEMQLTKRRLLGGIAIAAAAAALAACNDSKDAADASSSGKTMADGTNVDTIQTAATSSTDMPQSDGDVDMAEVLKPG
    ALPEMALGKADAPVKIVEYMSMT
    CPHCAHFHNTTFDAIKQKYVDSGKVQFIIREFPFDPRAAAAFMLARCSASNPEQLST
    PEQYFPMVSMLFKQQQVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNATPTFLINGKR
    YSGDMPVDTMSKLIDSLI

    >gi|190890878|ref|YP_001977420.1| probable organic hydroperoxide resistance (osmotically inducible) protein [Rhizobium etli CIAT 652]
    MPILYTTQASATGGRAGRAVSENGVLDVTLTVPKELGGDGATGTNPEQLFAAGYSACFLGALKFVAGQQKVKIPEETTVS
    AKVGIGPREDGTGFGIEVALTVNIPGLDRETAEKLAAAAHIV
    CPYSHAMRTSTEVPVTVA

    >gi|190890927|ref|YP_001977469.1| hypothetical protein RHECIAT_CH0001310 [Rhizobium etli CIAT 652]
    MTSALEKNRPSAAFAFDNSYAGLPQRFFAAQMPTQVAEPWLIKLNEPLAAELGLDVEALRRDGAAIFSGNLVPEGAQPLA
    MAYAGHQFGGFSPQLGDGRAILLGEVIDRSGRRFDIQLKGAGPTPFSRRGDGRAAIGPVLREYIISEAMFALGIPATRAL
    AAVTTGEPVYREEVLPGAVFTRVATSHIRVGTFQYFAARGDTDGVRALTNYVIDRHYPALKEADNPYLALFEAVSERQAA
    LIARWLHVGFIHGVMNTDNMTVSGETIDFGPCAFMDAYDPATVFSSIDQHGRYAYANQPGIGQWNLARLGETLLPLIDDE
    PDAAVDKANAVIRAYGERFQTHWLAGMREKIGLAREEDGDLELVQTLLSLMQAQGADFTLTFRRLSDLAGDEAAEPDFAA
    SFREAEASRNWLSRWRERLSRDPQTAGARAAAMRKVNPAFIPRNHRVEQAIEAAVENGDFSLFEALLTVLARPYDDQPDF
    APYREPPKPHERVLATF
    CGT

    >gi|190890953|ref|YP_001977495.1| peptide-methionine (R)-S-oxide reductase protein [Rhizobium etli CIAT 652]
    MSETATTAKIEKTDAEWKEQLTPEQYRITRQHGTERAFTGPYWDSFETGLYRCVGCNAPLFRSDTKFDAGCGWPSYFEAV
    SPDAVTEHRDTTYGMVRTEIRCGTCDAHLGHVFPDGPPPTGLRY
    CINGHAMVFEPGE

    >gi|190891282|ref|YP_001977824.1| glutathione peroxidase protein [Rhizobium etli CIAT 652]
    MKLEVPVTGNVLDIPVKTVDGRETALNEYKGRVLLIVNVASKCGLTPQYEGLEKLYGEKRERGFVVAAFPANDFKGQEPG
    TDAEILDFCTSTYDVTFPIFSKISVKGEAQHPLYRQLTKSGVKTTGDGPMRERLKSHGIAAGDEDDILWNFEKFLIGRDG
    KVAARFAPDVTADDSRLVSAVDKELAKG

    >gi|190891397|ref|YP_001977939.1| hypothetical protein RHECIAT_CH0001791 [Rhizobium etli CIAT 652]
    MAFIHTPNASASEKTTSMYASAEANYGYLPNMYRAFGHRPEVMECWAALLSSIRGHMSLRRYELVTLAAAKELKSSYCML
    AHGSVLLREGFTSDGLTAVVNETEKAPIEAGERAIMAFAAKVARDATSVTQQDIDGLKKHGLSDAEIFDVTAAAAARCFF
    SKMLDALGAAPDHAYIERLEPNVRKALSVGREVERPLAPSPSRGTSQ

    >gi|190891466|ref|YP_001978008.1| thiosulfate sulfurtransferase protein [Rhizobium etli CIAT 652]
    MTESKSRFVVSADWLQGELGKPDLRVLDASFYLPAQKRDADAEYAAGHIPGAIRFDQDKIADHSTSLPHTIPSPEYFATE
    VGRLGISENNRIVVYDGIGLFASPRVWWLFRVMGAKNVFVLDGGLDGWKAEGRPLETTTPAYMPTTFKPNFDASRVVTLD
    AMRDIVSSGAMQIADARSAGRFAATEPEPRAGMRSGHMPGARSLPSGVFASQGRFKSLPELRQTIEDAGIDLSKPVVTS
    C
    GSGITAAIITLALESLGHHDNKLYDGSWSEWGSRDDTPVVTGPPMPVKA

