Renibacterium salmoninarum ATCC 33209 uid58899

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|163838805|ref|YP_001623210.1| mercuric reductase [Renibacterium salmoninarum ATCC 33209]
    MTEERSAETFDVIVIGAGAVGENVADRAVKGGLSALLIESELVGGECSYWACMPSKALIRPATALKAAQSLAGSREAVSG
    KIDADAVLKRRNSFTADWHDDGQVAWVDGAGIKFIRGKARLTGKLSVDISAPDAGVQSVQARYAVVLATGSQPTLPPFTG
    LKDIEFWGTREATSSQRVPESLIVIGGGVAGAELAQAYARLGAKVTQLVRSGLLNVAPAEARQLVRQAFQQDGIDLRENT
    SPRSVSRDSDGVHVELDGETIHAEELLVATGRAPALADVGLEGLNLQAYDPAKSHLSTDESGRVDGTDWLYAVGDAAGKV
    LLTHQGKYEARITGDAIAARAKGPVESKRWSKFAQTADELAVPSVIFTDPEVALVGRNVAQANSDGVRVTEVSLPIAVAG
    SSLYADDYQGWAQLVIDAEREVIIGATFAGPDVAELLHSATIAIVGEVPLSRLWHAVPSYPTISEVWLRLLEKLGL

    >gi|163838930|ref|YP_001623335.1| FrnE [Renibacterium salmoninarum ATCC 33209]
    MQHEGVAKCVRIQIWSDIACPWCYMGKRRFETALAAFPHKDQVEVQWKSFQLDPSLPNHYDGTEVEYISQRKGMPVEQVK
    QMFAHVFDQAAGEGLAFDYDALTVANSHLGHELIHFAAEHGKQDLAKETLLKQHFEQGTDIGNLDTLVAVAVELGLDGEA
    ARAALTERDFEAAVDQDIAEAHALGIQGVPFFVVDRKYGISGAQSPEVFSQTLNEAWAESHPLIMSGTNDAEACGPDGCA
    I

    >gi|163839076|ref|YP_001623481.1| organic hydroperoxide resistance protein [Renibacterium salmoninarum ATCC 33209]
    MGANGEGGYGLAVELEVSLPAVDAATAQALVEAAHQVCPYSNATRGNIEVKLSPAGVAA

    >gi|163839110|ref|YP_001623515.1| DsbA oxidoreductase [Renibacterium salmoninarum ATCC 33209]
    MLKRKTLCLAGLSAALLIASVASCASPEAASPDVNTGATSSTGITSAPIGPNASATALPLVRADSRIVNNPAEAKATLVL
    FTDYQ
    CPYCAKMDTLINKARDEYSGQLKIVVRNFPLAMHPNAPIAARAVEAAAEQNALTTMAEAVFKGQTTWAKATDGQA
    QLLAKYARGLGLDMTKFEQDFTSAKIGDRVERDLQDATALGLRGTPSVVLNGKLLSVDSTDYSTLKTPIDRVLAG

    >gi|163839338|ref|YP_001623743.1| cation transporter E1-E2 family ATPase [Renibacterium salmoninarum ATCC 33209]
    MGKMKTARELTKSTETAGRFVDLDIQGMTCASCVTRVEKKLNQIDGVNAVVNLPLESARVEVPAGVSDEELVAAVKTTGY
    SASVKEPMQHAQHENHMDHGGSAKELLPRLIVAAVLTVPVFLISMIPALRFAHWGWFAAALTLPVASWSAWGFHKAAAVN
    ARHGASTMDTLVSIGIIAAYLFSLGELIANPLMTEHPGMESMTGGGLYFEVAAVVTTFLLLGRYLEARSKAKAGDALKAL
    LSLGAKEATVIRDGKEVSIPAEDLKVGEHFVVRPGEKLPADGQILEGHSAIDTSLVTGESLPVEVAPGDSVTGATINTSG
    RLLVRASRVGSETTLAQMGRLVSQAQSEKAPIARLADRISAVFVPIVLGIAVLTFVLWWIFSGDVQAAFVAAVAVLVIAC
    PCALGLATPVALLTGTGRGAQLGILIKGPQVLEDTRTANTIVLDKTGTVTTGTLAVQAVQSFGMPEAELIRLSAAVEHGS
    EHPVGKAIVAVAGLPLARVSDFRATAGGGLQGTVQ

