Ralstonia pickettii 12J uid58737

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|187926087|ref|YP_001892432.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia pickettii 12J]
    MTQRFDAIIIGTGQAGPPLAARLSGAGLKVAIVERGRFGGTCVNTGCIPTKAMVASAYAARMAQRAAEYGVVIDGGVTVD
    MRRVKARKDEISGRSSHGVEQWVRGLEHGTVFQGHARFESARAVRVGDELLEAERIFINVGGRALVPPMPGLDQVPFLTN
    STMMDVDFLPEHLVVIGGSYVGLEFGQMFRRFGSRVTIVEKGPRLIAREDEDVSQAVREILEAEGIDVQVNADCLSVRRD
    GAGVVVGLECGSGAREVSGSHLLMAVGRVPNTDDLGLDKAGVEIDKRGNIRVDEQLRTNVPGIWAMGDCNGRGAFTHTSY
    NDYEIVAANLLDSDPRKVSDRIQAYAMYIDPPLARVGMSLTEAKQSGRTLLVGNRPMTRVGRAVEKGESQGFMRVVVDAQ
    THEILGASILGVGGDEAVHSILDVMYAKAPYTTISRAMHIHPTVSELIPTLLQSMEPEQ

    >gi|187926128|ref|YP_001892473.1| peroxiredoxin [Ralstonia pickettii 12J]
    MSLINTQVQPFKAQAFHNGKFIEVTDESLKGKWSVLIFMPAAFTFNCPTEVEDAADNYAEFQKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAQFPLVGDPTHALTNAFGVHIPEEGLALRGTFVIDPQGVIKTMEVHDNAIARDVKETLRKLKAAQFVAN
    NPGNVCPAKWNEGAKTIKPSLDLVGKI

    >gi|187926129|ref|YP_001892474.1| alkyl hydroperoxide reductase, F subunit [Ralstonia pickettii 12J]
    MLDADVKAQLKAYLERLVQPIELVANVDDSEGSRDMMDLLRDVAEQSSMIVLTEQRDAAERAPSFLIRRTGADVSVRFAA
    IPTGHEFTSLVLALLQVGGYAPKLEADVIEQIRNIEGDFRFETYMSLT
    CQNCPDVVQALNVMSVINPRIQHVAIDGALYQ
    GEIEARQIMAVPTVFLNGETFGTGRMGVEEILAKIDTGAAARDAEKLAAKEAFDVLIVGGGPAGAAAAVYAARKGVRTGV
    VAERFGGQVLDTLGIENFISVQETEGPKFAAALEQHVRQYDVDIMNTQRAVKLTPADKPGGFAEVTLANGAVLKGRSVIL
    STGARWRNVNVPGEQEYKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGLVSHVTLLEFASELKADAVLVRKL
    QSLPNATIVTNAQTTEITGDGQKVNGLRYKSRVDGVEHTVALEGVFVQIGLVPNTEWLDGALERNRFGEIVVDARGQTSA
    EGVFAAGDATTTPYKQIIIATGDGAKAALSAFDHLIRVPLAEAA

    >gi|187926763|ref|YP_001893108.1| alkylhydroperoxidase like protein, AhpD family [Ralstonia pickettii 12J]
    MSYIKTLAAVDQASAEGKQKEILDKARQQVGFIPNMYANMANAPAVLDTYLHGYGLFRGESGFSPAEQEVVFLAVSQVNG
    CNY
    CTAAHSMIADKMSGVPAPVLAAIRERQPIPDAKLAALFDLTQDIVRTLGMPNEGKVDAFLDAGYREQDVLYIILAVA
    VKVLSNYSNHAFGTEVDSRFSAYRVG

    >gi|187926769|ref|YP_001893114.1| Thioredoxin domain [Ralstonia pickettii 12J]
    MKILRTISGLALAVSASVAMAGEIKPYTPQAFDQLTHAGKPVIVDVSATWCPTCKAQRPIVENLMKQAAYLDVTVLAVDF
    DTNRAALKKFKVNMQSTLVAFKGTSEVGRSVGDTTPSGIEDLIRKTVH