    >gi|190891484|ref|YP_001978026.1| putative peroxidase protein [Rhizobium etli CIAT 652]
    MSLRINDIAPDFTADTTQGPISFHEWIGNGWAVLFSHPKNFTPVCTTELGAMAGLAGEFSKRGAKIIGISVDPVESHAKW
    KGDIKTATGFDVEYPLIGDKDLKVAKLYDMLPAGAGESSEGRTPADNATVRSVFIIGPDKKIKLILTYPMTTGRNFNEIL
    RAIDSIQLTAKHQVATPANWNQGEDVIITAAVSNEDAITRFGSFDTVLPYLRKTKQPSA

    >gi|190891505|ref|YP_001978047.1| hypothetical protein RHECIAT_CH0001902 [Rhizobium etli CIAT 652]
    MTDTSVTLSDAAAKRIAAIIGAEAGKSALRVSVEGGGCSGFSYKFDLADSAADDDIIVEKNDAKVLIDSLSLVYMAGSEI
    DFVDNLLGQSFQIKNPNAVASCGCGTSFSI

    >gi|190891560|ref|YP_001978102.1| probable outer membrane protein [Rhizobium etli CIAT 652]
    MLDVQEALQKKQEAQRLVKANMAIQENTTDIFDSKNDVALGNPKGDVTVVEFFDYNCSYCRHALPDMQAMLKKDKNVRFV
    LKEFPILGPDSVAAHKVADAFRKLAPEKYADFHVALLGSEGRASDESAIAVAASLGVSEDKIRAEMAKSPNDGIVQATYQ
    LASSLGISGTPSYVIGNELVPGAVGLDDLEAKVKNMRSCGKTAC

    >gi|190891632|ref|YP_001978174.1| dihydrolipoamide dehydrogenase protein [Rhizobium etli CIAT 652]
    MAESYDVIIIGSGPGGYVAAIRASQLGLKTAIVEREHMGGICLNWGCIPTKALLRSAEVLDHANHFKDFGLVLEGSVKPD
    AKAVVGRSRAVSARLNAGVGFLMKKNKIDIIWGEAKLTKASTGAQPGEIVVGKSSKPVVEPQHPLPKNVKGEGTYTAKHI
    IIATGARPRALPGIEPDGKLIWTYFEALKPDALPKSLIVMGSGAIGIEFASFYRSMGVDVTVVEVMPTIMPVEDAEITAI
    ARKQLEKRGLKIFTSAKVTKVEKGAGSITAHVETSDGKVQQITADRMISAVGVQGNIENLGLEALGIKTDRGCVVADGYG
    KTNVAGIYAIGDVAGPPMLAHKAEHEGVVCVEKIAGLPNVHPTDKGKVPGCTYCNPQVASVGLTEAKAKELGRDIRVGRF
    SFAANGKAIALGEDQGMVKVIFDKKTGELLGAHMVGAEVTELIQGFVVAMNLETTEEELMHTIFPHPTVSETMKEAVLDA
    YGRVLNA

    >gi|190891743|ref|YP_001978285.1| putative dithiol-disulfide isomerase protein (involved in polyketide biosynthesis) [Rhizobium etli CIAT 652]
    MERITIDVVSDVVCPWCYLGKARLELAIAEVQDEIGVDTNWRPYRLNPDYPKEGVDQKKALAEKLGGEERVAQAHKMLTD
    LGREVGIAFNFEAIKIGPNTLDAHRLIHWAMIEGREAQDKIVAALFTANFEEGRNVGDHAVLLDIAEKAGLDRSVIASLL
    ASDADRDLIVAEIKAAQEMGVNGVPFFIFDQQYAVSGAQTPDVLAGALRDIAKAKAEARSGLN

    >gi|190891788|ref|YP_001978330.1| putative peroxiredoxin protein [Rhizobium etli CIAT 652]
    MQENHADRPLQPGDRAPNVVLDAITRQGKIAIDDFRGQKPLLVGLFRGLHCPFCRRQIAAMAELTEALQEKGIDSLTVVN
    TPIERARLYFRYHPLPNLLAASDPERVSHRAFGLPSLQFTETENEWPHTVSMDKVMSMRVDMPGELPEPMNPIAAMDFLD
    KADGYEVTADDKRMIATGEGQLVGEFLLDRDGVVRWCFTEVEEAGRHLFGVPAPREVMSAAANMAV