    >gi|163839550|ref|YP_001623955.1| putative 6-O-methylguanine-DNA methyltransferase [Renibacterium salmoninarum ATCC 33209]
    MKATFFTVDTPDGPFSVITAADNPESTEQAVVISAGWTESRADLAAQIHPTLRPTTIVDSAPDADIAATVADYYAGDFYT
    IGTIAVQQKSGPFRSHAWEILRQIPAGEPVTYRQYAELAGNPQAARAAASACANNAVALFVP
    CHRIVRTDGTLGGFRWGV
    AVKRSLLAREAAQTSAS

    >gi|163839634|ref|YP_001624039.1| thioredoxin [Renibacterium salmoninarum ATCC 33209]
    MLASRPQPCAECRVVAGFESRNQPQLDTRRKAEGEGWRCFGEYRIAANCSAGHRKGYVVTMATIDITGETFGSTVEGNDI
    VLVDFWADW
    CQPCKRFAPTYDAASQKHDDVVFGKVDTEAEQQLAAEANITSIPRLMAFREKVLVFAQPGALNPTQLEEVI
    TAVKALDMKEVHEHVAAQAAEAQES

    >gi|163839761|ref|YP_001624166.1| sulfide dehydrogenase precursor [Renibacterium salmoninarum ATCC 33209]
    MSYAGDLTPEEAWQKVADGATLVDVRTEAEWQIIGVPDTSSIAVEPKFVQWNLAGNVWNTAFLAELKAAVPADSELVFLC
    RSGARSISAAETATEAGFISYNVLEGFEGVPNSYGDRTVNGWKNRKLPWTSATHNEGQSE

    >gi|163839782|ref|YP_001624187.1| thioredoxin peroxidase [Renibacterium salmoninarum ATCC 33209]
    MSHDMLKFNQPLRSKESVMTTPRLNSGDAAPAFNLTDANGQSHSLKSFAGHKTVLYFYPAASTPGCTKEACDFRDNLSSL
    AAAGYAVVGISPDEVSALSKFTEAESLNFTLLADPDHSVAEAYGVWGEKKNYGRTYQGLIRSTFVLDEAGIVLLAQYNVR
    TTGHVAKLRRDLGLD

    >gi|163839855|ref|YP_001624260.1| peroxiredoxin, AhpE-like protein [Renibacterium salmoninarum ATCC 33209]
    MLGSNRTDNGGLEVGELVPDFELPNQFGEPIQLAAQRGKNVLLVFYPFAFSSVCTTELNELAERSAELIRANTVLLAVSV
    DSKYSLRAYSQAQKISFDLLSDFWPHGAVAQKFRVFDSVRGMAQRGTFAIDALGRLRSSFFSESGQARPWQEYQKALDLL
    AIEGSLQKTDFIVS

    >gi|163839962|ref|YP_001624367.1| molybdopterin biosynthesis protein [Renibacterium salmoninarum ATCC 33209]
    MSWPTDVDLPVLVQPDAELTDLEMHRYSRHLLLPEVGVLGQRKLKNAKVLLIGAGGLGSPAIAYLAAAGVGTIGIIDDDV
    VDVSNLQRQVLHSTSALGQAKVDSAAEQVAALNPLVSVQSYQSRLTAQNALQIFAEYDLVLDGSDNFATRYLVSDACEIL
    AKPLVWGSILRFDGQVSVFWAGQGPTYRDIFPEPPAPDSVPS
    CSEAGVFGMLCGVIGSVMAGEAIKLITGAGTSLLGKLQ
    IFDQLESSWRTITVRPDPQRAAVTELIDYDEFCGVSMPESVAIRLADLAPNSYQMIDVRTPAETALAVLPGAILLPKTLL
    DSGDYSLLPERPDGVALVLF
    CRTGLRSAVAALALRQAGFHSVFSVAGGLEL