    >gi|187926777|ref|YP_001893122.1| disulfide isomerase/thiol-disulfide oxidase [Ralstonia pickettii 12J]
    MNHSRKTFSLGPVSWLTAVALSTASVAAYSQEKPAALQALEKKGVTIVGKMAAPTGLTAYAGFMEEQPVALYVTPDGKHV
    IAGTVFDASGNDLTRAPLEEAVRKPMSERAWAELAHATWIADGRDSAPRKVYVFTDPN
    CPYCNKFWADARPWVDSGKVQL
    RHIMVGILTPTSAGKAAALLADKNPAAALNAYEQSHVSLNAKVLSSGHPKPLDDAGLKPVATIPAAVKGKLDANERLMAS
    LGFQATPAILWRDSDGALRMKQGVPASSLSEVLGPR

    >gi|187926891|ref|YP_001893236.1| Rhodanese domain protein [Ralstonia pickettii 12J]
    MHDLFPLLAEYGAFAVFLNVLLTQAGAPLPAVPTLLVGGALTLNGPLFFMELLPAAITGALLGDGLWYLAGKRYGRHVMA
    LLCRVSLSPDSCVRRTRTQFERWGAPLLLVSKFVPGLSTVSSALLGTMRTPFSTFVLYNLAGSALWAIIWLMLGRVAHDS
    IDQALRQLDLLGARAIVLILLLAVAYVTVRWLQRWRFRKMLEMVRISPDELHALIESGAAPVIVDVRADSSRQLQPQRIP
    GAVLYAMSSQHNAIEIDGPDREIVIY
    CACPNEASAVAVARTLMSRGFKRVRPLHGGIDAWIARGYGVEHVVPVTPATLQA
    AEARA

    >gi|187926910|ref|YP_001893255.1| OsmC family protein [Ralstonia pickettii 12J]
    MKTLYQTQVTAEGGRAGHVRSADGVLDLPLSLPRELGGAGGAATNPEQLFAAGYAACFENAVLHVARLKQIKLASTAVTA
    TVGIGPREDGGFALTVSLAATLGGVDQATAEALVMAAHGV
    CPYSHAVRGNIDVQLTTVTR

    >gi|187926969|ref|YP_001893314.1| OsmC family protein [Ralstonia pickettii 12J]
    MALNILYTAHATATGGRNGHTQTEDGQVSHNLSVPKSMGGPGKPDTTTPEDLFAAGYAACFGSACDFVAKSMLKLNPSNI
    EIHCDVGIGTRPEGGFGLKVGLTARISGLSHGDAEALVAKAHEV
    CPYSNATRNNVEVTLKTEVV

    >gi|187926975|ref|YP_001893320.1| heavy metal translocating P-type ATPase [Ralstonia pickettii 12J]
    MKPDHAPSLPSRDHAAKPETSGCGGCCVHYQLVATDTSRHAHDHDHNHAHEADAPVDAAARARASGRTTVRIEQMDCPTE
    ERMIRTKLGSAEGVVALEFNLLERHLTIHHTVDDVTPFLEALRAIGMGGEVLEAHDRAAAAPAEPAGISRRTWLLGAGGV
    AAFGAEVIAWSLGDHAWPVLALALASIALAGGPTLRKGWIALRALTFNINFLMAVAVIGALLIGKWAEAAMVIFLFAVAE
    AIEARALVRARDAVRALTAIAPDTAELADGNGGWRDVAVEAVGIGARLRVRTGSRVPVDARIVSGRAALDESPVTGESLP
    VEKTIGDIVLAGTIVTDGVIEAQATAVAADSTLARIAGAIQQAQAQRAPTQRFVDRFSSIYTPAMMVLALAVAVIGPLVT
    TEGWLAWTYRALVLLVIACPCALVISTPVTVVSGLAAAARRGIVVKGGVYLESGRRLRALALDKTGTLTTGRPVLDAVML
    PDGSRRAVAELHATTDAAHLRALAVAAALDANTTHPIAVAIVQAAAAHGAVAAGAIQDLSVLPGHGVAGTLGGVRWHLGN
    AALVADRGFDTSAWRAAADRLQAEGMSAVTLCDAGGAVALFGVRDRERPESAQAIADLRALGVLPVMITGDDRRAAQAIA
    RTVGIDQVRAEQLPEDKQRVVGELAAQHGSVGMVGDGINDAPALARADIGFAMGAAGTATALEAADVAIMDDDPRKLASF
    IRISRRTVAVLRQNIALALGIKAVFLALAVMGEATLWMAIFADVGASLLVVFNGLRVMRTRAA