    >gi|190891807|ref|YP_001978349.1| putative oxidoreductase protein [Rhizobium etli CIAT 652]
    MDFLRSASLAFGLIATLTTSVLAHSLDEVDQDLRNTEKYFQPADSPAPAFTLQDSGGRVVSLADLRGKVVVLNFIYTSCP
    DV
    CPLHTERIAQIQTMVNQTPMKAMVAFVTITTDPKRDTPQVLSDYGSAHGVDTVNWTLLTAGSEQPEDSTRRIAEAYGL
    KFVAEDDGMQMHGIVTHVIDQDGRLRARFHGLKFEPVNMVTFINALTNRSQKPHLHGEPSFWDSVEGLFK

    >gi|190891808|ref|YP_001978350.1| putative thioredoxin protein [Rhizobium etli CIAT 652]
    MKWLVMTALVSVLASSAATERPKNFVLRDALEPIPALQFTDEAGGPQTLDGFRGKVVLLNVWATWCLPCRKEMPTLDRLQ
    VALGGPDFEVVALSIDRGGPEAVKKFYAEIGVQHLAIHIDATSQAGFALASFGLPTTLLVDRQGQELGRLVGPAEWDAPD
    MIAFIRSFITQKRGGIALRPQKE

    >gi|190891946|ref|YP_001978488.1| hypothetical protein RHECIAT_CH0002356 [Rhizobium etli CIAT 652]
    MGFAVMSMTDGAAARVKAIVENAGPEAKGVRVGIKKGGCAGMEYTIDLVTEPNAKDDLIERDGARVWVEPSAVLYLLGTE
    MGFEQTTLRSGFTFTNPNQTSACGCGESVELKPADLAALAAQRQSEPAHS

    >gi|190891962|ref|YP_001978504.1| bacterioferritin comigratory protein [Rhizobium etli CIAT 652]
    MSSTNPAKERFSQWRFPGIGALAPDFNLPRDGGGRVSLSDFHGKPLVLFFYPKDDTTGCTAESLAFTALAPEFEAAGAAV
    IGMSPDSAACHDKFIRKHRLSVALASDEEKTTLQAYGVWKEKSMYGRNFMGVERTTFLIRHDGTIATIWQKVKVQGHAET
    VLEAVRNLAA

    >gi|190891990|ref|YP_001978532.1| glutaredoxin protein [Rhizobium etli CIAT 652]
    MSGIHEFIDNEIKNNDVVLFMKGTPQFPQCGFSGQVVQILDYIGVDYKGINVLADSEIRQGIKDYSNWPTIPQLYVKGEF
    IGGCDIVREMFQAGELQQHLQENGVTVRGAA

    >gi|190892055|ref|YP_001978597.1| glutathione reductase protein [Rhizobium etli CIAT 652]
    MSSYDYDLFVIGGGSGGVRAARVAASLGKRVAIAEEYRYGGTCVIRGCVPKKLFVYASQFHEHFEDAEGFGWTVGESSFD
    WKKLVAAKDAEIARLEGLYKKGLAGANAEILESRAELVDAHTVRLAKTGQTVTAKTVVIATGGRPNPHAALPGHEF
    CISS
    NEAFHLEELPKSIVIAGGGYIAVEFANIFHGLGVETTLIYRGAEILSRFDEDLRRGLHEAMVAKGIRILCHDTLQKVSEG
    EDGLILETMNNGTLRAGVVLLALGRDPNTEGLGLEAAGVAVDERGAIIVDDYSRTNVENIYALGDVTNRVQLTPVAIHEA
    MCFIETEYKNNPTRPDYELIPTAVFSQPEIGTVGLSEEEAGKRYGELEVYRAQFRPLKATLSGRAERMIMKLIVDAASRR
    VVGAHILGHDAGEMAQLLGITLKAGCTKDDFDRTMALHPTAAEELVTMYAPSYRIRDGKRV

    >gi|190892098|ref|YP_001978640.1| probable stress-induced OsmC-like protein [Rhizobium etli CIAT 652]
    MTKIDKVLYTGKTRTTGGRDGSSQSDDGQLDIKLSSPGSARPGTNPEQLFAAGWSACFIGAMGIAAGKLKIRLPAETAVN
    AEVDLGTTDGDYFLQARLKVGLPGIETDVAKALVDEAHRT
    CPYSKATRGNIHVQLIVA