    >gi|163840003|ref|YP_001624408.1| rhodanese-related sulfurtransferase [Renibacterium salmoninarum ATCC 33209]
    MNNLSFMINNQHAIEHFSHKLRFETDPSDVYAAWQSGSGLVLVDSRGEDSWRQGRAANAVHLPTAMIAEKASELIPRDSL
    VVVY
    CWGPGCNGAAKAALEFARLGYQVKEMIGGFEYWAREGFPVLNDDGPVLRQTDPLTAPLATTGISCDC

    >gi|163840153|ref|YP_001624558.1| thiosulfate sulfurtransferase [Renibacterium salmoninarum ATCC 33209]
    MLARFEGLGARPESAVAVYCGSGVTAAHQITALEIAGIKAALSQDLGLPGRSMLNCR

    >gi|163840330|ref|YP_001624735.1| HesB protein family protein [Renibacterium salmoninarum ATCC 33209]
    MTTTTETPAVSAAEPTVHGVGLSDVAADKVRSLLEQEGRTDLRLRVAVQPGGCSGLIYQLYFDERMLDGDAVRDFDGVEV
    VVDKMSVPYLDGASIDFEDTISKQGFTIDNPNAGGSCACGDSFH

    >gi|163840806|ref|YP_001625211.1| copper-exporting ATPase [Renibacterium salmoninarum ATCC 33209]
    MTCSACAVRIQKKLGKLDGVEATVNFATERAVLNGLAADRIDQAIEAVAAAGYSAELVTRGASSMPETNAPQRSAMLLRR
    LIIAAILTLPLGNFAIVLALIPEFRFPGWDWLCVLIATPVVFWCAWPFHRAAARNLRHGGFSMDTLVSLGVLASYFWSVG
    AIIFSDKSTPGFWVGFGQTPPGADSIYLEVAAGVTTFLLAGRYFEAKSRLAASNVLGALAKLAVGEVRLVRDGVESVVPV
    AQLRVGDLFVVKPGERIACDAEVEDGLAAVDTSAMTGELEPRPCSPGSTVVGGTVVLDGRLRLRAVKVGQSTQLAQLAAL
    AEHAQTRKASVQALVEKIVSVFVPVVLGLAVLVFALGLISGNPVDRAFGAAVSLLIIACPCALGLATPMALMVGVGRGSQ
    LGILIKSQQALESSGQIDTVVLDKTGTLTTGQMTVRLVQILKQSNTIDGTGISPERLTSMAAAAEAHSEHPTAQAITQFA
    QENGIQIPSTQEFRAIPGLGVRATVEGVEVLVGSAALLAAEGLDLVEELDLEKRSTIIYVAFDGEAVGRFSLQDSLRKGA
    VEAVQKLHALGLRTVLLSGDRQEVADEVARQSGISEAIGGVLPADKAQTIAQLQSAGRKVAMVGDGINDAAALATANLGL
    AMVSGTDVAMKSADIILLRSDLRVVADAIVLSKRTLRTIRGNLIWAFVYNIAAIPLAALGMLNPLIAGAAMSLSSLFVVT
    NSLRLRNFVASGDQTEAESDS

    >gi|163840833|ref|YP_001625238.1| thioredoxin peroxidase [Renibacterium salmoninarum ATCC 33209]
    MPMRKGDLVQDFELPDQTGELRKLSSLLANGPVVLFFYPVAMSGGCTKEVCHFRDIDAEFKAQGAQQVGISRDSVERQAE
    FAQKTNTEYLLLSDAEGEVAEAFGVKRYLLAKALPVKRATFVIDSDFRVLDVISSETDMNGHADQALAALKARA

    >gi|163841107|ref|YP_001625512.1| thiosulfate sulfurtransferase [Renibacterium salmoninarum ATCC 33209]
    MSLAPETDTENATKFSGYAHPERLVSTQWVADTIAAGKVGTAELAIVESDEDVLLYGTGHIPGAVKIDWHTDLNDHDTRD
    YIDGAAFAQLLSSKGIGRDTTVVIYGDKSNWWAAYALWVFTLFGHQDVRLIDGGRDKWLAEGREVSTESSAPAPAEYHPV
    ERKDEEIRAFKDDVLQHLGNGSLIDVRSPEEYTGARTSMPAYPEEGALRGGHIPTAASVPWAKAAAEDGKFRSREELENI
    YLNCAGLKGGDDVVAY
    CRIGERSSHTWFALKHLLGFDNVRNYDGSWTEWGNAVRVPIVKGEEPGSVN