    >gi|187926993|ref|YP_001893338.1| Glutathione S-transferase domain [Ralstonia pickettii 12J]
    MSIDTALPLLYSYRRCPYAMRARLAMLQARRPFQTFEIVMRDKPAELLALSPKGTVPVLRLTDGSVLEESWDIMRWALES
    PDADGWWSRAQSEDNLLLLNTNDGAFKRHLDRYKYPDRYPHEETTRETARANAVATLLTPLEARLQRQRYLGGRAPCATD
    LAIFPFVRQFAAVEPDWFDDQPLPALHAWLAQWLGSDLFAVCMTKRPVQIAAVFPTFQPIH

    >gi|187927137|ref|YP_001897624.1| alkylhydroperoxidase like protein, AhpD family [Ralstonia pickettii 12J]
    MSQAPRIAYFQLAPKAFNNLLNLSNGLRRDLLGARLVDLVLLRVSQINGCAFCIDMHWADLIKMGEDPRHLNAVAGWREA
    PFFTERERGAALRWAELVTNTPHSDASDEEFARLREHFSDEEIAELSFVIVTINSWNLLNVSLRNPVPLKAPHVAAA

    >gi|187927243|ref|YP_001897730.1| DSBA oxidoreductase [Ralstonia pickettii 12J]
    MKKLAAFLIALATGAGFLMTAPANAAPTAGKEYKVLQTPQPVPAGKIEVTEFFWYGCPHCYDFENTWTAWVAKQGKDVVI
    KRVPVAFNAKLEPHTRIYYTLEALGKLDAKDASGKTLHDRVFDQLHKNYRSMSELDDIAKFMAANGVDEKQFRDTYNSFS
    VNANTKRAAQLADQYKIEGVPTVVVQGKYTTSPADAGSNVGAAQTLDYLVDQVRNRKM

    >gi|187927270|ref|YP_001897757.1| glutathione peroxidase [Ralstonia pickettii 12J]
    MLFPATVSMRRPRLQLHASGVLRRHHLLMIAIAIAIAVIALLLPRTGHAVTAGVAPAAQTPTTPGACPASLNFRVKRLQD
    DAPQDLCQYAGRVVLVVNTASY
    CGYTHQYEGLEALYAKYRDKGLTVLGFPSNDFQQEPGNSKQIADFCYNTYGVKFPMFS
    KTAVVGAGASPLYAWLATQTGQPPKWNFHKYLLDRTGRVAAVFPSSVEPSDPALIKRIDALLAEPSTRSSR

    >gi|187927298|ref|YP_001897785.1| Redoxin domain protein [Ralstonia pickettii 12J]
    MASTLTSSAAPATATATSGGRRWLLPVIMLVLAVGGWFGWRAFSPSQQVPAATFTLLDGQKLSTQDLKGKVYLVNFWATS
    CATCIKEMPNMIQTYNKYKGEGLEYVAVAMSYDAPMYVMNFSQTRQLPFKVAMDADGSAAKAFGDVQLTPTTFLVDREGR
    ILKRYVGEPEWSSFDSLLKQALGKQA

    >gi|187927315|ref|YP_001897802.1| UBA/THIF-type NAD/FAD binding protein [Ralstonia pickettii 12J]
    MNDDQLLRYSRHILLDEIGIEGQTRLLESHALVIGAGGLGAAALPYLAAAGIGTLTIVDDDTVDLTNLQRQIIHTTESVG
    QPKVASAQAAIARLNPDVRVHAVQRRLDTDAIGARLDGVSVVLDCSDNFGTRQATNLACVRAGVPLVSGAAIRFDGQISV
    FDSRAGGPCYACLFPPDEPAPDVA
    CATMGVFSPLVGMVGTVQAAEALKLIAGIGSSLAGRLLMLDGLTMEWTTMRIARQP
    SCPVCGGMH

    >gi|187927318|ref|YP_001897805.1| Rhodanese domain protein [Ralstonia pickettii 12J]
    MKFFADYNNLALLAVAIVSGLLLLWAPIQRRIAGGGGAKVGASAATQLINRRNAVVVDVRENAEYAAGHLPQAKHAPLGE
    LAGKAAGLAKNKETPIILV
    CQTGQRAGRAQAVLKQAGYSEVYSLEGGLAAWQQAGLPVVK