    >gi|190892102|ref|YP_001978644.1| putative cytochrome c biogenesis protein [Rhizobium etli CIAT 652]
    MYRSVSPAPHCNSTVHFPENRTHRRYVSPALSPPLLVRAHRRPEPDQSVSKETMMTLLIIAYLGGVLTILSPCILPILPF
    VFARAGQPFIRSTLPMLAGMAATFALVATLAAVGGSWAIRANEYGRLAAIVMLALFGASLLSPRFASTLARPIVDLGNNL
    VNANSAGRAAPTVRSALILGVATGLLWAPCAGPILGLVLTGAALQGANLQTTFLLIAYAGGAATSLAVALLLGGKIFAAM
    KRSLGFGDRIRQLLGAAVLAGVAVIALGLDTSLLARLSYASTASLEQAVLDRLHAKPLGGAPSELASSDATIVAADAKKP
    FRSDLPMEGYAPSLDGAVEWLNSKPLTTEQLRGKVVLVDFWTYS
    CINCIRTIPYVRAWAEKYADQGLVVIGVHAPEFAFE
    KKIDNVRKALSDFQIRYPVAIDNDYKIWRAFENSYWPAAYLIDAKGQIRYHHFGEGNYGRTEKAIQDLLQEAGSQMTAAA
    PVAPDAKGVEAAPDLGNIRSGETYLGYGQAENFESPEGLQADKSETYSIAAPGLNAWGLAGTWTVGKDQATLDQPGGAIA
    YRFSARDLHLVLGPGASATPIRFQVTIDGKPPGPDHGSDIDADGNGTVTATRLYQLVRQSGTVAARTFEVRFLDPGVQAY
    AFTFG

    >gi|190892200|ref|YP_001978742.1| hypothetical protein RHECIAT_CH0002612 [Rhizobium etli CIAT 652]
    MGDQKRPLQPGDSAPAFALATANFNGTVSLADLSGRPFLIGFFRGLHCPFCRRQVEQLASVQPTLRAAGVETVAVINTPV
    ERARLYFRHRPTPVTLLCDPDCHTHRAYGVPHGEFLPDGSSEQPKWPYGAAMAQFQAARINPTGELPEPLHPMEANTILN
    AKDRFELDETDNAIFENHATQLVGHFLVDANGTIGWVQIEALDGPNNLCIFPTAAEIIAAAGSLGR

    >gi|190892211|ref|YP_001978753.1| arsenate reductase protein [Rhizobium etli CIAT 652]
    MNVIIYHNPACGTSRNTLAMIRNAGIEPTVIEYVNTPPSRTELMKMIADAGLTVRQALREKDTPYVELGLGNPDLSDDQL
    LDAMLAQPILINRPFVITPLGTRLSRPSELVLEILPETHKRAFTKEDGEKVLDAEGKRIG

    >gi|190892239|ref|YP_001978781.1| organic hydroperoxide resistance protein [Rhizobium etli CIAT 652]
    MTEKLLFTGKTHIAGGGNGYARSSDGTLDIKLPQPHPAAENLFGAAWSACYIGAIELAAAQRKITLPAGPEVDAEITLNG
    DNGSYFLRARLNVNIADIDREIAQELIEAAHGI
    CPYSKVVHGNIDVETKLI

    >gi|190892501|ref|YP_001979043.1| putative carboxymuconolactone decarboxylase protein [Rhizobium etli CIAT 652]
    MTQRLNYAQQSPELFKKFMEFSMALKSSVIDEKLQALIEIRASQINGCGFCLDMHVKQAKIFGESELRLHHVAIWRESNL
    FVPRERAALAWTEALTKLPEGGISDEIYERIRGQLSEREISDLTFVVMAINAWNRVNVGFKTVPGSADKAYGLDKAGLN

    >gi|190892726|ref|YP_001979268.1| thioredoxin reductase (NADPH) protein [Rhizobium etli CIAT 652]
    MPARHTKVLIIGSGPAGYTAAVYAARAMLKPVLIAGLEQGGQLMITTDVENYPGFADPIQGPWLMEQMLQQAKHVGAEIV
    SDLVTEVDMNQRPFVARTDSGQVWTADTLIIATGAKAKWLGIESEQHFQGFGVSA
    CATCDGFFYRNKDVIVVGGGNSAVE
    EALYLSNIAKSVTLVHRRDTFRAEKILQERLFARENVKVLWNTEVAEITGTAAKPPMPQSVSGARLRDVRTGAITEMPID
    GVFVAIGHAPATELFKDKLKLKDNGYLWTAPDSTATSLEGVYAAGDVTDDTFRQAVTAAGMGCMAALEAERYLTGHMPVA
    VAAE

    >gi|190892988|ref|YP_001979530.1| hypothetical protein RHECIAT_CH0003405 [Rhizobium etli CIAT 652]
    MSEVVHRFTTLVPRWQPYVVPVDLATATQEQREAMQVTPSNKGISTYVLTLAHDPESLAVRSPLFNLIMYGKDGLSPGER
    ELGATAASVVNHCVY
    CAAVHASRFISHTKREDVINTIFTDGLDAELDEHLQSIFDFSAHLSTTPPQATQADAQALADVGL
    SELESLDLVLSSAIFGWANRLMHTLGEPIKD