    >gi|163841112|ref|YP_001625517.1| peptide methionine sulfoxide reductase [Renibacterium salmoninarum ATCC 33209]
    MTDSNAGYFKNSYTPAVVKTDQEWRQELSPEEFRVLRQSGTERAYSGEYTDTHTEGVYKCRACGAELFRSNEKFDSHCGW
    PSFFAPSEEGTVRYIHDRTMGMDRVEVRCANCDSHLGHVFEGERYGTPTDKRY
    CINSVSMTLVPAE

    >gi|163841166|ref|YP_001625571.1| dihydrolipoamide dehydrogenase [Renibacterium salmoninarum ATCC 33209]
    MSDQPAQPTQQEFDILILGAGSGGYAAALRAVQLGFTVGLVEKGKLGGTCLHNGCIPTKALLHSAELADHARDSAKYGVN
    VELQSIDIAAVNAYKDGIIAGKYKGLQGLIKSKKGLTVIEGEGKLSSQNTVTVTDAEGKATAYTGKNIVLTSGSYSRSLP
    GLEIGGRVITSDGALNLDRIPKSAIILGGGVIGSEFASVWKSFGVDVTIIEGLPSLVPNEDATIIKTLERAFKKRGINFS
    TGIFFQGVEQTDDGVKVTLVDGKTFEAELLLVAVGRGPNTAGLGYEEAGIPMDRGFVLANERLHTGVGNIYAIGDIVPGL
    QLAHRGFQQGIFVAEEIAGLNPVVIKDVNIPKVTYCDPEIASIGLTEKLAQEKYGAENVESKEFNLAGNGKSAIIGTSGT
    VKMVRQKDGPIVGVHMIGARMGEQIGEAQLIVNWEAYPEDIAPLLHGHPTQNEALGEAAMALAGRPLHG

    >gi|163841172|ref|YP_001625577.1| osmotically inducible protein C [Renibacterium salmoninarum ATCC 33209]
    MATVRTAHTVWQGDLPTGSGQVTLDSSGLGTYYVTWKARAEQAEGKTSPEELIAAAHSACFSMAFSHALGEEGKVPNNVQ
    TTADVSFQPGEGITGIHLTLKASVPELSEEDFQRIAQGAKTG
    CPVSAALTGTTITLEATLES

    >gi|163841442|ref|YP_001625847.1| thiol:disulfide interchange protein [Renibacterium salmoninarum ATCC 33209]
    MNLDGQDPVAETSKTTTSRRRGTLRRRAIFAAAAVSAALVLSACTANDPLAQQAKAGYDKNYIAGDGSVTEYALGKRTDP
    VDFTGKLYDGTEIASKSFEGKVTVLNFWYAA
    CAPCRVEAPDLEALNKELSPQGAEFYGVNIRDSEGTATPFMRTFNLSYP
    SFNDKDGAVLLAVAAQVPPAAVPTTLVLDKDRRVAARILGLADKSTLKALITSTLAESGATESGAASPTEKSE

    >gi|163841448|ref|YP_001625853.1| glutaredoxin [Renibacterium salmoninarum ATCC 33209]
    MRQDAVILLVKPNCHLCEDARAVVHEVTAEFGVAFSELSIAEDVDLATKYVDEVPVLLIDGIQRDFWTIDPVRLRRLLAA
    RN

    >gi|163841478|ref|YP_001625883.1| hypothetical protein RSal33209_2744 [Renibacterium salmoninarum ATCC 33209]
    MAIHRIVLFYAFAPVADPESVRLWQRALCEKHGLTGRILISRDGINATVGGELSAVKQYVKATKEYPAFNDIDVKWSEGS
    AADFPRLSVKVRDEIVSFGAPGELEVDQNGVVGGGTHLQPEELHELVAQKDVVFFDGRNAFEAQIGKFKNAVVPDVETTR
    DFIAELDSGKYDELKDQPIVTY
    CTGGIRCEVLSSLMVKRGFKEVYQLDGGIVRYGEKYRDAGLWEGSLYVFDKRMHLEFS
    DEAKTIGECSRCGAPTSDFHNCANLACRHLSLYCAECAASEDTLRCAGGCPAA