    >gi|187927319|ref|YP_001897806.1| glutaredoxin 3 [Ralstonia pickettii 12J]
    MAHVVMYSTTVCPYCVAAERLLKQRGVEQIEKILIDREPGKREEMMTRTNRRTVPQIYIDERHIGGFDDLSALDREGGLV
    PLLAA

    >gi|187927336|ref|YP_001897823.1| electron transport protein SCO1/SenC [Ralstonia pickettii 12J]
    MTMLSFRYFRAALFAMLAVAVLALAACSDKPAFKNLDITGSKSFGTDFSLTDHTGKRRTLEDFRGKVVVMFFGYTHCPDV
    CPTTLAELRAVMDTLGKDADRVQVLFVTVDPERDTQDLLAKYVPAFDPRFIGLRPANETELKKVASDFKVFYSKVPGSSP
    DNYTMDHTAGSYMFDPKGNLRLFIKHGQGPEPIAHDIKQLLAD

    >gi|187927339|ref|YP_001897826.1| OsmC family protein [Ralstonia pickettii 12J]
    MSIVVSKDTEGLFRHKVTFPEGVTYTDVPKPTGEGSAPDPHAYFDAALASCKALTVTLYARQRKYPLDSIDVAVEHDGTQ
    ERQGRYRLRTVLTLHGNLTDEQRADLLRVAGK
    CPVHKLMTEVEISVDTELAEHA

    >gi|187927403|ref|YP_001897890.1| cytochrome c biogenesis protein transmembrane region [Ralstonia pickettii 12J]
    MTLFIISFLGGALTVLAPCILPVIPFVFARVDQPFVKSGLPMLVGMASTFAAVGTLGAAAGSWAVEANEYGRIAATALLG
    LMGAAMVFPRLAERLTRPLVSVGLDLSNAANAHTAMAGNCVLPSFIRGVATGLLWAPCAGPILGLILTGAVLQGPNVKTS
    LLLLAYGAGAVSSLALVLLAGHRIFAAMKRSLGIGEWFRKGLGITVLSGAVVVMTGVDTGWLAQVSSGSVEASVEKMLLQ
    HFAPRQTGKMPIVDGQQQAKRNAPGGRLILVQAQQNRQPLNLPVEGLFPPLTGAVDWLNSPPLTVEALRGKVVLVNFWTF
    G
    CINCRNVLPYVREWDRKYKDQGLVVVSVHAPEFAYEKNIENVKRAASELGATFPIAIDNRFEIWKAFNNNYWPANYFID
    SQGRIRFHHFGEGEYEKSERVIQQLLKEARVGDRPVPMTETTLETLNAALALQRAGDFVAAGVGAG

    >gi|187927417|ref|YP_001897904.1| protein of unknown function DUF395 YeeE/YedE [Ralstonia pickettii 12J]
    MSIDFTHFTPGAALVGGLIIGLAAAVLVLGTGRIAGISGIVGGLLLRPRGDMDWRIAFLIGLMGAPVVAALLGHPVVPEI
    AAGWGEVLAAGFLVGIGTRYAGG
    CTSGHGVCGLSRGSVRSLVATLSFVTAGIVTVFVVRHVFGG

    >gi|187927468|ref|YP_001897955.1| OsmC family protein [Ralstonia pickettii 12J]
    MDCTVSWTGPDGMAFLAETGSGHLVTMDGAPDGGGRNLAPRPMEMVLLGTGGCTAYDVVLILKRGRQDVQGCSVKLHADR
    AETDPKVFTRIHFTFTVTGRNLKRETVERAVQLSHEKYCSASIMLAKTAEITHSLELVDLATQPTASE

    >gi|187927473|ref|YP_001897960.1| iron-sulfur cluster assembly accessory protein [Ralstonia pickettii 12J]
    MNAVAQAATPDVNEVPAPLVFTDSAADKVKQLIEEEGNPELKLRVFVQGGGCSGFQYGFTFDEETNEDDTTMTKNGVSLL
    IDSMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV

    >gi|187927742|ref|YP_001898229.1| Rhodanese domain protein [Ralstonia pickettii 12J]
    MQQLAPTALAQWLADASRAKPVLLDVRWTEEVEICAIPGITHIPMDQIPGRASELNADQDIVCICHHGGRSAQVAQYLIT
    QGGFDAARVYNLQGGVHAWAHQVDPQMATY