    >gi|190893109|ref|YP_001979651.1| putative rhodanese-related sulfurtransferase protein [Rhizobium etli CIAT 652]
    MPGPVSEIPAAAPDLAAAHYAAKLAFETDCSDVHAAFAGAKVDFVLLDVRSPALFAQSHVPGAINLPHGKMTAHRMSEWA
    RDTLFVVY
    CAGPHCNGADKAALRLARLGLRAKLMIGGMTGWADEGFGFESEAVAAE

    >gi|190893482|ref|YP_001980024.1| probable rhodanese-related sulfurtransferase protein [Rhizobium etli CIAT 652]
    MRPFRKAIAPLADFLYFPAMTDSLTHTGPFLVAALYHFVSVPRFASLQAPLQALCEENGVKGTLLLAHEGINGTIAGPDA
    GIGAVLAFLRAQPEFAGLEHKESRASKMPFLRLKVKLKKEIVTMGVEDIDPNKVVGTYVAPQDWNALISDPDTIVIDTRN
    DYETAIGTFRGALDPKTKTFREFPNWVRSNTGLHNKPKIAMYCTGGIRCEKATAFMKAEGFDEVYHLKGGILKYLEDVPQ
    EESLWDGACFVFDERVSVEHGLKEGEHRLCHACRNPITSEEITSPLYEEGVSCSHCYHTRSEEDRLRYRQRQHQIALARK
    RGQRHIGS

    >gi|190893516|ref|YP_001980058.1| probable 6-O-methylguanine-DNA methyltransferase (DNA repair) protein [Rhizobium etli CIAT 652]
    MDMIANLQTDITPDGPDYDIVRRVIELITEDYRDQPSLEAIATRLNQSPTQLQKTFTRWAGLSPKGFLQAVTLDHAKRLL
    RNEDMPLLETSIEVGLSGPSRLHDLFVTHEAMSPGEWKARGGGLTIRYGFHICPFGVALIMVTDRGLAGLAFSDSGDERA
    CLEDMTCRWPNACYIEDLQATVPYAARIFEPGKWSSDQPLRVVLIGTDFQVRVWESLLKIPFGKAVTYSDIANDIGRPTA
    QRAVGAAVGANPISFVVP
    CHRALGKNGALTGYHWGLTRKRAMLGWESAHA

    >gi|190893537|ref|YP_001980079.1| osmotically inducible protein [Rhizobium etli CIAT 652]
    MQINRTASAHWSGGLKDGKGLISTQSGALKDYPYGFASRFEGIPGTNPEELIGAAHAGCFTMALSLILGEAGFTAEHMET
    SAKVTLESVEGGFAVTAIHLSLSGRIPGADEATFTELANKAKAG
    CPISKALAAVPITLDVKLA

    >gi|190893564|ref|YP_001980106.1| glutaredoxin protein [Rhizobium etli CIAT 652]
    MSVTVYSKPACVQCTATYRALDRLGVDYDIVDISQDAEALDRVRSLGYMQAPVVIAGERHWAGFRPDMISALS

    >gi|190893565|ref|YP_001980107.1| probable heavy metal-transporting ATPase protein [Rhizobium etli CIAT 652]
    MAETNEARYRVGGMDCAACASKIDTAVRRVAGVADVSVSVMAGTMIVRHDGSSDLKAIEKKVTGLGYSVSPFAGSMVPTH
    EHGSHDHHDHDHDHAGHDHDHEGHDHDHAHGKAEIEGLHGHDHGPMTGPWWQSRKGRFTILSGAALIAAYAVGHLVPTIA
    PYTFIVAMLVGLVPIARRAVMAARSGTPFSIEMLMTIAAVGAVIINAGEEAATVVFLFLVGELLEGVAAGKARESIQSLT
    ALVPKNALLEDNGQTREVPAESLAVGAIIMVRPGDRISADGIIVSGESAIDEAPVTGESTPVRKGVDAAVFAGTVNGDAV
    LRVRVTAAAADNTIARIVKLVEEAQELKAPTERFIDRFSRYYTPGVVMVAALVAVVPPMFLSGAWGEWIYKGLAILLIGC
    PCALVISTPAAIAASLSSGARRGLLMKGGAVLEALGKVTMVAFDKTGTLTEGKPKVTDIVAFGMSEAQVLSRAAVLEQGS
    SHPLALAILNRARADGVPVPPAFELEALPGKGVRGKVGGETLDLLSPSAARERGALDGERDAGIMALNDEGKSVSVLLVN
    NVAAGLVAMRDEPREDAKVGLSTLRSAGVKAMMLTGDNKRTAAAVAGMLGIDWRGEMMPEDKQRVVVELKRQGFVVAKVG
    DGINDAPALAAAHIGIAMGGGTDVALETADAAVLHGRVGDVARMIELSKRTMRNILQNITIALGLKGVFLVTTIAGITGL
    WPAILADTGATVLVTINALRLLRLKGQ

