Bacillus cereus AH187 uid58753

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|217956821|ref|YP_002335915.1| hypothetical protein BCAH187_C0180 [Bacillus cereus AH187]
    MNKVYKIGAIVTTLCVACIAIFTLTKNESVNPETVTPKKTIVSAAETKGSPENIKDISKEELKQKIQSHEEFIAYYYQPT
    CHYCKKAAPDINSMSKKHDRTIYRIDISTPENQSAFQEFDIPGTPVVVAYNRGEEIERLEGAVSAATYDGFFTRRNSSAS


    >gi|217957832|ref|YP_002336376.1| protein disulfide isomerase [Bacillus cereus AH187]
    MKIEVWSDFVCPFCYIGKRRLEVALEQFPHKKDVEVEFKSFELDQNAPIYSGTSINEVLASKYGISIEEAKRNNVQLGNH
    AASMGLSFNFDEMKPTNTFDAHRLAKFAKNQGKEKEMTENLLFAYFTESKNLSDVDTLASIAEASGLDKQEALQVINDKS
    AYANDVRVDEAIAQQYQISGVPYFIINQKYAISGAQPLETFVGALQQVWEEENPVPKLQELSSEGGSDMSCTDESCSVPS
    KEQ

    >gi|217957909|ref|YP_002336453.1| peroxiredoxin Q [Bacillus cereus AH187]
    MPNNKNKEVENTLIEQDGDIFSVLSTFKEKLLTFKGKNIILYFYPRNFTSGCTKLACNFRDYSSEFVDLDTIIIGISPDS
    ALSHQEFIQSYKLPYILIEDESMKIADMYGAVVEADDRKKIIRKTIFINRDGEIVQEWIYDDVDGHVEEILHLIKNYK

    >gi|217957922|ref|YP_002336466.1| alkyl hydroperoxide reductase, F subunit [Bacillus cereus AH187]
    MILDADIKTQLSQYLQLMENDILLKVSAGDDDVSKDMLALVDELATMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGI
    PLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHFESYISLS
    CHNCPDVVQALNVMSVLNSGITHTMIDGAAFKE
    EVESKDIMAVPTVYLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRN
    VGVPGEAEFKNKGVAY
    CPHCDGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTV
    LKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
    NNPYKQIIISMGSGANAALGAFDYLIRN

    >gi|217957923|ref|YP_002336467.1| peroxiredoxin [Bacillus cereus AH187]
    MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTFVCPTELEDLQNQYATLKELGVEVYSVSTDTHFTHK
    AWHDSSETIGKIEYIMIGDPTRTITSNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRN
    NPGEVCPAKWQEGSATLKPSLDLVGKI

    >gi|217957981|ref|YP_002336525.1| hypothetical protein BCAH187_A0500 [Bacillus cereus AH187]
    MKNFETIEELVTYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLENYDYVEKIEILLQDMQEVAGRYAVFTGPTILLFHNG
    KEILRESRFISLENLERTIQLFEE

    >gi|217958073|ref|YP_002336617.1| bacterioferritin comigratory protein [Bacillus cereus AH187]
    MITVGEMAPEFTLEGSNGEQVRLADFRGKNVVLYFYPKDMTPGCTTEACDFRDAYGLFQEKDTIILGVSPDSANRHLKFI
    EKHELPFVLLVDEDHKVAELYDVWKLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEDVLSYIK

    >gi|217958079|ref|YP_002336623.1| hypothetical protein BCAH187_A0618 [Bacillus cereus AH187]
    MKSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLK
    EEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVDQ
    FKKDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYINGNLANPDFDSMKKAIDKELKK

    >gi|217958182|ref|YP_002336726.1| heavy metal-transporting ATPase [Bacillus cereus AH187]
    MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKTMVLETEQNKENEVVTEAKQLVTKLEPHIKVQEEKS
    TKVAKEVFILEGLD
    CANCAMKIENKVKEMPTVSTATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVLREEKG
    GHDHGHSHDHGEANVKKMVGRLVVGGILTAIAALASLPQMITIPLFVLAYVLIGGDIVWRAVRNITRGQVFDENFLMAIA
    TLGAFAIQQYPEAVAVMLFYQVGELFQSIAVNRSRKSITSLMDIRPDYANVKVGNETKQVSPEDVQIGDYIIVKPGEKVP
    LDGKVVEGTSMVDTSALTGESVPREVEAGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITKF
    ARYYTPVVVITAAIMAFIPPLILEGATFSDWIYRALVFLVISCPCALVVSIPLGFFGGIGGASKSGVLVKGSNYLEALND
    VKYIVFDKTGTLTKGVFKVTKMEPSEGITNEELLEYAAFAEVYSNHPIAQSIRNAYGKSVDEKMIDDYNEISGHGTVVKV
    QGKEIFAGNAKLMRKENITFKQPETVGTLVHVAVDGKYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAKSVGEA
    VGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKVAFVGDGINDTPVLARADVGIAMGGLGSDAAIEAADIVIMTDEPS
    KIATAVNIAKRTRRIVWQNIIFALGVKGLVLLLGAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL

    >gi|217958230|ref|YP_002336776.1| hypothetical protein BCAH187_A0773 [Bacillus cereus AH187]
    MKLTIKQDDIEADLSYGQLAIGKENGYSPLQLLVSSIAGCSAIVFRTILEKKRITYDTFTIETEIGRSEALSKPVESVHL
    HYKIKAHNITEEQLDKALQLAVKN
    CTIVQSVKDGIKVTETIELIK

    >gi|217958316|ref|YP_002336864.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Bacillus cereus AH187]
    MNNRYSRQELFSPIGEEGQQKIREKHVLIIGAGALGSANAEMFVRAGVGTVTIVDRDYVDWSNLQRQQLYAESDVENNLP
    KAVAAKKRLEEINSEVRVEALVQDVTAEELEELVTNVDVMIDATDNFETRFIVNDMAQKYSIPWIYGACVGSYGLSYTIL
    PSKTPCLSCLLQSIPLGGAT
    CDTAGIISPAVSLVVSHQVTEALKLLVEDYESLRDGLVSFDVWKNEYSCMNVQKLRKHNC
    PSCGENALYPYLNKENTSKTAVLCGRNTVQIRPPHKEEIDFERYKELLHDRVNDLNVNPYLLSFSVEEKRLVAFKDGRVL
    VHGTKDISEAKTVYHRYFG

    >gi|217958346|ref|YP_002336894.1| putative thioredoxin [Bacillus cereus AH187]
    MKKMLIFGGIIIVLFAAIFAVTQMEKKSASTDEKGYYSNKISLEDLNKNIEDKKEQTIYFYQTSCVHCQKVSPTVVPLAK
    DLNVDMKVIDIENLNEPWDKYNIQGTPTIIHFKDGKEVSRISGEQSKEKFKEWFEQTKK

    >gi|217958361|ref|YP_002336909.1| pyridine nucleotide-disulfide oxidoreductase, class I [Bacillus cereus AH187]
    MSRKIVVVGGVAGGASVAARLRRLSEEDEIIMVERGEYISFANCGLPYYIGGVITERQKLLVQTVERMSKRFNLDIRVLS
    EVVQINKEEKTITIKNVTTNETYNEKYDVLILSPGAKPIVPSIPGIEEAKALFTLRNVPDTDRIKAYIDEKKPRHATVIG
    GGFIGVEMVENLRERGIEVTLVEMANQVMPPIDYEMAAYVHEHLQKHDVELVFEDGVDALEENGTVVRLKSGSIIETDMI
    ILAIGVQPESSLAKDAGLALGVRGTIKVNEKFQTSDPHIYAIGDAIEVKDFVTETETMIPLAWPANRQGRMLADIIHGHT
    DSVYKGTLGTSVAKVFDLTVASTGVNEKILKRLNIPYEVVHVQANSHAGYYPNATPVLIKLIFNKDSGKIYGAQALGRDG
    VDKRMDVIATAMKANLTVLDLPDLELSYAPPYSSAKDPVNMVGYAASNIVDGFVETVQWHEIDHIVENGGYLIDVREPNE
    LKQGMIKGSINIPLDELRDRLDEVPVDKEIYIT
    CQLGMRGYVAARMLMEKGYKVKNVDGGFKLYGTVVPERVVY

    >gi|217958363|ref|YP_002336911.1| rhodanese domain protein [Bacillus cereus AH187]
    MSIKVDMSLDCKGLACPMPIVKTKKAIEGLASGQVIEIKATDKGSTVDIQSWANKVGHQYIGTKQEGDVLMHYIRKAHEH
    EVNEVAKYPHTITNTELEEILLSDEECIVLDVREAAEFAFGHIPSAISVPLGELDSAVLDQTKQIYVV
    CRTGNRSDVACH
    MLKEKGYENVKNVIPGMLEWQGNIKN