    >gi|163841553|ref|YP_001625958.1| hypothetical protein RSal33209_2820 [Renibacterium salmoninarum ATCC 33209]
    MTAGNAAVTTQSAPRIRASELVGRGWLNTGGQSLDLQALRGKIVLLDFWTFCCINCLHVLDELRPLEQKYADVLVTVGVH
    SPKFEHEADPVALAAAVERYEIQHPVLDDPELVTW

    >gi|163841779|ref|YP_001626183.1| thymidylate kinase [Renibacterium salmoninarum ATCC 33209]
    MARAGTNALSGEESAYLRQHADHPVHWQPFGDEAFAAAQQSGVPIFLSVGYAACHWCHVMAHESFDDPVLAEYLNEHFVS
    VKVDREERPDVDAVYMAATQAMSGEGGWPMSVFLTPEGQAFHAGTYFPPRPLAGRPSFREVLAAVNEVWTERRAEVYESA
    GQLATALTGRPVALGKSDELDAVELLHSSVRKLAEQEDPDFAGFGRAPKFPPSPVLGFRLRATADQGLTATEARAMAART
    LAAMANSSLQDQLAGGFARYSVTADWSLPHYEKMLYDNAQLLRRYAEWLKLPQGADYPPVEAQQVLRATADFMIAELLRA
    DGAFASSLDADSISGASGALHEGAAYTWTKAALIEALGQDDGVRLADLMNIGETEAPLHPGRELSRLDRQFLDAIRPTLL
    SNRASRPQPALDEKAVAGWNGLAVGSLVEAWAVTDEPRYLAAVIRAAETLLQTHWRGGVLTRLTGGSRPGLLEDYAWCAE
    GYFLLYSATGDPRWYQIAEDILLAASQAFVSANGVIDAIPVSAELLRAQGGVQGADPMDNATPSGVAAFAEVLVRYAALS
    GSFEHRELTEKILAQLSPLAERVPRAMGAVLGTLLAVDSEPWEVAVVGEQGAAELLKVARMIPLPGLVIAPSGRTVLADE
    ELVPLLRGRGLGPAGEAAAYLCQGMVCQRPTSGPAELAAELAAAPR

    >gi|163841883|ref|YP_001626288.1| O6-methylguanine-DNA methyltransferase [Renibacterium salmoninarum ATCC 33209]
    MSWQTEQMETQTSDCLRAPKRHAVVATSLGEITIVAEGSAVVGLYFPGHWTLPRKPDFGPRIAAEDDDLLHSAQSQLNEY
    LRGERVAFDVPTATEGSELEEQVWSLLRALLFGSTTTYGELAEKLGNKKLAQAVGRAVGHNPLSILVG
    CHRVLGSDGSLT
    GFAGGLERKRALLELENPNIAAARLF

    >gi|163841955|ref|YP_001626360.1| sulfurtransferase [Renibacterium salmoninarum ATCC 33209]
    MAMSEFENVAVTELNDGTKILDVREDYEWDEGHIAGAVHIPLEELPTRFEELDPDEDLYVICRSGGRSARATQWLNAQGY
    SALNVIGGMGAWQDAEKPMVSENGEPPNVR

    >gi|163841988|ref|YP_001626393.1| hypothetical protein RSal33209_3263 [Renibacterium salmoninarum ATCC 33209]
    MTETAVATASENVSNPAKADFWFDPLCPFAWVTSRWIGEVEKVRGIQVDWHVMSLSVLNSGRDGLSEKYKGLMDKGWGPA
    RVVIAAQQLHGEAVVKPLYDAIGAQIHNNGVEDYDEAIRLGLASAGLPAELAEYAHKDTYDAELKASHENGILPVGQEVG
    TPVVAFNGTAFLAQ