    >gi|190893568|ref|YP_001980110.1| peptide-methionine (R)-S-oxide reductase protein [Rhizobium etli CIAT 652]
    MLNRRLLLMTTVFGALAVRASLAGKAIAGETFAVTHTDEEWHKLLTPDQFVILRQAGTENPFSSPLLHEERKGTFACVGC
    EQKLFSSATKFDSGTGWPSFWAPLDHAVGTTHDASFGMARTAVHCSRCGGHLGHVFDDGPKPTGLRY
    CMNGLVMTFRAAS
    A

    >gi|190893597|ref|YP_001980139.1| glutaredoxin protein [Rhizobium etli CIAT 652]
    MVPVTIYTRQFCGYCSRAKSLLEEKGVDYVEHDATYSPDLRQEMIGKSNGRTTFPQIFIGAEHVGGCDDLFALDRAGKLD
    PMLAA

    >gi|190893631|ref|YP_001980173.1| thiol:disulfide interchange protein [Rhizobium etli CIAT 652]
    MTTKKPFGLPSVKLIAIAAVAGVVAGAAAVYVKETGIGNGIGNTASAECPLARERAANLTPLMKGQVAAMVAANEPRKLA
    GVSFNGPDGKPLTLDHFAGKTVLFNLWATW
    CVPCREEMPALNALEKQMGSDKFQVVPVNIDTGDDEKPKAFLAETGVDAL
    QLYRDNTIGVFNSLKKEGLAFGLPVTLLLDEKGCLISAMNGPAAWDSEDAKTLIKGAIGS

    >gi|190893729|ref|YP_001980271.1| dihydrolipoamide dehydrogenase protein [Rhizobium etli CIAT 652]
    MSYDVIVIGTGPGGYVCAVKAAQLGLKVAVVEKRATYGGTCLNVGCIPSKALLHASEMFHQAGHGMSALGIDIPAPTLNL
    GNMMAHKDATVKANVDGVAFLFKKNKIDAFQGTGKIVSAGKVAVTTEDGQVQEIEGKNIVIATGSDVAGIPGVQVEIDER
    TIISSTGGIALDKVPETLIVVGGGVIGLELGSVWSRLGAKVTVVEYLDTILGGMDGEVSKQFQRMLAKQGIDFHLGAKVT
    GVEKGDKGAKVTFEPVKGGDKVVLDAEVVLIATGRKPYTAGLGLEEAGVALDNRGRVEIDGHFKTNVAGIYAFGDVVKGP
    MLAHKAEDEGVALAEILAGQHGHVNYDVIPSVVYTQPEIASVGKTEEELKAAGIAYKVGKFPFTANGRARAMLATDGFVK
    ILADKDTDRVLGGHIVGFGAGEMIHEIAVLMEFGGSSEDLGRSCHAHPTMSEAVKEAALATFFKPIHM

    >gi|190893797|ref|YP_001980339.1| thiol disulfide interchange protein (involved in cytochrome c biogenesis) [Rhizobium etli CIAT 652]
    MSETPETKPGKPSGLSRYALALLPLFVFGAIAATAAKMLYDQDFHGKNIAEIPSALIGTKAPALNLPPLDGANLPALTDA
    AITGKLTLVNVFASW
    CIPCRDEHPILKELAKDARLNVVAINYKDKNDNALRFLGELGNPYRAIGVDPNGKAAIDWGVYGI
    PESYLVAPDGTILYKRVGPFDDISLKEGLFPAMEKALAKPAS

    >gi|190893827|ref|YP_001980369.1| thioredoxin protein [Rhizobium etli CIAT 652]
    MSGSNNPYNGSFGNQMSATASFGAQGASAAAAGSYITDTTTANFGKDVIEESRKQPVLVDFWAPWCGPCKQLTPVLEKVV
    NEAKGRVRLVKMNIDDHPSIAGQLGIQSIPAVIAFVNGRPADGFMGAVPESQITQFIDRIAGPAGADEAAEIEAALTEAS
    ELLAAGNLNEAAQLYGAVMQADPENAKALAGMAECMIAANQHQRARETLTDLPEELARDAGIQAVLKKLDQIEEARKLGD
    PVALERELAADPDNHEARLKLAKILNVEGRRDEAAEHLLQIMRKDRSFDDDGARRQLLQFFEVWGFKDPATVAARRKLSA
    MLFS

