Rhizobium etli CFN 42 uid58377

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|21492746|ref|NP_659821.1| putative hydroperoxide reductase protein [Rhizobium etli CFN 42]
    MTMEKQVPIVTFRTRVRDESISGPNPYRWEDKTTDDYFSGKRVILFSLPGAFTPICSTFQLPDFESLYVEFKKNGIDDIY
    CLSVNDAFVMNAWGKSQGLKNVKLIPDGSGEFTRKMGMLVAKDNLGFGLRSWRYAAVINNGVVEGWFEEEGFGDNCATDP
    YGVSSPQNILKCLKAPAFV

    >gi|21492743|ref|NP_659818.1| Fe-S cofactor nitrogenase synthesis protein [Rhizobium etli CFN 42]
    MIKLTENAAAIMNVTLSRAEQAEGFRIAVEAGGCAGYKYLVGLESVQGEGDAVIETNGVKVFVDADSQAHINGMTIDFVT
    GPETSGFVFDNPNAHQNCTCGKSFG

    >gi|21492678|ref|NP_659752.1| cation transport ATPase protein [Rhizobium etli CFN 42]
    MTCCSMDAESVLGLSATSASAEEVCLASHPLGAGLRQVDLSVPDVHCGDCILTLEKALSALAFVRKARVNLTARRVTCVY
    QEEIEAKATDPSEILAAITLAGYRAHLITSTAPETDRIRNQLLLAIGVSGFAAANIMMLSVSVWSGADAATRDMFHWISA
    MIAAPALVYGGRFFFKSAWSGLKRRRTNMDVPISLAVTLSYAVSLWETMHHGEHAWFDASVSLLFFLLIGRTLDHVMREK
    ARAAINGLARLAPRGAQLMMPDGSRHYIPVEEIAVGDNIAIAAGQRIPVDGMIVSGESDVDLSIVTGESSTVAVAAGSAL
    NSGAMNLTGSLVLRATKVARDSLLSEIIGLMEAAEGGRARYRRVADRAAALYSPAVHLLALASFLAWGLLGGDWKQAMLV
    AVAVLIITCPCALGLAVPVVQVVAAGELFRRGIVVKDGSALERLADADIVAFDKTGTLTMGRPRLVRIDSIAGNRAIVCA
    MAAHSRHPLSQGLVRDIDISYPFAFDRVTEIAGGGLEAWQGADFYRLGNRAFACGTGLTPAGDTPFSEVVLSKNGVDLAR
    FLFDDTLRPGAAETFRQLAAAGIETLIVSGDRQAVVDNTARALGIGKALGDLGPKQKVEELQRLGAEGYRVLMVGDGIND
    APALAAAQVSMAPATASDVGRQAADLIFFNDRLDAVPEAIAVARRSASLIRQNFALAIGYNVLAVPIAIAGLATPLIAAV
    AMSTSSIIVVTNALRLNAFGLRSEPLAGGRAEVETA

    >gi|86355693|ref|YP_467585.1| thioredoxin protein [Rhizobium etli CFN 42]
    MATVKVDINNFQSEVLESAEPVVVDFWAEWCGPCKMIAPSLEEISVEMEGKVKVAKLNIDENPELAAQFGVRSIPTLAIF
    KGGEVADISVGAKPKTALSNWISNAA

    >gi|86355800|ref|YP_467692.1| molybdopterin biosynthesis protein MoeB [Rhizobium etli CFN 42]
    MEPLSPDEIARYQRHILLPEIGGAGQQKLKAARVLVIGAGGLGAPILQYLAAAGIGTLGIVDDDRVSLSNLQRQVIHDSG
    TIGELKTESAALAIARLNPHVRLIRFEERFSRETARRQLSGFDLLIDGSDNFDTRYAAADAAEEARIPLVTGAVGRFDGS
    LTVLKPYETADDGAPNPGYRDLFPEAPPAGLIPS
    CAEAGIIGALTGVIGTMMAMEAIKLITGAGEPLIGRLLLYDALLAR
    FETVRYKRRRARQAG

    >gi|86355902|ref|YP_467794.1| hypothetical protein RHE_CH00244 [Rhizobium etli CFN 42]
    MTEKARVSILYCTQCNWLLRAAWMAQELLSTFSDSLGEVALIPGTGGNFEIRVNGDLIWERKRDGGFPGPKELKQRVRDI
    IEPGRDLGHVDRVSHES

    >gi|86355939|ref|YP_467831.1| glutathione S-transferase protein [Rhizobium etli CFN 42]
    MSRLTLISHHLCPYVQRAAIALREKGVPFERINIDLANKPDWFLEISPLGKVPLLRIEEDDGGEAILFESSVICEYLEET
    QAGSALHPADPLARARHRGWMEFGSSVLSDLWGYETATEVEQLEAKRKALIAKFATLEGVLADGPYFSGSSFSLVDAVFA
    PIFRYFDVFERLGDSGIFAGLERVTRWRIALGERRSVKDAVGEDYPQRLMEFLDKHESILLRLPAAA

    >gi|86355942|ref|YP_467834.1| arsenate reductase protein [Rhizobium etli CFN 42]
    MAVTIYGIKNCDTMKKACSWLEEHGVAYEFHDYKALGIDRAHLEDWIDKAGLDTVLNRAGTTFRKLPDAERENLNREKAI
    ALMLDQPSMIKRPVLETEGKLLIGFKPENYADMFGR

    >gi|86355944|ref|YP_467836.1| methylated-DNA-[protein]-cysteine S-methyltransferase protein [Rhizobium etli CFN 42]
    MAETIHHYLIFETTGGFCGIAWSEAGIARFQLPTKTAEATERLLLRRLPDAQPGSPMPEVLDTVAAVKRYFQGEETDFSG
    VQLDLAGQNDFFRDIYAAARRVGWGRTTTYGALAKELGVGPEAARDVGQAMAKNPVALIIP
    CHRVLAAGGKIGGFSAPGG
    SSSKARMLELEGVSLAPPPPVQQSLGF