    >gi|163842044|ref|YP_001626449.1| peptide methionine sulfoxide reductase [Renibacterium salmoninarum ATCC 33209]
    MGGGCFWCLDAIYQKTKGVSEVVSGYTGGHTRHPDYESVSAGITGHAEVVAVTFDETVIPEEVILDLFFVSHDPTTLNRQ
    GYDVGTQYRSSMFYVDAEQEEAFNAAIMRAQPLWSDPIVTEITRLPDFYRAEEYHQDFYAKHPEQGYCQVIINPKLAKAR
    KYYSSWLTT

    >gi|163842199|ref|YP_001626604.1| glutaredoxin [Renibacterium salmoninarum ATCC 33209]
    MKHKSSANNYSSSQYSRRTRTAFDLNALRGRKIMTVTVYTKPACVQCNATYRALDKKGITYQSVDLSQDPEALERVRAFG
    YLQAPVVVTEQDHWSGFRPDKIDAIAQASDAASSVA

    >gi|163842208|ref|YP_001626613.1| glutaredoxin [Renibacterium salmoninarum ATCC 33209]
    MSLTNSIEYTPAAGTITMFSTSWCGYCRRLKSQLDSPGIGYTEINIEEVAGSAELVEQLNNGNQTVPTVIFPDGTAATNP
    SLLEVKERLAA

    >gi|163842267|ref|YP_001626672.1| thioredoxin reductase [Renibacterium salmoninarum ATCC 33209]
    MRATAPPWVTDTRSSQSVSTETTQNDVRDVIIIGSGPAGYTAAIYTARANLKPLMIAGSVTAGGELMNTTDVENFPGFPE
    GVMGPDLMDNLQQQAERFGTQIEYDDVTEVSLDGEIKTVRTGAGQSYSARSVIVSTGSAYRELGLDDEKRLSGHGVSW
    CA
    TCDGFFFKDKDIVVVGGGDSAMEEATFLTRFARTVTVIHRRDSLRASKIMQDRAFSNDKIKFIWNTEVYGIDGEAKANGV
    KLNNLVTGEKSELPATGIFVAIGNYPRVDLFKGVLDLTTEGTIAVAGRSSKTSLTGVFAAGDVVDPTYRQAVTAAGSGCV
    AAIDVEHYLASLDA

    >gi|163842268|ref|YP_001626673.1| thioredoxin [Renibacterium salmoninarum ATCC 33209]
    MSNAKAVTDATFQSDVISSEKPVIVDFWAEWCGPCRKVGPILDEISSEYADKVNVVKVDIDENPRIAAELGITSIPAIYL
    FADGEVKSTVIGAKPKQFFEKEFASYLQ

    >gi|163842259|ref|YP_001626664.1| phytoene dehydrogenase-like protein [Renibacterium salmoninarum ATCC 33209]
    MSRAAVVGSGPNGLAAAVTLARAGLEVKVYELSSTVGGGVRTAELTLPGFWHDVCSTGHPMALVSPFFREFELAQRIEFC
    NAELAFAHPLDDGRVGLAYRDLDRTIEELGRDGNAYGRFFSSMLGSMSEITDVLLNPLLPLPKSVPAAVLLGLRGAEQTF
    AAQARYCDDVAPALITGASAHSIARIPGVVSATAGVYLTALAHTVGWPLAKGGSQAIADAMLADLLAHGGSVELDRQIET
    LSELDEELILLDVSARALERIGAAAFPERYRRSLRAVRYGDGSCKLDLALSGPIPWRNPELSRAPIVHLGGTRAQMIASE
    RAVAAGQHPERPFVLLSQPGVVDPSRAPAGRQTLWAYTHVPAGSDRDVSETILDEIERHVPGTRDLVLGSSVITAAGYEH
    YNPNYQGGDISAGALTLPQLLGRPVFSTKTWRTPVRGVYLCSAAAVPGPAVHGMVGWHAAVTALQDLYQLPAPELAPDSS


    >gi|163841173|ref|YP_001625578.1| carboxymuconolactone decarboxylase family protein [Renibacterium salmoninarum ATCC 33209]
    MSEDQARRIRIPKLRPEFYKSLSAMDAAGAEGLDAKLVELIRIRSSQLNNCAFCLDIHLTDAREKGESQQRLDVLSAWHE
    APSFFTEQEQAALELTETMTLLPQSGVPHLIYQRAANAFGDDELSGVMATIIAINAWNRIGVATQLSPKQR