    >gi|217958364|ref|YP_002336912.1| metallo-beta-lactamase family protein [Bacillus cereus AH187]
    MSVKSLQAKDVAEKVLFGELFILDVRNETDYEDWKIEGKQISSINKPYFDLLDGVDHIVSELPKDKDVLVVCAKEGSSIF
    VAEQLTEAGLENIYYLAGGMKAWSEYVKPVKVGDLKNGGSMYQFNRLGKGCLSYMVVSNGEAAVIDAVRTVEAYEEFAKE
    HAVTITNVMDTHLHADHISGGRKLAEKVGGTYWLPPKDAEEVVFSYEPLVEGSVITVGGTKIEIDALYSPGHTIGSTSFI
    VDDSYLLSGDILFVDSIGRPDLAGKAEDWVSDLRNTLYSRYKELSQSLIVLPAHYSKISEMDESGIVSAKLKDLFEHNAG
    LNIEDEGEFRKVVTENLPPQPNAYQEIRQTNMGQLNPNKDEEREMEIGPNRCAVHN

    >gi|217958367|ref|YP_002336915.1| rhodanese-domain protein [Bacillus cereus AH187]
    MDVKTILNIILIVLVSWFIISRFLPARGVKNISGKELKRMMGQNNKQFIDVRTAGEYRGNNIKGFRNIPLNELANKAQQL
    DKQKEVIVL
    CQSGMRSKQAAKVLKKLGFQHVINVSGGMNGL

    >gi|217958769|ref|YP_002337317.1| transcriptional regulator Spx [Bacillus cereus AH187]
    MVTLYSSPSCTSCRKAKLWLEENHIPYTERNIFSDPLTIEEIKEILRMTESGTDEIISTRSKVFQELNVNLESLPLQDLY
    KMIRDYPGILRRPIMIDEKRLQVGYNEDEIRRFLPRTVRTFQLREAQRLVN

    >gi|217958825|ref|YP_002337373.1| thioredoxin [Bacillus cereus AH187]
    MALHFSKGINIFSKSGVTMKKMILFSLVIISILSGIFFVQKGNKNQELEVSKIQDGNYYQNSISIKQLKADLINNEKHVI
    YFYKEG
    CLYCEQVSPIIVPMAKDKNIPMKVINLGEYPIEEWDNFRIEAVPTIVEYRNGKEKNRIEGAHSETSYKEWFNII
    R

    >gi|217958832|ref|YP_002337380.1| pyridine nucleotide-disulfide oxidoreductase, class I [Bacillus cereus AH187]
    MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKMFRDKYGIDAKVRHEV
    TKVDTEKKMVYAEHTKTKDIFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGA
    IGLEMAETFVELGKKVRMIERNDHIGTIYDADMAEYIHKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLV
    SVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRA
    FKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDK
    RIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE

    >gi|217959049|ref|YP_002337597.1| thiol-disulfide oxidoreductase [Bacillus cereus AH187]
    MKKNRLLFRVIILLILCGAVGFTLYQGCFSKEEKMEIGKEAPNFVVTDLEEKKIELKDFKGKGVFLNFWGTWCKPCEKEM
    PYMNELYPKYKEKGVEIIALDADETDIAVKNFVKQYDLKFPVAIDKGGEIIKTYGVIPLPTSFLIDKDGKVIQEIKGEQT
    KEQLEEYLKKITP

    >gi|217959157|ref|YP_002337705.1| rhodanese-like domain protein [Bacillus cereus AH187]
    MLVTVEWLREHIEDENVRIIDCRFDLANPNWGREKYEEEHIPHALYFDLNVDLSSPITEHGGRHPLPNIEEFADKLSRAG
    IDEHTTVIAYDSEAGANASRLWWLLNYVGHEKVYILDGGFPAWKENGLPVTTEISVAKRKAFKANVQNHMLVTMETVREN
    IYAGADVTLIDSREPKRYAGVEELVDPKAGHIPTAVNYFWKDGMLQSGQFKNEAQQQERFQNLSKDKETIVY
    CGSGVTAC
    PNIVALKLAGFQNVKLYAGSWSDWISYPENQIAKEED

    >gi|217959311|ref|YP_002337859.1| thioredoxin family protein [Bacillus cereus AH187]
    MKKLIAIILAGALIWAGVNFYNAKKEEKERKAKQAELQKTEVLPQVGFKAPDITLKGLDGKLYSLNDAKGKPYLINFWAS
    W
    CGPCEMEAPDLVHMYDKYKKDVEIFAVNATIGDPVQEASAFADRHGFQFPVLLDMDGVAGLDYKVFSLPTTFFVNKDGI
    IVEQVRGVLPPDQLEEKFKKLIES

    >gi|217959370|ref|YP_002337918.1| peptide methionine sulfoxide reductase [Bacillus cereus AH187]
    MSEKTYELATFAGGCFWCMVKPFDELPGIHKVLSGYAGGHVENPTYEQVKAGTSGHLEVVQITFDPSIFPYEKLLDLYWP
    QIDPTDDGGQFFDRGPSYRTAIFYHTETQKELAEKSKQTLAESGMFKEPIVTEIRPAAPFYEAEEYHQHFYKKNPEKYAT
    EQKESGRADFIKENWQKK