    >gi|86356080|ref|YP_467972.1| methylated-DNA-[protein]-cysteine S-methyltransferase protein [Rhizobium etli CFN 42]
    MLFERPDDDTLYDALIARSADYEGQAYVCVKTTGVFCRLTCPARKPKRENTLFFETIAACMHSGFRPCRRCRPLEQPGRE
    PIVDALLARLEEEPEVRWSEDELVRRGHDPSTVRRAFKRALGMTFHDIVRYIRLGEAARQLAAGARVIDAQIDAGYETPS
    GFRAAFQRLVGKAPALSQNRELLFADWFDTPLGPMIAVADKTHLHLLEFHDRKALLSELEALQKRVRSSVAIGRTPAIDQ
    IEAEIRDYFEGRLTVFKTPLALGGTPFEKHVWARLMEIPLGQTRAYGDLAREMERPEVVRAVGRANGANQLAIVVP
    CHRI
    LGADGSLTGYGGGLWRKQWLLRHEEKIGTETRMEETA

    >gi|86356199|ref|YP_468091.1| hypothetical protein RHE_CH00546 [Rhizobium etli CFN 42]
    MQPRFNFAKAAPDAYKAVAALEQYVQTSGLERRFIHLIKLRASQINGCAYCVDMHVKEARHDGLGEQWINLMCVWRESPV
    YDARERALLGWVDAVTNIAKTGAPDADYETLKAHFSEEEMTKITVAIGAINIWNRLAVGFRSQHPIDVVTKAA

    >gi|86356271|ref|YP_468163.1| putative membrane-anchored protein (osmotically inducible protein) [Rhizobium etli CFN 42]
    MADLKARPRPTGATATLGRTGFPHVTSTTKGEIDIVTAPSQPGFSPLDLLYASLSACLVLSARIAASQMGVLDRISEVTA
    DVTGEKAAEGLSRVAKFNIVFSIKGDIDEETRRKIVDAAEDEI
    CTVSNTIRGTPEFSTLISKQV

    >gi|86356614|ref|YP_468506.1| peroxiredoxin protein [Rhizobium etli CFN 42]
    MTIAIGDKLPAATFKEKTADGPVEITTEQLFAGKRVVLFAVPGAFTPTCSLNHLPGYLENRDTILAKGVDDIAVLAVNDW
    HVMGAWAQSSGGLGKIHFLADWDAAFTKAVGLEADLSAGGLGLRSKRYSMLVEDGVVKALNVEESPGQATVSGAAAMLEL
    L

    >gi|86356645|ref|YP_468537.1| putative thiol-disulfide oxidoreductase protein [Rhizobium etli CFN 42]
    MQMSEMQLTKRRLLGGIAIAAAAAALAACNDSKDAADASSSGKTMADGTNVDTIETAATSATTDMPQSDGDVDMAEVLKP
    GALPEMALGKADAPVKIVEYMSMT
    CPHCAHFHNTTFDAIKQKYVDTGKVQFIIREFPFDPRAAAAFMLARCSAANPGQLS
    TPEQYFPMVSMLFKQQQVWAAADDGRAALLQMSKLAGFTEDSFTKCLTNQKLLDEVNATRERGSKDFGVNATPTFLINGK
    RYSGDMPVDTMSKLIDSLI

    >gi|86356654|ref|YP_468546.1| hypothetical protein RHE_CH01008 [Rhizobium etli CFN 42]
    MADKKRPLQPGNTAPAFELATANFDGTVSLADLSGRPFLIGFFRGLHCPFCRRQLEQLAGIEPTLNAAGVKTVAVINTPV
    ERARLYFRHRPTPVTLLCDPDCRTHRAYGVPHAEFQPDGSSEPPEWPYTATMAQFQAARINPTGEFPEPLQPMEANTILN
    AKDRFELDEADQAIFAKHATQLVGHFLVDQNGTIAWAQMEALDGPSSLCIFPTAAEIIAAVGELAR

    >gi|86356769|ref|YP_468661.1| hypothetical protein RHE_CH01127 [Rhizobium etli CFN 42]
    MSTRYVDHPLQPGDRVPNVEFDAISREGKIALDDFRGHSPLLIGLFRGLHCPFCRRHVAAMAYLNPMLREKGVQSLAVVN
    TPVERARLYFRYHPIPDLLAASDPVKASHQAFGLREVGIDTVLAIRIDLPGELPEPMNPIAMDEFINKKEGYQVTEADQQ
    MMTADHGQLVGQFLIDREGIVRWSFTEVLEPGLQTYKAPNSQELISVASQVAL

    >gi|86356814|ref|YP_468706.1| organic hydroperoxide resistance (osmotically inducible) protein [Rhizobium etli CFN 42]
    MPILYTTKASATGGRAGRAVSENGVLDVTLTVPKELGGDGATGTNPEQLFAAGYSACFLGALKFVAGQQKVKIPEDTTVS
    AKVGIGPREDGTGFGIEVALTVNIPGLERETAEKLAAAAHIV
    CPYSHAMRTSTEVPVTVA