    >gi|190894226|ref|YP_001984520.1| putative hydroperoxide reductase protein [Rhizobium etli CIAT 652]
    MTMEKQVPIVTFRTRVRDESISGPNPYRWEDKTTDDYFSGKRVILFSLPGAFTPICSTFQLPDFESLYVEFKKNGIDDIY
    CLSVNDAFVMNAWGKSQGLKNVKLIPDGSGEFTRKMGMLVAKDNLGFGLRSWRYAAVINNGVVEGWFEEEGFGDNCATDP
    YGVSSPQNILKCLKAPAFV

    >gi|190894229|ref|YP_001984523.1| Fe-S cofactor nitrogenase synthesis protein [Rhizobium etli CIAT 652]
    MIKLTENAAAIMNVTLSRAEQAEGFRIAVEAGGCAGYKYLVGLESVQGEGDAVIETNGVKVFVDADSQAHINGMTIDFVT
    GPETSGFVFDNPNAHQNCTCGKSFG

    >gi|190894285|ref|YP_001984579.1| cation transport ATPase protein [Rhizobium etli CIAT 652]
    MTCCSMDAESVLGLSATSASAEEVCLASHPLGAGLRQIDLSVPDVHCGGCILTLEKALSALAFVRKARVNLTARRVTCVY
    QEEIEAKATDPSEILAAITLAGYRAHLITSTAPETDRIRNQLLLAIGVSGFAAANIMMLSVSVWSGADAATRDMFHWISA
    MIAAPALIYGGRFFFKSAWSGLKRRRTNMDVPISLAVTLSYAVSLWETMHHGEHAWFDASVSLLFFLLIGRTLDHVMREK
    ARAAINGLARLAPRGAQLMMPDGSRHYIPVEEIAVGDNIAIAAGRRIPVDGMIVSGESDVNLSIVTGESSTVAVAAGSAL
    NSGAMNLTGSLVLRATKVARDSLLSEIIGLMEAAEGGRARYRRVADRAAALYSPAVHLLALASFLAWGLLGGDWKQAMLV
    AVAVLIITCPCALGLAVPVVQVVAAGELFRRGIVVKDGSALERLADADMVAFDKTGTLTMGRPRLVRSDAIAGNSAIVCA
    MAAHSRHPLSQGLVRDIDISYPFAFDRVTEIAGGGLEAWKGADFYRLGNRAFACGTGLTPAGDTPFSEVVLSKNGVDLAR
    FLFDDTLRPGAAEAFRQLAAAGIETLIVSGDRQAVVDNTARALGIGKALGDLAPKQKVEELQRLGAEGYRVLMVGDGIND
    APALAAAQVSMAPATASDVGRQAADLIFFNDRLDAVPEAIAVARRSASLIRQNFALAIGYNVLAVPIAIAGLATPLIAAV
    AMSTSSIIVVTNALRLNAFGRRPGLRSEPLAGGRAEVETT

    >gi|190894487|ref|YP_001984780.1| putative FAD-dependent pyridine nucleotide-disulphide oxidoreductase protein [Rhizobium etli CIAT 652]
    MTAALYLARLNRRVLAVDSGQSRALLIPLSRNHPAFPEGIKGSELSRRMKTQLRKVGVEVGAVAVSQVSRGADAGFVAEI
    AGRPIFAQNIILATGVEDTLPPIDDANDLIRSGHLRL
    CPICDGYEIAGRSAVVIGATERAAAEALFLTSFTKSITIATLG
    ERLDVNESMMARLIEHGVSVHFGQLVRCARSVDGTVDLIMRNSCALESVVLYSALGIRPRSRLAQQLGAELEQDRRIKVD
    AHQATLVPGLFAVGDVVTGLNQLGVSMAQGEIAAVAVHNRLRQMQANNKTPLG

    >gi|190894544|ref|YP_001984837.1| peptide methionine sulfoxide reductase protein [Rhizobium etli CIAT 652]
    MTEERAVLAGGCFWGMQDLIRRYKGVISTRVGYTGGDVPNATYRNHGTHAEAIEIIFDPARISYREILEFFFQIHDPTTR
    NRQGNDVGTSYRSAIFYTSPEQERVAKETIADVDASGLWPGKVVTEVVPVSDFWEAEPEHQDYLERIPNGYTCHFVRPGW
    KLPARQKIA