    >gi|187927800|ref|YP_001898287.1| Peroxidase [Ralstonia pickettii 12J]
    MSLRLGDIAPDFEQDSSEGRIKFHEWLGNSWGVLFSHPADYTPVCTTELGLTAKLKDEFAKRNVKAIALSVDSVESHKGW
    INDINETQNTSVNFPIIADPDRKVSQLYDMIHPNASETFTVRSLFVIDPNKKIRLTITYPASTGRNFNEVLRVIDSLQLT
    EYHSVATPGNWQDGDDVVIVPSLKDEEVIKQKFPKGYKALRPYLRLTPQPNK

    >gi|187927810|ref|YP_001898297.1| peptide methionine sulfoxide reductase [Ralstonia pickettii 12J]
    MTEQRALETAVLGGGCFWCLEAVFQQVQGVHSVVSGYAGGHVDRPSYRAVCNGNTGHAEVVAVKFDPAVIPYREILDIFF
    AIHDPTTVDRQGNDVGPQYRSAIFAQTPEQLATARTAIAELGASDIFEAPIVTELVDAADGKVTFWRAEDEHQNYFRDHP
    AQGYCAFVISPKVAKFRKQFAHRLQG

    >gi|187927822|ref|YP_001898309.1| thioredoxin [Ralstonia pickettii 12J]
    MSDITSQNFAQEVIETSRQIPVLVDFWAPWCGPCRTLGPMLEKLEAEFAGKWKLAKINSDENPELSAQFHVRSIPYVVAF
    VDGKPVDQFVGVLPEAQLRAFLDRVIPQPAEVAYREGLAASQAGETAHAREAFQNALAFDPGFDAARFALVNLLLDSGDV
    HAAQDEFALLSPKAPQDERYAPLETRLRATERADTLPDAGALRTVVEAQPDNLQARLDLAQQYIAAQDYEAALEQLLAIV
    ERDRAFRDDIARKTMVSVFDMMRDAPQAVSHWRRQLASKLN

    >gi|187927981|ref|YP_001898468.1| iron-sulfur cluster assembly protein IscA [Ralstonia pickettii 12J]
    MITLTDKAAQHVSRYLTRRGKGVGLRVGVKTTGCSGLAYKLEYADEIATEDQVFESNGVKVIVDPKSLPYIDGTELDYAR
    EGLNEGFRFNNPNVKDECGCGESFRV

    >gi|187928019|ref|YP_001898506.1| glutaredoxin 2 [Ralstonia pickettii 12J]
    MIQLTLYGRTYCHLCEDMKNALELLRRGFSFVLHEVDVDSDPALEARFDELVPVLMTGAPETSPEDARELCHYFLDVPAV
    QAWLAAQTAHN

    >gi|187928074|ref|YP_001898561.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia pickettii 12J]
    MTSAATLNADSPQPVEQRTDVLVVGAGPVGLFAAFQAGVLGMSCVLVDALDRPGGQCTELYPEKPIYDIPALVSCTAQEL
    VDRLMAQCAPFNYPILCGRRAETVETLENEHGRRFRVTTSAGDVFDCAAVLITAGNGAFTPQRVALPEAAALEGRHLHYA
    VRDTARFTGKRVVIAGGGDSALDWALALRKVAARVTLVHRREGFRAADASVAEMRAAVVAGEMDFVLGMLSRLDSTPDGT
    LIGAAIRGRDGETVLPCDELIALYGLVSEPGPIVNWGVEMRAGRITVETTAYETSRPGVFAAGDIALYPNKQKLILSGFH
    EVAMALRRAYRYANPDKTLVHTHSSNDAGLQTKLHVTAE

    >gi|187928125|ref|YP_001898612.1| thioredoxin [Ralstonia pickettii 12J]
    MSEQIKYVSDASFEADVLKSDKPVLVDFWAEWCGPCKMIAPILDEVSKDYGEKVQIAKINVDENQGVPAKFGIRGIPTLI
    LFKNGAVAAQKVGALSKSQLTAFLDSHL