    >gi|86356863|ref|YP_468755.1| hypothetical protein RHE_CH01223 [Rhizobium etli CFN 42]
    MAALCPLWQSSFDEREKQITIPCIGRCCVKSFIRLAPRATQPYLSIMTSALEKNRPGAAFAFDNSYAGLPQRFFAPQAPT
    PVAEPWLIKLNEPLAEELGLDVEVLRRDGAAIFSGNLVPEGALPLAMAYAGHQFGGFSPVLGDGRAILLGEVVGRNGKRY
    DIQLKGAGQTPFSRRGDGRAALGPVLREYIISEAMFALGIPATRALAAVTTGEPVYREEVLPGAVFTRVAASHIRVGTFQ
    FFAARGDAEGVRALADYVIDRHYPELKEAENPYAALFEAVSERQAALIARWLHIGFIHGVMNTDNMTVSGETIDFGPCAF
    MDIYNPSTVFSSIDHHGRYAYANQPAIGQWNLARLGETLLPLIDADQDSAVDKANAVIRAYGERFQAHWLKGMRAKIGLE
    GEEDGDLELVQALLALMQAQGADFTLTFRRLSDLAGDDAAEPGFATSFREPDSSGEWLARWRGRLSRDPQTAAGRAAAMR
    SVNPVFIPRNHRVEQAIEAAVESADFSLFEALLKVLAKPYEDQPSFAAYMEPPKPNERVLQTF
    CGT

    >gi|86356887|ref|YP_468779.1| methionine sulfoxide reductase B [Rhizobium etli CFN 42]
    MSETATTAKIHKTDAEWKEQLTPEQYRITRQHGTERAFTGPYWDSFETGLYRCVGCNAPLFRSDTKFDAGCGWPSYFEAV
    SPDAVTEHRDTSYGMVRTEIRCGTCDAHLGHVFPDGPPPTGLRY
    CINGHAMVFEPAE

    >gi|86357234|ref|YP_469126.1| glutathione peroxidase protein [Rhizobium etli CFN 42]
    MTGNVLDIPVKTVDGRPTTLNEYKGRVLLIVNVASKCGLTPQYEGLEKLYGEKRERGFVIAAFPANDFKGQEPGTDAEIL
    DFCTSTYDVTFPIFSKISVKGEAQHPLYRQLTKSGVTTTGDGPMRERLKAHGISGGDEDDILWNFEKFLIGRDGEIVARF
    APDVTADDPRLVSAVDRELAKG

    >gi|86357345|ref|YP_469237.1| hypothetical protein RHE_CH01715 [Rhizobium etli CFN 42]
    MAFIHTPDASASEKTTSMYASAEANYGYLPNMYRAFGHRPEVMESWAGLLSSIRSHMSLRRYELVTLAAAKELKSSYCML
    AHGSVLLREGFTSDGLTAVVNETEKAPIDAGERAIMAFAAKVARDATSVTQQDIDGLKKHGLSDAEIFDVTAAAAARCFF
    SKMLDALGAAPDHAYIERLEPNVRRTLSVGREVERPLAPSSASGASQ

    >gi|86357366|ref|YP_469258.1| ubiquinone/menaquinone biosynthesis methyltransferase protein [Rhizobium etli CFN 42]
    MGSVPMGHKRISFHIVQTTRSGDRSASRTSVEEASDQGPSPWTTADSAIFQLRWSCVWRRAVSTSANIEDGADAAFVASP
    PPFGAGVADLYQALLVPILFEPYALEMAIVAERSKPVSVLEVAAGTGALTRALRAKLDPAAEIVATDLSQAMIDVGAPSV
    TMSRTHWMHADAQDLPFAPLMFDLVVCQFGVMFFPDKPKAYHEAKRVLRSGGRLLFSTWDSLAANDFARCVDE
    CLTGLFP
    SDPPDFLGRLPYSYFDPSLIKAEVSSAGFKAVSCERLELASIAATSQDVATAFCRGTPLSGEIEWRAPERMSEIVDEVAE
    RVASRYGARPCGSMSALVVSGRAP

    >gi|86357403|ref|YP_469295.1| thiosulfate sulfurtransferase protein [Rhizobium etli CFN 42]
    MTESKSRFVVSAEWLRAELGKPDLRVLDASFYLPAQKRDADAEYAAGHIPGAIRFDQDKIADHSTALPHTIPSPDYFAAE
    VGKLGISENDRIVVYDGIGLFASPRVWWLFRVMGAKNVYVLDGGLDGWKAESRPLETAAPNYAPATFTPDFDESRVVTLD
    TMRDIVSSGAMQIADARSAGRFAATEPEPRAGMRSGHMPGARSLPSGVFANQGRFKSLPELRQTIEEAGIDLSKPVVTS
    C
    GSGITAAIITLALESLGHHDNKLYDGSWSEWGSRDDTPVVTGPPTPVKA

    >gi|86357421|ref|YP_469313.1| anti-oxidant AhpCTSA family protein [Rhizobium etli CFN 42]
    MSLRINDIAPDFTADTTQGPISFHDWIGNGWAVLFSHPKNFTPVCTTELGAMAGLADEFSKRGVKIIGISVDPVESHAKW
    KGDIKTATGFDVDYPLIGDKDLKVAKLYDMLPAGAGDSSEGRTPADNATVRSVFIIGPDKKIKLILTYPMTTGRNFNEIL
    RAIDSIQLTAKHQVATPANWNQGEDVIITAAVSNDDAIARFGSFDTVLPYLRKTKQPSV

    >gi|86357444|ref|YP_469336.1| hypothetical protein RHE_CH01816 [Rhizobium etli CFN 42]
    MTDTSVTLSDAAAKRIASIIGAETGKSALRVSVEGGGCSGFSYKFDLADSPGEDDVVVEKNDAKVLIDSLSLVYMAGSEI
    DFVDNLLGQSFQIKNPNAVASCGCGTSFSI

    >gi|86357498|ref|YP_469390.1| outer membrane protein [Rhizobium etli CFN 42]
    MLDVQEALQKKQEAARLVKANMAIEENTANIFNSKDDVTLGNPKGDVTVVEFFDYNCTYCRHALPDMQAMLKKDTNVRFV
    LKEFPILGPDSVAAHKVADAFRRLAPAKYADFHVALLSSEGRASEDSAIAVAASLGVSEDKVRAEMAKSPNDGIVQATYQ
    LASSLGISGTPSYVIGNELVPGAVGLDDLEAKVKNMRSCGKTVC