    >gi|217959395|ref|YP_002337943.1| hypothetical protein BCAH187_A1989 [Bacillus cereus AH187]
    MATTKPYRVLLYYMYTTIENPEEFAAEHLAFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRFDGIVFKID
    EADGHAFKKMHVRPRPELVTLRLEDDINPHEITGKYLEPKDFYEAMKQEDTVIIDARNDYEFDLGHFKGAIKPDIESFRE
    LPDWIRENKEVLEGKKILTY
    CTGGIRCEKFSGWLVREGYEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQ
    KEHVIVGKDHFTGEPCERYVNCSNPECNKKILCSEENEAKYLRACSHECRVSPRNRYVIQHELTEEQVAAALEKIEAGK

    >gi|217959426|ref|YP_002337976.1| 2-hydroxychromene-2-carboxylate isomerase family protein [Bacillus cereus AH187]
    MTVKMKVYSDFICPFCFLAKGPLDEVAKEKDVEIEWMPFELRPSPYSKIDPWNEPEKLGSWDAFILPTAKKLGIDMRLPR
    VSPHPYTHLAFEGCQFAKERGLGNEYHHRVFTAFFQEEQNIEDIDVLTKLAVEVGLPEAEFKDALVTRKYKEKHQEAIQH
    AHDEANIMAVPTVMIGDEIIQGLASKETLQRVIDKEIEKDKTNSFEGMQCNTDGYC

    >gi|217959541|ref|YP_002338093.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus AH187]
    MYQAYYESELGLLEITANDKGITSVIFVDERQEEHKNEMIDQCINELDEYFKGNRKEFAVPLSPEGTAFQKNVWDALYTI
    PYGVSASYLDIAEKVGNTKAVRAIGGANSRNPISIIVP
    CHRVIGKSGKLVGYAGGLWRKEWLLKHEGILK

    >gi|217959672|ref|YP_002338224.1| glutathione peroxidase [Bacillus cereus AH187]
    MTIYDFSAKTITGEEKSLKDYEGKALLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILGFPCNQFGGQEPGTEADITSF
    CELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMKAVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE


    >gi|217959682|ref|YP_002338234.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus AH187]
    MQERYSRQVLFSGIGEMGQRKIREKQVLLIGAGALGAANAEALARMGIGKLTIADRDYVEWSNLQRQQLYTEEDAKQCKP
    KAIAAAEHVRKINSEVEIVPVVMDVTMQEIEELTKEVDLIIDATDNFDTRLLINDISQKENIPWIYGGCVGSYGVTYTIL
    PGKTPCFRCLMDHPMGGAT
    CDTAGIIQPAVQMIVAHQVTEAMKILVDDFETLRGTMLSFDIWNNQFLSLKVNKQKKSTCP
    SCGNTRTYPSLTFESQVKTEVLCGRNTVQIRPGIKRVLNLNEIQKRLQKIVHVQKTPYLLSFLIDEYRFVLFTDGRAFIH
    GTNDVKIAKRLYAKYIG

    >gi|217959820|ref|YP_002338372.1| thioredoxin family protein [Bacillus cereus AH187]
    MKEIKSEQEFKDIIASEEPVVVKFFTTWCPDCVRMDNFIGDVMEEFNKFEWYSINKDEFPSIAEEYQVMGIPSLLVYQNG
    EKLGHLHSANAKTEEQVTEFLEAY

    >gi|217959946|ref|YP_002338502.1| hypothetical protein BCAH187_A2550 [Bacillus cereus AH187]
    MKKFDVAIVGGGLAGLTASIYLAKAGRKVIVLEKSSRFGGRGMTINKNGICMNLGAHALYRGGAAFLTFNELGMNLPGGI
    PSTKAHGIWKGDIFTIPTDFRSILSTPLLSWSAKVQFSRLMIRLGNLDVRKVQKVSLTTWAENEIKDPMVRNIFYALCRT
    TTYTFAPTIQLASSVLKQIQLSIKDGVFYVDGGWETIITKLRDIANHAGVQFLDKKQVLEIEHYEDKQRIYCFDDEVFEV
    GTVIVTTPPKEACNIIKGVEGTSLHRWSKQSVPVTVAALDIGLRRLPNPTHQFALGLDQPIFFTNQSRAAKLSDDGSITV
    SLIKYHNPVLEMKQTHEDKEQLESTMDLLHPNWKREAVAQQYLPKITVVYDFPHINRVEKPGPNIPEMPGIYVAGDWTGH
    DEILADAAVASGKRAALHILKQLESEGVHHGNGAII