    >gi|187928192|ref|YP_001898679.1| dihydrolipoamide dehydrogenase [Ralstonia pickettii 12J]
    MSKEFDVLVIGAGPGGYIAAIRAGQLGLNVACCEDNPYDDPKGEPRLGGTCLNVGCIPSKALLASSEEFENVNHHLADHG
    ITVDGVKVDVAKMLKRKDDIVGKMTKGIEFLFRKNKVTLLKGHGKFVGKTDAGYQVEIAGKAGTEVVTAKHVIIATGSKA
    RHLPGVKVDNVTIADNEGALKFGEVPKKLGVIGAGVIGLELGSVWRRLGAEVTILEALPSFLGAADESVAKEANKLLTKQ
    GLKINVGVKVGEIESSAKGVKVNYTDAAGAAQVLECDKLIVSIGRVPNTDNLGLEAIGLAADQRGFIEVDDHCATKLPNL
    WAIGDVVRGPMLAHKAEDEGVAVAERIVGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGRETKAGQFPFLANGRAL
    GMGASDGFVKVIADAKTDEILGVHIVAANASDLVAEAVVAMEFKAAAEDIGRICHPHPSMSEVMREAALAVDKRQLNM

    >gi|187928195|ref|YP_001898682.1| heavy metal translocating P-type ATPase [Ralstonia pickettii 12J]
    MTSTFAPIHPTAPVDGKGSPIGPSRAGASHITCYHCASPLEGATALHADIGGKSREFCCAGCQAVAQTLHAAGMGHVYDG
    PIAFAKPIEGDRRTEAEAVWATYDLPVMRERFVRTRADGAEELSLAISGMR
    CAACVWLIERALSRVTGVREVTVNYATER
    ARIVGDAGVMRLSAVFAAIADVGYEAWPDQPSARRTAEARERRSLLIRLGLAMLGMMQVMMYAWPVYLHGGDIPVNQTRL
    MQWASLVLTVPVVLISARPIFINAWRQVRHAHVGMDAPVALGIGAAFIASVFATLRGHGETYFDSVTMFVAFLLAARYLE
    LRARQSAASGAEALVRQLPATCRRFNAVSGALETIPVATLQQGDCVEVRAGEVLPADGTIEHGTTEIDESLLSGESVPRP
    RDVGATALAGSYNVVSAIRVRVNRVGTQTRLAAIVDLLERALTDKPRMAELADRVAGRFVAVLLGWALLTAIAWWWIDPT
    RVFAVTVAVLVVSCPCALSLATPSALAAASGALARRGVLVTRGHAIESLAAVTDVLLDKTGTLTEGRLRLLSIETFADVD
    AEHCLALACAMEQSENHPIAQSLRAGTSNAMPLPRLGRVTNVPGQGVYAMAENRLMRLGTQSFAAMHYANQPVATIRYGG
    EAPMEEVPPAAACTSVWLGRDGQPLARFTLADTPRADAPACLGALRAQGLRLHLVSGDAPETVHWWANRLGIDHAVGGSS
    PEDKRAYVHKLQADGARVLAVGDGINDAPLLAQAQVSIAIGSGAPLAQAGADAILTEPRLIAISEAVSIGRRTLRVVRQN
    LGWAFAYNAISIPMATLGWLSPLAAGIGMSVSSLLVALNAWRLSRAV

    >gi|187928220|ref|YP_001898707.1| Rhodanese domain protein [Ralstonia pickettii 12J]
    MTSFVTAQALKAWLHDGAEIALFDVREHGQYGEAHPFYAIPLPYSRLEIDAPRLAPRRAVRMVVYDDNDGVADRAADRLN
    TIGYTNVHVLQGGAQAWAQAGFTLFAGVNVPSKTFGELVERAYHTPRVTARELAAMRERGDDVVIVDGRPVSEYLKMTIP
    SSICCPNGELGLRIRELVPDATTPIVVN
    CAGRTRSIIGAQTLINLGIPNPVMALENGTQGWYLEDLPLEHGSTRRYPDVI
    APANVKDMREASQQLAARSAVPEVDAATLARWVAQGEQSLYLCDVRTPEEFASGSLQGAQHAPGGQLIQATDQYVGVRHA
    RLVLFDADGVRAPIVASWLRQLGHDAYVLRDGLDSRASLPVAMTVLPQPLPEFSVQALATALAAGTAHVIDLRPSMSFRR
    AHVPGATWAIRPRLPALAADRDTVLIADDPRIAQLAAADWAAHAPQAASRLKLLAGGITAWTAAGYATEGSDSAPPDADC
    IDYLFFVHDRHDGNKAAARQYLAWETGLLAQLDAQELGAFRVGAGGAQS