    >gi|86357559|ref|YP_469451.1| dihydrolipoamide dehydrogenase [Rhizobium etli CFN 42]
    MAESYDVIIIGSGPGGYVAAIRASQLGLKTAIVEREHMGGICLNWGCIPTKALLRSAEVLDHANHFKDFGLVLEGSVKPD
    AKAVVGRSRAVSARLNAGVGFLMKKNKIDIIWGEAKLTKPGEIVVGKSSKPVVEPQHPLPKNVKGEGTYTAKHIIIATGA
    RPRALPGIEPDGKLIWTYFEALKPDALPKSLIVMGSGAIGIEFASFYRSMGVDVTVVEVMPTIMPVEDAEITAIARKQLE
    KRGLKIFTSAKVTKVEKGAGSITAHVETSDGKVQQITADRMISAVGVQGNIENLGLEALGVKTDRGCVVADGYGKTNVAG
    IYAIGDVAGPPMLAHKAEHEGVVCVEKIAGLPNVHPTDKGKVPGCTYCNPQVASVGLTEAKAKELGRDIRVGRFSFAANG
    KAIALGEDQGMVKVIFDKKTGELLGAHMVGAEVTELIQGFVVAMNLETTEEELMHTIFPHPTVSETMKEAVLDAYGRVLN
    A

    >gi|86357717|ref|YP_469609.1| putative dithiol-disulfide isomerase protein (involved in polyketide biosynthesis) [Rhizobium etli CFN 42]
    MERITIDVVSDVVCPWCYLGKARLELAIAEVQDEIGVDINWRPYRLNPDYPKEGVDQKKALAEKLGGEERVAQAHKMLTD
    YGREIGIAFNFEAIKIGPNTLDAHRLIHWAMIEGREKQDKVVAALFKANFEEGRNVGDHAVLLDIAEKGGLDRSVIASLL
    ASDADSNLIVAEIAAAQEMGVNGVPFFIFDQQYAVSGAQTPDVLANALRDIAKAKAEARSGLN

    >gi|86357756|ref|YP_469648.1| hypothetical protein RHE_CH02137 [Rhizobium etli CFN 42]
    MQENHADKPLQPGDRAPNVVLDAITRNGKIAIDDFRGQKPVLVGLFRGLHCPFCRRQIAAMAELTDALQEKGIDSLTVVN
    TPIERARLYFRYHPLPNLLAASDPERVSHRAFGLPNIEFTESENEWPHKVSMSTMSSMQIDMPGELPEPMNVMAAMEYLD
    KADGYEFTEDDTRMIATGHGQLVGEFLLDRDGVVRWCFTEVEEGGRNLFGGPAPRDVMSAAANMAV

    >gi|86357862|ref|YP_469754.1| hypothetical protein RHE_CH02247 [Rhizobium etli CFN 42]
    MGFAVMSMTEGAAARVKAIVENSGPETKGVRVGIKKGGCAGMEYTIDLVTEPNAKDDLIERDGAKVWVEPSAVLYLLGTE
    MGFEQTTLRSGFTFTNPNQTSACGCGESVELKPADLAALAARREAEPAHS

    >gi|86357877|ref|YP_469769.1| bacterioferritin comigratory protein [Rhizobium etli CFN 42]
    MAVPGIGALAPDFNLPRDGGGRVSLSDFHGRPLVLFFYPKDDTTGCTAESLAFTALAPEFEAAGAAVIGMSPDSAACHDK
    FIKKHRLSVALASDEDKTTLQAYGVWKEKSMYGRNFMGVERTTFLIRQDGTIATIWQKVKVQGHAEAVLEAVRNLAA

    >gi|86357919|ref|YP_469811.1| glutaredoxin protein [Rhizobium etli CFN 42]
    MSGIHEFIDNEIKSNDVVLFMKGTPQFPQCGFSGQVVQILDYIGVDYKGINVLADSEIRQGIKDYSNWPTIPQLYIKGEF
    IGGCDIVREMFQAGELQQHLQENGVTVRGAA

    >gi|86357992|ref|YP_469884.1| glutathione reductase [Rhizobium etli CFN 42]
    MSSYDYDLFVIGGGSGGVRAARVAASLGKKVAIAEEYRYGGTCVIRGCVPKKLFVYASQFHEHFEDAAGFGWTVGRSSFD
    WKKLVAAKDAEIARLEGLYKKGLAGANAEILETRAELVDAHTVRLVKTGQTVTAKTIVIATGGRPNPHVALPGHEL
    CISS
    NDAFHLEELPKSIVIAGGGYIAVEFANIFHGLGVATTLIYRGAEILSRFDEDLRRGLHEAMVAKGIRILCHDALQQVSNA
    EDGLVLETLNNGTLQAGVVMLALGRDPNTEGLGLEAAGVAMDERGAVIVDDYSRTNVENIYALGDVTNRVQLTPVAIHEA
    MCFIETEYKNNPTRPDHELIPTAVFSQPEIGTVGLSEEEAGKRYSELEVYRAQFRPLKATLSGRPERMIMKLIVESASRK
    VVGAHILGHDAGEMAQLLGVTLKAGCTKDDFDRTMALHPTAAEELVTMYAPSYRIRDGQRL

    >gi|86358024|ref|YP_469916.1| stress-induced OsmC-like protein [Rhizobium etli CFN 42]
    MIKIDKVLYTGRTRTTGGRDGASQSDDGELDIRLSPPGSARPGTNPEQLFAAGWSACFIGAIGIAAGKLKVRLPTETAVN
    AEVDLGTTEGDYFLQVRLQVSLPGIEADVAKALVDEAHRT
    CPYSKATRGNIHVELSIA