    >gi|217960212|ref|YP_002338772.1| dihydrolipoamide dehydrogenase [Bacillus cereus AH187]
    MSKLVVIGGGPAGYVAAITAAQNGKDVTLIDEADLGGTCLNVGCMPTKSLLESAEVHDIVRKANHYGVILNNGSISIDWK
    QMQARKSQIVTQLVQGIQYLMKKNKIKVIQGKANFETDHRVRVIYGDKEDVVDGEQFIIAAGSEPTALPFAPFDGKWILN
    SSHAMSIDYIPKSLLIVGGGVIGCEFASIYSRLGTKVTIVEMAPQLLPGEDEDIAHILRGKLENDGVEIFTGAALKGLNN
    YKKQASFEYEGSIEEVNPEFVLVSVGRKPRVQQLDLEKAGIQYSNKGISVNEHMQTNVSHIYAAGDVIGGIQLAHVAFHE
    GTTAALHASGEDVKVNYHAVPRCIYTAPEIASVGLTEKDAREKYGDIQIGEFPFTANGKALIIGEQTGKVKVIVEPKYQE
    IVGISIIGPHATELIGQGTVMIHTEVTADIMRDYIAAHPTLSEAIHEALLQAVGHAVHA

    >gi|217960270|ref|YP_002338830.1| carboxymuconolactone decarboxylase [Bacillus cereus AH187]
    MEQEQHHSSVNDVLHHYKEGIGSFTNQIPEIAETYNAFTQACFQEGSLTKREKQLIALGISLATQDEYCTVYHTKGCLDQ
    GCSDKEILEACGVSAAFAGGAAMSQAVTLVQECLTELKNQKH

    >gi|217960814|ref|YP_002339378.1| transcriptional regulator Spx [Bacillus cereus AH187]
    MVVLYTTASCGSCRKAKAWLEENQIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIDELSLNEFY
    QLIIEHPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN

    >gi|217960907|ref|YP_002339473.1| hypothetical protein BCAH187_A3529 [Bacillus cereus AH187]
    MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYA
    GHQFGHFNMLGDGRALLIGEQMTPAGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTT
    GEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEDHENRYTALLQEVIKRQASLIAKW
    QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEAL
    KIAQDEISKFSVQYENQWFLGMKKKLGLFSNEEQDQSLIEQLLKMMEKFKADYTNTFRSLTLNTLENTPLFDSPEFKEWY
    KLWQSRLEKQDESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTSGDYSVMEKLLEALANPYAYTTDQEEYCVPPAPTNR
    PYRTF
    CGT

    >gi|217960967|ref|YP_002339535.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus AH187]
    MAERYSRQHLFKPIGSRGQEKIRNKHVLIVGVGALGSASAESFVRAGIGKLTIIDRDYVEWSNLQRQQLYSEQDAREKLP
    KAIAAKNRLEKLNAEVQIHAFVMDACVENLEELLENVDVIIDATDNFDIRFIINDLSQKHNIPWVYGSCVGSYGMSCTII
    PQETPCLHCVLKNVPVTGVT
    CDTAGIISPTVQIVAAYQVAEALKILVEDFAAIRKTFFMFDIWSNQNHFIKLGKIKTDAC
    LSCGLNRTYPYLSYENQTKVAALCGRNTVQIRSVDNRKYNFDDIEKVLKKVGEVNRNPYLLSCQLDEYRIVVFRDGRVFI
    HGTNDISKAKQLYYCVFG

    >gi|217961013|ref|YP_002339581.1| ahpC/TSA family protein [Bacillus cereus AH187]
    MWRKLTIIVVLLCLAGYAAYEQFGKNDQVVQGEQTKSEAAMKEMIASNGIEIGKSAPDFELTKLDGTNVKLSDLKGKKAI
    LNFWATW
    CGPCQQEMPDMEAFYKEHKENVEILAINYTPSEKGGGIEKVSNFAKEKGITFPILLDKNIDVTTAYKVITIPT
    SYFIDTKGVIQDKFIGPMTQKEMEKRIAKLK