    >gi|187928230|ref|YP_001898717.1| Glutathione S-transferase domain [Ralstonia pickettii 12J]
    MKLYYAPQSCALAPHIVAAEAGIPITAVSVDIPTLKTDTGIDYLTINPKGFVPALELSDGQVLTENAAILQFLADQAPAV
    GLAPPNGTFERSRLHEMLHYLGTDIHRGYSPLFRRETPAQTREERQSSLRRHYAVLDTELSRTQFLLGHQFSVADAYLFT
    LTRWAKLIQLDISQFGHLQSFQGRVAARPAVAAAMRAQGLIDA

    >gi|187928281|ref|YP_001898768.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ralstonia pickettii 12J]
    MPVTLDQPLPDFSAPATSGITFSPASQRGKIVVLYFYPKDNTPGCTTEAMNFRDQYDAFEAAGAVVFGISRDSLKSHENF
    KAKLEMPFELISDADEAVCNIFDTIKMKKMYGKDVRGIERSTFLIDNKGVLRREWRGVKVPNHVDDVLTAVRAL

    >gi|187928335|ref|YP_001898822.1| Disulphide bond formation protein DsbB [Ralstonia pickettii 12J]
    MQANSRAFFLLIAVISFGVVGYALYLQHVEGLQPCPLCILQRFAFLGIGVFSLLAALSSATRLLWHGLAMLSGLAGLCVA
    GYHVSLLLNPKAT
    CGIDPIENWVNALPTAKWLPQVFEADGLCVGPMPPVLGLSVPVWSLIWLVILSLTLVVGMIRRERR

    >gi|187928353|ref|YP_001898840.1| arsenate reductase and related [Ralstonia pickettii 12J]
    MTTLHGIPNCDTVKKARTWLESNGVVYTFHDFKKQGVSADMLAGWLKHVPLTTLLNRKGTTWRALSDADKARAGDEAGAI
    ALMQANPSLIKRPVLVHGKSVNVGFSADQYATLF

    >gi|187928402|ref|YP_001898889.1| protein of unknown function DUF899 thioredoxin family protein [Ralstonia pickettii 12J]
    MSATHPTATRATWLAERIELLKAEKELTRRSDELARRRQALPWVRIDKSYRFETENGSATLADLFGGRSQLLVYHFMFGP
    DYKAGCPS
    CSMIADGFDGFVTHLANHDVTLLAVSRGPLAKLIEYRERMGWSFPWASSVGSDFNYDFNVSISEEQQRAGSA
    DYNYVRGSHVMDASDLPEPVQQFASMCGTDAPTYVRDRPGMSAFVLEDGVVYHTYSTYARGLDGLWGAYQWLDRAPLGRN
    ETGVWWRRHDEYAQQR

    >gi|187928542|ref|YP_001899029.1| protein of unknown function UPF0061 [Ralstonia pickettii 12J]
    MTASPAALPDDSLASPFDWPGRPAAAPGFSALGERFLTRLPPMPMPSGAIGEPYLVGFSPDAAASLGITRAELDTAAGLA
    VFTGNAVATWSDPLATVYSGHQFGVWAGQLGDGRALLLAEFQTADGPYEVQLKGAGRTPYSRMGDGRAVLRSSIREFLCS
    EAMAGLGIPTTRALCVTGADAPVRREEIETAAVVTRLAPSFVRFGHFEHFAASEQLPQLRALADYVIDRFHPASRSEPQP
    YLALLRELARRTAELMADWQAVGFCHGVMNTDNMSILGLTLDYGPFGFLDGFDANHICNHSDTGGRYAYAQQPQIGYWNL
    FCLAQALLPLFGEDPDVFVNLSDEAQAQPAIDAAQNVLLTYRDVYGAAFYARYRAKLGLSTAQDADEALFGDLFKLLHNQ
    RADYTLFFRHLADVRRDDTPAAAEARTVRDFFFDRAAADVWLAAYRQRLQAEPQSDDERAAAMQRVNPKYVLRNHLAEIA
    IRRAKEKDFSEVENLRAVLARPFDDHPGFEHYAQPAPDWASSLEVS
    CSS