    >gi|86358028|ref|YP_469920.1| putative cytochrome biogenesis protein [Rhizobium etli CFN 42]
    MYSFVSAALSAIVRYIFLSNQTHRRYLRPTISQPLLVQAHRRPEPDQPVSKETMMTLLIIAYLGGVLTILSPCILPILPL
    VFARAGQPFVKSTLPMLAGMAATFALVATLAAVGGSWAIRANEYGRLAAIVLLALFGASLLSQRFASTLARPIVDLGNNL
    LNASGSGRTAPTVRSALILGVATGLLWAPCAGPILGLVLTGAALQGANLQTTALLIAYAAGAATSLAVALLVGGKIFAAM
    KRSLGLGDRIRQAVGAAVLAGVAVIALGLDTSLLARLSYASTASLEQAVLDRLHARPAGGTPSAVASNDTIVPAADGSKP
    FHSDLPVEAYAPSFDGAVEWLNSKPLTKEQLRGKVVLVDFWTYS
    CINCIRTIPYVRAWAEKYADQGLVVVGVHAPEFAFE
    KKIDNVKKAIGDFQIGYPVAIDNDYKIWRAFENSYWPAAYLIDAKGQIRYHHFGEGNYGRTEKAIQDLLREAGSQMADTA
    PVAPDARGVEAGPDLANIRSGETYLGYAQTENFVSPEGLQADTPQNYSITEPGINAWGLSGSWTIGKDQATLDQAGGGIA
    YRFSARDLHLVLGPGADAKPIRFQVRLDGKAPGPDHGSDIDADGNGTVTATRLYQLVRQSGTVTARNFEVRFLDPGVQAY
    AFTFG

    >gi|86358144|ref|YP_470036.1| arsenate reductase protein [Rhizobium etli CFN 42]
    MNVTIYHNPACGTSRNTLAMIRNAGIEPAIIDYVSTPPSRAELVKMIADAGLTVRQALREKDTPYAELGLDNPDLTDDQL
    LDAMLAHPILINRPFVITPLGTRLSRPSELVLEILPETHKGAFTKEDGEKVLDAEGKRIV

    >gi|86358154|ref|YP_470046.1| organic hydroperoxide resistance protein [Rhizobium etli CFN 42]
    MTEKLLFAGKTHIAGGRNGYARSSDGTLDIKLPQPHPAAENLFGAAWSACYIGAIELAAAQRKITLPAGPEVDAEITLNG
    DNGSYFLRARLNVSLADIDREIAQELIEAAHGI
    CPYSKAVHGNIDVETKLV

    >gi|86358577|ref|YP_470469.1| thioredoxin reductase (NADPH) protein [Rhizobium etli CFN 42]
    MPARHTKVLIIGSGPAGYTAAVYAARAMLKPVLIAGLEQGGQLMITTDVENYPGFADPIQGPWLMDQMLQQAKHVGAEIV
    NDLVSEVDMNQRPFVARTDSGQVWTADTLIIATGAKAKWLGIESEQHFQGFGVSA
    CATCDGFFYRNKDVIVVGGGNSAVE
    EALYLSNIAKSVTLVHRRDTFRAEKILQERLFAKENVNVLWNTEVAEITGTAAKPPMPQSVSGARLRDVRTGTITEMRID
    GVFVAIGHAPATELFKDKLKLKDNGYLWTAPDSTATSLEGVYAAGDVTDDTFRQAVTAAGMGCMAALEAERYLTGHMPVA
    VAAE

    >gi|86358883|ref|YP_470775.1| putative rhodanese-related sulfurtransferase protein [Rhizobium etli CFN 42]
    MASPVAEVPAAEPDLAAAHYAAKLAFETDCSDVHTAFARAMVDFVLLDVRSPALFAQSHVPGAINLPHGKMTAHRMSEWA
    RETLFVVY
    CAGPHCNGADKAALRLAKLGLKAKLMIGGMTGWVDEGFALESGAVAAE

    >gi|86359259|ref|YP_471151.1| 6-O-methylguanine-DNA methyltransferase protein [Rhizobium etli CFN 42]
    MDMIANPQTDITPDGPDYDIVRRVIELITEDYRDQPSLEAIAARLNQSPTQLQKTFTRWAGLSPKGFLQAVTLDHAKRLL
    RKEDMPLLETSIEVGLSGPSRLHDLFVTHEAMSPGEWKAKGGGLTIRYGFHICPFGVALIMVTDRGLAGLAFSDSGGERA
    CLEDMTCRWPNAEYIEDMRATMPYASRILEPGKWSSEQPLRVVLIGTDFQVRVWQSLLKIPFGKAVTYSDIANDIGRPTA
    QRAVGAAVGANPISFVVP
    CHRALGKNGALTGYHWGLTRKRAMLGWESAHA

    >gi|86359280|ref|YP_471172.1| osmotically inducible protein [Rhizobium etli CFN 42]
    MQINRTASAHWSGGLKDGKGLISTQSGALTDYPYGFASRFEGIPGTNPEELIGAAHAGCFTMALSLILGEAGFTAEHMET
    SAKVTLESVEGGFAVTAIHLSLSGRIPGADEATFTELANKAKAG
    CPISKALAAVPITLDVKLA

    >gi|86359308|ref|YP_471200.1| glutaredoxin protein [Rhizobium etli CFN 42]
    MSVTVYSKPACVQCTATYRALDRLGVDYDIVDISQDAEALDRVRSLGYMQAPVVIAGERHWAGFRPDMISALS