    >gi|217961153|ref|YP_002339721.1| heavy metal-transporting ATPase [Bacillus cereus AH187]
    MNEQKEANLQISGMTCAACANRIEKGLKKVEGVHDANVNFALEKTKIIYDPQKTNPQQFKEKVESLGYGIVSDKAEFTVS
    GMT
    CAACANRVEKRLNKLEGVNGATVNFALESATVDFNPDEINVNEMKSAITKLGYKLEVKSAEQDGSTDHRLQEIERQK
    KKFIISFILSFPLLWAMVSHFSFTSFIYLPDMLMNPWVQLALATPVQFIIGGQFYVGAYKALRNKSANMDVLVALGTSAA
    YFYSVYLSVQSIGSSEHMTDLYFETSAVLITLIILGKLFEAKAKGRSSEAIKKLMGLQAKTATVVRDGTEMKILIEEVVA
    GDIVYVKPGEKIPVDGEIVEGKSAIDESMLTGESIPVDKTIGDVVIGSTMNKNGFLKVKATKVGRDTALAQIIKVVEEAQ
    GSKAPIQRVADQISGIFVPVVVVIAIITFAVWMIFVTPGDFGGALEKMIAVLVIACPCALGLATPTSIMAGSGRSAEYGI
    LFKGGEHLEATHRLDTVILDKTGTVTNGKPVLTDVIVADGFNEEEILRLVGAAEKNSEHPLAEAIVEGIKEKKIDIPSSE
    TFEAIPGFGIESVVEGKQLFIGTRRLMKKFNIDIEEVSKSMEELEREGKTAMLIAINKEYAGIVAVADTVKDTSKAAITR
    LKKMGLDVVMITGDNTQTAQAIAGQVGIEHVIAEVLPEGKAEEVKKLQAQGKKVAMVGDGINDAPALATADIGMAIGTGT
    DVAMEAADITLIRGDLNSIADAIFMSKMTIRNIKQNLFWALAYNGLGIPIAAFGFLAPWVAGAAMAFSSVSVVLNALRLQ
    RVKLK

    >gi|217961154|ref|YP_002339722.1| copper-ion-binding protein [Bacillus cereus AH187]
    MEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSAVTLKDIVAVIEDQGYDVQ

    >gi|217961163|ref|YP_002339731.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus AH187]
    MNSYKNNYIYWTLLTHANWKFHIAATETGLCFIGSQNETFEEVNIWARKKLPQHILIHSPDYLQVYTKEIIEYLENKRET
    FTSPIAAYGTAFQLSVWSTVREIPYGKTYSYTEIADRIQKPTAVRAVASAIAANPILIMIP
    CHRVIGKNGKLTGFRGGLE
    MKKELLALEKLQVEFI

    >gi|217961455|ref|YP_002340023.1| dihydrolipoamide dehydrogenase [Bacillus cereus AH187]
    MVVGDFPIELDTVVVGAGPGGYVAAIRAAQLGQKVAIIEKANLGGVCLNVGCIPSKALINAGHRYENAMHSDDMGITAEN
    VKVDFTKVQEWKNGVVKKLTGGVEGLLKGNKVEIIRGEAYFVDANTLRVMTEDAAQTYTFKNAVLATGSTPIEIPGFKYS
    KRVINSTGALSLPEIPKKLVVIGGGYIGMELGTAYANFGTEVTVVEAGDEILAGFEKAMSSVVKRALQKKGNVTIHTKAM
    AKGVEETETGVKVSFEVKGEIQTVEADYVLVTVGRRPNTQEIGLEQVGVKMTDRGIIEIDEQCRTNVPNIYAIGDIVPGP
    PLAHKASYEGKVAVEAISGHASAIDYIGIPAVCFTDPELASVGYTKKQAEEAGMTVTVSKFPFAANGRALSLNSTDGFLQ
    LVTRKEDGLLVGAQVAGAGASDIISEIGLAIEAGMTAEDIAQTIHAHPTLGEITMEAAEVALGMPIHIVK

    >gi|217961475|ref|YP_002340043.1| glutaredoxin family protein [Bacillus cereus AH187]
    MKKIEVYTQPDCPPCVIVKEFLKHNNVVYEEFDVKKDAAARNRLLYDYDSYSTPTVVIDGEVVAGFQIEKLQQLLNIE

    >gi|217961616|ref|YP_002340186.1| Na+/H+ antiporter NhaC [Bacillus cereus AH187]
    MVSKIESVLLTFFIFFCIGFSVIKLEVSPHIPILFGIVLLLAFGFMKKIDWSTMEKGMISSISAGIPSIFIFLLVGVLIS
    VWIAAGTIPTLMVYGFQLVSPKIFIPTVFVV
    CAIVGTSIGSAFTTAATVGLAFMGMGSALGYDPALIAGAIISGAFFGDK
    MSPLSDTTNLAPAVTGVDLFEHIRNMLWTTVPAFIIAFIAFFILGSGTSGDVDFTNFISTLEKNATISIFTLIPILLLFL
    FAFKKVPAVPTLLAGIIVGIIILFIFKPSTSLTDLMKIMQDGYVSKTGMKDIDSLLSRGGLQSMMMSIALIFLALCMGGL
    LQGMGIITQLMNIISSFVKTSTRLIISTASTAIGVNFLLGEQYLSIVLTGQAFANKYDEVGLERRNLSRVLEDAGTVINP
    LVPWGVSGVFLSNVLGVPTFDYVPFAIFCLACPVVTIIVGFTGFGLSWKKEKAVTLS