    >gi|190894797|ref|YP_001985090.1| probable iron ABC transporter, substrate-binding protein [Rhizobium etli CIAT 652]
    MTSLKSIAAACGLFTVIGLAATPSLAGSTTYPLTLENCGAEVTFKKAPERAIGLGQNSAEILLLLGLQDKMVGTAFWPSK
    VLPQLTEANAKVKLLTVEMPTFESMLAENPDFVAAALPSLVGPNSKVAKREDFDKVGVATYLSPST
    CLSTKDVKDQYGSR
    GELWNMDLLYKEIDELSQIFDVTDRGQALIADFKAREAKLRGSVAKDGQKLSYVFWFSSPSPSADAYVGGKNSASGFIAD
    LLGGRNAIDAAAEWPTIGWEGIIAANPDVIVVASLDRNRWELDKPEAKIKFLNTDPAVSQIPAVKNKALVVMDGQAMNPT
    IRTIYGAEQVAEQLKALGLLK

    >gi|190895328|ref|YP_001985620.1| peptide methionine sulfoxide reductase protein [Rhizobium etli CIAT 652]
    MSSNGRRLAAFLAVAAFLLGADVTVAAEEAVVIPPPDVDEAAGSGTETAIFAGGCFWGVQGVFQHVKGVESAVSGYAGGT
    AKTAQYETVSTGSTGHAEAVEVKFDPKQVSYGRLLQIFFSVAHNPTQLNYQGPDRGTQYRSVLFVSHPQQRKVAERYIDQ
    LDKAHAFPRPIVTKVSDADGFYPAEAYHQDFLTLNPTYPYIVYNDLPKIESLKSLFPADYRSQPVLVGKTKG

    >gi|190895530|ref|YP_001985822.1| probable mercury(II) reductase protein [Rhizobium etli CIAT 652]
    MKSFDAIVIGAGQAGPFLAARMVEKGMKVALIERKFLGGTCVNAGCMPTKTLVASARAAHVARSAAAYGVNIEGAIAVDM
    KVVRARAETVTMNARNGLIGWFAGMDGMSVIYGHAHFEGPNTVSVNGEALTAPRIFLNVGARPVIPDLPGIDDIDYLTST
    SIIHLDTLPRHLAVIGGSYIGLEFAQMYRRFGAEVSVIEHGPKLASREDEDISDAIAEILRSEGIDVHTDAGNIALAVNG
    NGVSVTAGAATIDASHVLIATGRKPNTDDLGLDAAGVATDKRGYITVDDKLATNVEGIFALGDCNGRGAFTHTSYNDFEI
    AAANLLDDDDRKVSSRIPAYALYIDPPLGRVGMTEKQARETGRKIMVSTRPMSRVGRANERGETKGFMKVIADAETKEIL
    GAAILGIEGDEVIHGLIDAMNAGTTYPTLKWSVPIHPTVSELIPTLLGDLKPV

    >gi|190895598|ref|YP_001985890.1| putative carboxymuconolactone decarboxylase protein [Rhizobium etli CIAT 652]
    MATVKLLSDQEAAATPAVQAVFDDIRATRKTDFINNFWRALANDPANLKRVWETLKSVMTVEGAIDPLTREMIYIAVSTA
    NACQY
    CIQSHTAAARARGMTDAQHGELLTVIGLAAQTNHLALAMQVPPDPEFEVR

    >gi|190895665|ref|YP_001985957.1| probable thioredoxin reductase protein [Rhizobium etli CIAT 652]
    MDDVIIIGGSFAGLAAALQLGRTRRRVTVLDTGLPRNRFAGHSHGLLGHDHKPPLDILAEARMQLARYPTVRLLNARADS
    ISGPIDDFSVLTGDGESLGARRLILSYGVADQMPDVPGFAESWGTSIVP
    CPYCDGFEVADQHWGLVWSGPPSHNYVRLYH
    DWTDTLTVFADGHDIAPDIRADLARRNIPVIDGRIAEIAHHRGHITTVNLESGRNAGVDILFAHPRNKPSASLHESLGLA
    TVDTPFGIALKVDERRETSMPGIYAAGDLANPAMNSVTTAISQGATAGISAQQSMLV

    >gi|190890819|ref|YP_001977361.1| putative peroxiredoxin protein [Rhizobium etli CIAT 652]
    MSTRSVDHPLQPGDRVPNVVLDAISREGKIALDDFRGHSPLLIGLFRGLHCPFCRRHVAAMAYLNPTLREKGVQSLAVVN
    TPVERARLYFRYHPIPDLLAASDPVRASHQAFGLREVGIDTVMAIRLDLPGELPEPMGVMAMDEFLNEKEGYQITDADQQ
    MMTADHGQLVGQFLIDREGIVRWSFTEVLEAGVQTFKGPNSQELISVASEIAL