    >gi|86359309|ref|YP_471201.1| heavy metal-transporting ATPase protein [Rhizobium etli CFN 42]
    MAETSETRYRVGGMDCAACATKIDTAVRRVAGVADVSVSVVAGTMTVRHDGSSDLKVIEKRVTGLGYSVSPIVGTVAPAQ
    NHRSHDHHRHDHAGRDHGDHDHEGHDHDHGHAEKEIEGLHGHDRGSIAAPWWQSRKGQLTILSGAALIAAYAFGHLVPAI
    GSYAFIVAMLVGLVPIARRAIMAALSGTPFSIEMLMTIAAVGAVIINAGEEAATVVFLFLVGELLEGVAAGKARESIQSL
    TALVPKNALLEDNGQTREVPAESLAVGAIIMVRPGDRISADGVIVSGESAIDEAPVTGESTPVRKSVDAVVFAGTVNGDA
    VLRVRITAAAADNTIARVVRLVEEAQESKAPTERFIDRFSRYYTPGVVVVAALVAVVPPLFLAGAWSEWIYKGLAILLIG
    CPCALVISTPAAIAASLSAGARRGLLMKGGAVLETLGKLTMVAFDKTGTLTEGKPQVTDIVAFGLSEAQVLSRAAVLEQG
    SGHPLALAILNRAWADGVPVPPAFELEALPGKGVSGKVGGETLDLLSPSAARERGALDGEKDAGIAVLNDEGKSVSVLLV
    NGVAAGLIAMRDEPREDAEAGLSALKSAGVKAMMLTGDNKRTAAAVAGMLGIDWRGEMMPEDKQKVVGELKRQGFIVAKV
    GDGINDAPALAAADIGIAMGGGTDVALETADAAVLHGRVGDVARMIELSKRTMRNILQNITIALGLKAVFLVTTIAGITG
    LWPAILADTGATVLVTINALRLLRVKGQ

    >gi|86359346|ref|YP_471238.1| glutaredoxin protein [Rhizobium etli CFN 42]
    MQGLSPSLYDRNTRHPSGDIMVPVTIYTRQFCGYCSRAKSLLEEKGVDYVEHDATYSADLRQEMIGKSNGRTTFPQIFIG
    TEHVGGCDDLFALDRAGKLDPMLAA

    >gi|86359366|ref|YP_471258.1| hypothetical protein RHE_CH03783 [Rhizobium etli CFN 42]
    MTATSSPLARPGFIYSISLAIGMAAVVGAALGFQYIGGYIPCALCLLQRQPYYYAIPIAILAAICELAGLPNWISRAMLL
    AAGILMLVTAGMGVYHAGVEWHFWAGPAT
    CSTTANSMTSNAGDLLTELNTIKGPSCTDAALRVLGLSFAGWNVIAGILLA
    VFAFVGVRKSA

    >gi|86359378|ref|YP_471270.1| thiol:disulfide interchange protein [Rhizobium etli CFN 42]
    MTTKKPFGLPSGKLIAIAAVAGVVAGAAAVYVKETGIGNGIGSSASAECALAKERAANLTPLMRGQVAAMVAANEPRKLA
    AVSFNGPDGKSVGLDHFAGKTVLLNLWATW
    CVPCREEMPALNALEKEMGSDKFQVVPVNIDSGDDEKPKTFLAEIGVDAL
    QLYRDNTIGVFNSLKKEGLAFGLPVTLLLDDRGCLISAMNGPAVWDSEDAKALIKSAIGS

    >gi|86359463|ref|YP_471355.1| dihydrolipoamide dehydrogenase [Rhizobium etli CFN 42]
    MSYDVIIIGTGPGGYVCAVKAAQLGLKVAVVEKRATYGGTCLNVGCIPSKALLHASEMFHQAGHGLSALGIDVPAPTLNL
    GNMMAHKDATVKSNVDGVAFLFKKNKIDAFQGTGKIVSAGKVAVTAADGQVQEIEGKNIVIATGSDVAGIPGVQVEIDEK
    TIISSTGGIALDKVPETLIVVGGGVIGLELGSVWSRLGAKVTVVEYLDTILGGMDAEVSKQFQRMLAKQGIDFHLGAKVT
    GVEKAEKGAKVTFEPVKGGDAVTLDAEVVLIATGRKPYTAGLGLEEAGVALDNRGRVEINGHFRTNVAGIYAIGDVVKGP
    MLAHKAEDEGVALAEILAGQHGHVNYDVIPSVVYTQPEIASVGKTEEELKAAGIAYKVGKFPFTANGRARAMLATDGFVK
    ILADKDTDRVLGGHIVGFGAGEMIHEIAVLMEFGGSSEDLGRSCHAHPTMSEAVKEAALATFFKPIHM

    >gi|86359501|ref|YP_471393.1| putative stress-induced OsmC-like protein [Rhizobium etli CFN 42]
    MSTVIYTGKTSTTGGRDGASRSSDGRLDVTLSPPGSSGAGTNPEQLFAAGWSACFLGAIGRAAAERQLRVSADAAINAEI
    DLVSNDGGYVLQARLNAKLPGIEMDLARSLIERAHQL
    CPYSKATRGNIAVELNVA

    >gi|86359530|ref|YP_471422.1| thiol disulfide interchange protein (involved in cytochrome-c biogenesis) [Rhizobium etli CFN 42]
    MSGTPESNPGKPGGLSRYALALLPLIVFGAIAATAAKMLYDQDFHGKNIAEIPSALIGTKAPALNLPPLDGANLPALTDA
    AIKGKLTLVNVFASW
    CIPCRDEHPILKELAKDGRLNIVAINYKDKNDNALRFLGELGNPYRAIGVDPNGKAAIDWGVYGI
    PESYLVATDGTILYKRVGPFDDISLKEGLFPAIEKALAKPAS

    >gi|86359559|ref|YP_471451.1| thioredoxin protein [Rhizobium etli CFN 42]
    MSGSNNPYNGSFGNQMSATASFGAQPEPAAAAGSYITDTTTANFGKDVIEASRNQPVLVDFWAPWCGPCKQLTPVLEKVV
    NEAKGRVRLVKMNIDDHPSIAGQLGIQSIPAVIAFVNGRPADGFMGAVPETQIRQFIDRIAGPAGADEAAEIEAVLTEAT
    EMLAAGNINEAAQLYGAVMQADPENAKALAGMAECMIAADQHQRARETLTDLPEELAKDAGIQAVLKKLDQIEEARKLGD
    PVALERELATNPDHHEARLKLAKILNVEGRREEAAEHLLLIMRKDRGFDDDGARRQLLQFFEVWGFKDPATVAARRKLSA
    MLFS