    >gi|217961653|ref|YP_002340223.1| dihydrolipoamide dehydrogenase [Bacillus cereus AH187]
    MAKEYDLVIVGGGTGGYVAAIRASQLGLKTALVEKENLGGTCLHKGCIPSKALLRSAEVYATAKKSEEFGVIASNVELNF
    AKVQERKEKIVTQLHKGVQHLMKQGKIDVFEGIGRILGPSIFSPMPGTISVELASGEENEMLIPKNVLIATGSRPNSLPG
    LELDGEYVMSSDHALKMETLPSSIIIVGGGVIGIEWASMLADFGVEVTVLEYAKTILPLEDQDVSKEMQRLFKKKGIKVV
    TGAKVLPETLVKDNGVTIQAEHNGENKEFKAEKMLVSVGRQANTQNIGLENTDIVVEKGYIQTNEFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIVAVEHIAGKEVTPIDYSMVSKCVYSSPEVASVGLTEQEAKEKGYKLKVGKFSFRAIGKALVYGES
    DGFVKLVVDEETNDILGVHMIGPHVTDMISEAGLARVLDATPWEVAHTIHPHPSLSEAIGEAALAVDGKALHA

    >gi|217961700|ref|YP_002340270.1| rhodanese-like domain protein [Bacillus cereus AH187]
    MSTTWIILLAVIVAFIGYTVWMYFYQKKLITTLSEEEFRAGYRKAQLIDIREADEYTAGHILGARNIPLSQIRLRHKELR
    KDQPVYLY
    CQSGFRTGRAAQYLKKQGYKDFYQLQGGFKTWTGKIKKK

    >gi|217961960|ref|YP_002340530.1| organic hydroperoxide resistance protein [Bacillus cereus AH187]
    MDKLYTASVTATGGRNGKVVSDDGILNLDVKMPKALGGAGGEATNPEQLFAAGYAACFDSALQLVIRTKRVKVESTEVTA
    HVSIGKDTDGGFGLSAVLDVHVAGVSHSEAQELVEAAHGV
    CPYSKATRGNIEVTLNVH

    >gi|217962004|ref|YP_002340574.1| thioredoxin [Bacillus cereus AH187]
    MAIVNANDQSFAAETSEGVVLLDFWAPWCGPCKMIAPVLEEIDAELGEKVKVVKVDVDENQETARQFEVMSIPALFVLKD
    GKVVDQALGYKPKEALVELVSKHF

    >gi|217962127|ref|YP_002340697.1| thiol peroxidase [Bacillus cereus AH187]
    MANVTFKGNPMTLVGTEVKVGDQAPNFQVLANDLSPVSLETYKGEVKLISVVPSIDTGVCDAQTRRFNQDAAGIENAKVL
    TISADLPFAQKRWCAANGLENVVTLSDHRDLSFGEAYGLVMKELRLLARAVFVVDSNDKVVYVEYVSEGTSHPNYEAALE
    AAKAAK

    >gi|217962180|ref|YP_002340750.1| thioredoxin family protein [Bacillus cereus AH187]
    MKSLESMEQFQELKNEENVIFMFSAEWCPDCRFVDPFMPEVEEKYSDFSFYYVDRDEFIDLCVKLDVFGIPSFVAYNKGE
    ETGRYVNKDRKTQEQIEEFIEGLK

    >gi|217962196|ref|YP_002340766.1| conserved hypothetical protein TIGR00275 [Bacillus cereus AH187]
    MHYDVIVIGGGPSGLMAAIGAAEEGASVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNN
    EDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVVLKTGEVLETNHVV
    IAVGGKSVPQTGSTGDGYAWAEKAGHTITELFPTEVPILSNEPFIRDRSLQGLALRDVNLSVLNPKGKAIISHKMDMLFT
    HFGLSGPAALRCSQFVVKALKKFKTNTVQMSIDTLPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLEKNE
    IDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYN
    ITSALVTGRIAGTTAGENAKMQY