    >gi|86359989|ref|YP_471879.1| methionine sulfoxide reductase A [Rhizobium etli CFN 42]
    MTEERAVLAGGCFWGMQDLIRRLNGVISTRVGYTGGDVPNATYRNHGTHAEAIEIIFDPAKTSYRDILEFFFQIHDPTTR
    NRQGNDVGMSYRSAIFYTSPEQERVARDTIADVDASGLWPGKVVTEVVPAGDFWEAEPEHQDYLERIPNGYTCHFVRPGW
    KLPARQKIA

    >gi|86360096|ref|YP_471985.1| polyketide synthase protein [Rhizobium etli CFN 42]
    MLQIELYTEITCPWCIIGHHRLDKVLAERFPELEVDIRQHPVLLLPDGPAEGLYIPDLLLKRYGVTDPKASFARPEAEAR
    ASGLDLDLSRQPWTYRTQAAHGLILAAQARGTQHQLAVAITHTHFLEAKNISDPDVLADVAAAYGLEREEARAIALDPEQ
    HRRVEQEAVRSMAAGVLSSVLRLRPTHRNQRRTQRRRDCSRYP

    >gi|86360097|ref|YP_471986.1| thioredoxin reductase protein [Rhizobium etli CFN 42]
    MDDVIIIGGSFAGLAAALQLGRTRRKVTVLDTGLPRNRFAGHSHGLLGHDHKPPLDILAEARQQLTRYSTVKLVNARADS
    ISGAIDKFSVLTGDGESLGARRLILSYGVADQMPDVPGFAESWGTSIVP
    CPYCDGFEVADQHWGLVWSGPQSHNYVRLYH
    DWTDTLTVFANGHDIAPDIQADLARRNIPVIDGRIVEITNHRGHITTVNLESGRNAGVDILFAHPRNKPSASLHESLGLA
    TVNTPFGIALKVDERRETSMPGIYAAGDLANPAMASVTTAISQGATAGISAQQSMLV

    >gi|86360118|ref|YP_472007.1| dihydrolipoamide dehydrogenase [Rhizobium etli CFN 42]
    MKEIVCKLLVIGAGPGGYVCAIRAGQLGIDTVIVEAGKPGGTCLTVGCIPSKALIHAAEEFDATQKMLAGKNPMGVRVEG
    ASIDLAKTIAWKDGIVGRLTAGVSGLLQKARVKIVHGRAHFRDGKTVEVETETGQQIIRAETVVIATGSDPVELANLPFG
    GRVISSTEALSLTELPKKLVVVGGGYIGLELGIAFSKMGSEVSVVEATPQVLPLYDAELVRPVMRKLSESGIRLLAGAKA
    MALADNGEALIVETSDGRRETLPADRVLVTVGRRPRTAGSGLEELDLDRAGPYLRIDDQCRTSMRGIYAIGDVTGEPMLA
    HRAMAQGEMVAEIVAGRKRGWDKRCIPAICFTDPEIVTVGLSPVEARAQGYEIRTAQFPFSANGRAMTMLSEEGFVRVVA
    RADTNLVLGLQAVGVGVSELSAAFALAIEMGARLEDIAGTIHAHPTRSEAVMEAALKALGNALHI

    >gi|86360289|ref|YP_472177.1| methionine sulfoxide reductase A [Rhizobium etli CFN 42]
    MSMSSNRRRLAAFLAVAAVLLGADVTAAAEEAVVIPPPEIDEAAGSGTETAIFAGGCFWGVQGVFQHVKGVESAVSGYAG
    GTAKTAQYETVSTGSTGHAEAVEVKFDPKQVSYGRLLQIFFSVAHNPTQLNYQGPDRGTQYRSALFVSNPQQRKVAEGYI
    DQLDKAHAFPRPIVTKVSDAAGFYPAEAYHQDFLTLNPTYPYIVYNDLPKIENLKSLFPADYRSQPVLVGKTKG

    >gi|86360497|ref|YP_472385.1| hypothetical protein RHE_PE00223 [Rhizobium etli CFN 42]
    MSEVVHTFTTQVPRWQPYVIPVDLETATSEQREAMQVTPSNKGISPYVLTLAHDPESLAVRSPLFNLIMYGKDGLSPGER
    ELGATAASVVNRCVY
    CAAVHASRFISHTKRADVIDAIFADGLDAELDEHLQAIFDFSAHLSTTPPEATQADAQALTDVGL
    SELEALDLVLSSAIFGWANRLMHTLGEPVMD

    >gi|86360544|ref|YP_472432.1| mercuric reductase [Rhizobium etli CFN 42]
    MKSFDAIVIGAGQAGPFLAARMVEKGMKVALIERKFLGGTCVNAGCMPTKTLVASARAAHVARSGAAYGVNIPGEIAIDM
    KVVRARAETVTMNARKGLIDWFAGMDGMSVIYGHARFESPNTVRVNGETLTAPRIFLNVGARPVIPELPGIDQIDYLTST
    SIIHLDTLPRHLAVIGGSYIGLEFAQMYRRFGAEVSVIEHGPKLASREDEDISDAIAEILRSEGIGVHTAANNIAFAGNG
    GGVSVTAGAAKIDASHVLIATGRKPNTDDLGLDAAGVATDKRGYITVDDRLATNVEGIFALGDCNGRGAFTHTSYNDFEI
    AAANLLDGDDRKVSSRIPAYALYIDPPLGRVGMTEKQARESARKIMVSTRPMSRVGRANERGETKGFMKVIADADTKEIL
    GAAILGIEGDEVIHGLIDAMNAGTTYPKLKWSVPIHPTVSELIPTLLGDLKPV

    >gi|86360567|ref|YP_472455.1| hypothetical protein RHE_PE00293 [Rhizobium etli CFN 42]
    MQERMGNPALVLPEAMQALNALSKVPTETGLSPKLLELVNLRASQINGCSVCIDGHWRVARKHGETDERLFAVAGWRDAP
    YYSEAERAALALTEAVTRTSDRADPVPDQIWDEATRHYDGRSLAALVIAIANINVWNRLNIATRQIAGAWKP

    >gi|86360627|ref|YP_472515.1| putative carboxymuconolactone decarboxylase protein [Rhizobium etli CFN 42]
    MATVKLLSDQEAAAIPAVQAVFDDIRATRKTDFINNFWRALANDPANLKRVWETLKSVMTVEGAIDPLTREMIYIAVSTA
    NACQY
    CIQSHTAAARARGMTDAQHGELLTIIGLAAQTNHLALAMQVPPDPEFEVR

    >gi|86360868|ref|YP_472755.1| thioredoxin reductase (NADPH) protein [Rhizobium etli CFN 42]
    MRDCIIIGGGPAGLTAAIYLARYHLSTTVFDDHSSRAATIPISHNLAGFPEGISGRELLARMRTQLQRYKVQILAEGVSQ
    LRKEQVGFRVLSNSGSMRARTVLLATGVTDRKPPILAERHDEAVAGGLIRY
    CPVCDGFEVTDKRVAVIGCGSRAFAEALF
    LRSYTTHVTIITPQEEHELSEIEVDRLRDLQIGLQKGPVKSIDPGRDAIRVATASGIGEFSSIYPALGSDARSKLAAVAG
    AELSENGCVIVDSHQRSTLPGLYAAGDVVVGLDQIGTAMGQAGIAATAIRNDLNEARPLAR

    >gi|86361230|ref|YP_473117.1| cation transport ATPase protein [Rhizobium etli CFN 42]
    MTCCSMDTESVLALSTASSSAEEVRLASHSLGAGLRQLDLSVPDAHCGGCISSIESALSALAFVRKARVNLTARRVSCIY
    QEEIDGRATDPSEILAAIAAAGYRAHLFTPTAPETDRIRNQLLLAVGVSGFAGANIMLLSVSVWSGADAATRDMFHWISA
    MIAAPALVYAGRFFFKSAWSALKRGRTNMDVPISLAVTLSYAVSLWETMHHGEHAWFDASVSLLFFLLIGRTLDHVMREK
    ARAAINGLARLAPRGALLMLKDGSRRYVAVEEIAVGDNISIAAGERIPVDGMIVSGESDVDLSIVTGESSPVAVAAGSAV
    NSGSMNLTGSLVLRATKVARDSLLSEIIGLMEAAEGGRARYRRVADRAAALYSPVVHLLALASFLAWGLLGGDWKQAMLV
    AVAVLIITCPCALGLAVPVVQVVAAGELFRRGIMVKDGSALERLAEADIVAFDKTGTLTLGRPRLVRAEAIDAGITTIAS
    ALAAHSRHPLSQALVRDMEFVSAFAFDRVTEMPGGGLEAWSGTDVYRLGNRAFACGTGLTPAADSPFSEVVLSKNGADLA
    RFLFDDTLRPGAASAVRQLAATGLETLMISGDRQTVVDNTAQALGIDKAMGALAPKQKVEECRELSAEGHRVLMVGDGIN
    DAPALAAAHVSMAPATASDIGRQAADLVFFHERLDAVPEAIAVARRSASLIRQNFALAIGYNVLALPIAIAGLATPLIAA
    VAMSTSSIIVVTNALRLNAFGKRTGPRTEARAGGNPEVKPA

    >gi|86361285|ref|YP_473172.1| hypothetical protein RHE_PF00557 [Rhizobium etli CFN 42]
    MSRSSVDRPLQPGDRAPNVVFDAISREGKIALNDFRGRSPLLIGLFRGLHCPFCRRHVSAMAQLNPALKEKGIECLAVVK
    TPVERARLYFRYHPLPDLLSASDPEGASHRAFGLPIVEFTENETEWPHKLGMDAVMAMRIDLPGELPVPMNPAAAGDFLE
    KKDWYEITAADRQIMIAGHMPLIGEFLLDREGTVRWSFTEAEEEGQNICRAPSPEELMAAASQVAHQ

    >gi|86356789|ref|YP_468681.1| glutathione S-transferase protein [Rhizobium etli CFN 42]
    MLTLYYASGTCALASLIALEESGLAFETKKLSFANSEQRSPDYLKINPKGRVPALVTDRGVLTETPAILGFIADSAPTAK
    LAPLGDAFEMARLQSFNSYLCSTVHVNHAHRRRGSRWTDDPAAIEAMKAKVPQNMADCFTLIEETMFDAPWVMGETYSLA
    DPYLFVMTDWLPADGVDPARFAKVSDHHARMLQRPAVQRALAFDRG

    >gi|86358278|ref|YP_470170.1| hypothetical protein RHE_CH02672 [Rhizobium etli CFN 42]
    MTAMLNATREQWLAARLDLLEEEKELTRQSDALAAKRQQLPRVKIDKDYRFDTEGGGASLKDLFGGRSQLLIYHFMFGPD
    YSAGCPS
    CSSIADGFNGFFVHLANHDVAFWTVSRAPLAKLEAFKRRMDWSFSWASSAGSDFNADFSVWFSPEQQRLGEIE
    YNYRREPPAPEPAAGKTVPQWQSRDSDEPIVQIATMTGTDVPTYTRDRPGVSAFELIDGGVYHSYSSYARGLDGLWGMYQ
    WLDRAPKGRNEAGIWWRHHDRYGKE