    >gi|217962213|ref|YP_002340783.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus AH187]
    MQERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKVTIADRDYVEWSNLQRQQLYTEEDAKQYKP
    KAVAAAEHLKAINSEVEINPVVTDVTVQEMEELVKGVDLILDATDNFETRLLINDISQKYNIPWIYGGCVGSYGVTYTIV
    PGKTPCFRCLMEHPASGAT
    CDTAGIIQPAVQLVVAHQITEALKILVEDYGALRETMLSFDLWNNQQMAFKVNRQKKETCL
    SCGRLRTYPSLTFEAQTKTEVLCGRNTVQIRPGVRNEFNLEEIKKRLQRSVDVKATPYLVSFLVEEFRFVLFTDGRAFIH
    GTNDINVAKRLYTRYIG

    >gi|217962218|ref|YP_002340788.1| rhodanese-like domain protein [Bacillus cereus AH187]
    MTEVKTITTEEVQERLENGETLFLVDVREDEEVAAGKIPEAVHIKMGDIPNKVDFFDKENEYIFICRSGMRSENVCHYLN
    EQGFKTVNMVGGMLQYEGEIK

    >gi|217962263|ref|YP_002340833.1| hypothetical protein BCAH187_A4911 [Bacillus cereus AH187]
    MYVTVTEAAYKKIVDTIPNEAKYIKLFYDNEGCGCVMSGIIDLVAVAEKDERDVDIESSQFSFIADRTKLVFMDDKLTVD
    WHEGGGTFQLKSPSQFYNPNMKLHVRV

    >gi|217962401|ref|YP_002340973.1| hesB/yadR/yfhF family protein [Bacillus cereus AH187]
    MIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEVEPKEDDTVLEFFGVEFVIDKESAPIVKGVKIDYK
    QSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC

    >gi|217962404|ref|YP_002340976.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus AH187]
    MKHLVILGGGYGGMRILQRLLPSNQLPDDVQVTLIDKVPYHCFKTEYYALVAGTISETHIRIPFPEHPRLNIQYGTVTNI
    DLEEKAVHLDGGEAIQYDDLIIGLGCEDKYHNVPGAKEYTHSLQSIEQTRKTYEQLNSLEPNATVAVVGAGLSGVEVASE
    LRESRSDLKIYLFDRKDRILFPYPEKLSRYVEEWFVKHKVTIIRNSNITKVEPNIVYNHDEPLECDAIVWTAGIQANEVV
    RNLPVEQDGSGRVVLTKYHNIPNNEHVYVVGDCAALPHAPSAQLAEGQGEQIVQILLKRWHNEPLPDELPVIKLKGVLGS
    LGKKHGFGLLANQPLMGRVPRLLKSGILWMYKYHNG

    >gi|217962453|ref|YP_002341025.1| putative thioredoxin [Bacillus cereus AH187]
    MIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEDLKIGMLDLNYAPHFAKEYGIESVPCLLVFENGT
    LMKKIYAFHSVEYLYTELK

    >gi|217962456|ref|YP_002341028.1| hypothetical protein BCAH187_A5134 [Bacillus cereus AH187]
    MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASED
    EMYELLASDGMLIKRPIVTDGTKVTLGFNEEQFESVWKKYQ

    >gi|217962610|ref|YP_002341182.1| glutaredoxin family protein [Bacillus cereus AH187]
    MKVVLYTKNDCGLCVKAKQVLQEVQCEYSFQIEEIDIYEDNDLLEKYHLMIPVVEIDGKQVEYGNIHKGVIINYIKNAVK
    S

    >gi|217962638|ref|YP_002341210.1| thioredoxin-disulfide reductase [Bacillus cereus AH187]
    MSEEKIYDVIIIGAGPAGMTAAVYTSRANLSTLMLERGIPGGQMANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYA
    YGDVKEVIDGKEYKTIIAGKKEYKARAIIVASGAEYKKIGVPGETELGGRGVSY
    CAVCDGAFFKGKELVVIGGGDSAVEE
    GVFLTRFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEANGKVGSVTLVDVNSGEEKEVKTDGVFVYIG
    MLPLSKPFVELGITNENGYLETNERMETKVPGIFAAGDVREKMLRQIVTATGDGSIAAQSAQHYVEELLEELKTVSEK

    >gi|217962927|ref|YP_002341505.1| peptide methionine sulfoxide reductase [Bacillus cereus AH187]
    MAVNEKVELATFAGGCFWCMVSPFEEMEGIIKVVSGYTGGHKENPTYKEVCSETTGHYEAVQITFDANKMPYEELLNIYW
    RQIDPTDVGGQFHDRGQSYETVIFYHNEEQHKKAEASKEELARSGRFSKPIATKILPATTFYPAEEYHQGYHKKNEFRYE
    LYRKGSGRDAFIKQHWPKDNAHLKEKLSEMQFYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSLDKFDSGCGWP
    SFTKPVMSASVKEKMDVSHNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRY
    CINSAALRFIPTEELEKEGYGDFLILFGNK
    K