    >gi|187928543|ref|YP_001899030.1| methionine-R-sulfoxide reductase [Ralstonia pickettii 12J]
    MTVKKSDAEWRDQLSDIEYRVTREAATERPFTGKYWDHWDRGVYNCVCCGTPLFESSTKFDAGCGWPSYFQPINGEVIDE
    KTDRSHGMLRIEVQCKNCGAHLGHVFEDGPAPTGLRY
    CINSAALKFGD

    >gi|187928726|ref|YP_001899213.1| heavy metal translocating P-type ATPase [Ralstonia pickettii 12J]
    MSDCGSKGCGCAATNVVTPADGDAAAVDLKRSRYRIDNMDCPTEETLIRNKLAALPGVVNLEFNLMQRSLAVQHRLPSPA
    PIEQALAAVGMRAVRADESPAGQSTVLTIRQMD
    CPTEETLIRGKLAGMAGVSDMQFNLVQRTLAVQHAADALPQVLAAIQ
    SLGFDAEVRDRSAAAPLPEQDAAPTKWWPLAIAGANAVLAEVVYWLNGGNHWVVVILALAAILTGGLSTYKKGWIALKNR
    NLNMNALMSIAVTGAMVIGHWPEAAMVMVLFALAEVIEARSLDRARDAIRGLMDLAPETATVQRSDGSWSDVDAKTVAVG
    SRVRVKPGERIALDGTILQGRSSVNQAPITGESLPVEKAAGDSVFAGTINESGSFEYRVTAAASDSTLARIIHAVEAAQG
    SRAPTQRFVDQFARLYTPIVFAVALAVAIVPPLVFGATWLDWIYKALVLLVIACPCALVISTPVSIVSGLAAAAKRGILI
    KGGVYLEEGRKLKWLALDKTGTITHGKPAQTDVVAWNGADASAAQILAASLAARSDHPVSLAVARAAQDQGLALRDVTDF
    AALPGRGVRGHVNGALYHLGNHRLVEELGVCSPALEAQLAVLETQGKTVVMLIGQDGVRALFGVADTIKDSSRQAIKELH
    ALGIKTLMLSGDNPHTAEAIAQQVGIDEARGNLLPEDKQREIERRSAQGTIGMVGDGINDAPALARADIGFAMGAAGTDT
    AIETADVALMDDDLRKLPAFVRLSRSTAGVLKQNIALALGIKVVFLALTFTGQATMWMAVFADMGASLLVVGNGLRLLRK


    >gi|187928788|ref|YP_001899275.1| Heavy metal transport/detoxification protein [Ralstonia pickettii 12J]
    MDTIELKIKGMSCGSCVSSVTHALQRVPGVDAVDVDLARGIARVSGNAQAAPAMLAALAAAGYEAESLSTGAGAKTEHAH
    HGDVPTGTAHKSGGCCH

    >gi|187928867|ref|YP_001899354.1| Mercuric transport protein MerT [Ralstonia pickettii 12J]
    MSEPQHGRSALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTALEPYRPLFLGTAMLALFFAWRRIFRPAQVCQPGE
    VCAIPQVRATYKVIFWVVALLVLVALGFPYVMPFFY

    >gi|187928868|ref|YP_001899355.1| mercuric transport protein periplasmic component [Ralstonia pickettii 12J]
    MKKLFAALALAAVAPAWAAMQTVTLSVPGMTCETCPITVKHALSKVDGVSKTEVSFEKRQAVVTFDDAKTSVQKLIKATE
    DAGYPSSVKH

    >gi|187928870|ref|YP_001899357.1| mercuric reductase [Ralstonia pickettii 12J]
    MTHLKITGMTCDSCAVHVKDALEKVPGVRSAVVSYPKGTAQIATDPGTSTDALTAAVAGLGYRVMLGEAPPVEKRGNLLD
    KALGWLASGEKSAGEGSALRIAVIGSGGAAMAAALKAVEQGAQVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRES
    PFDGGIQATPPAIVRERLLAQQQGRVDELRHAKYEGILASTPAITVLRGEARFQNGHALSVRLAEGGEREVAFDRCLIAT
    GASAAVPPIPGLKDTPYWTSNEALASDTLPKRLAVIGSSVVAVELAQAFARLGSQVTVLARSTLFFREDPAIGEAVTAAF
    RAEGITVLDHTQASQVAYANGEFVLTTGHGEIRADQLLVATGRAPNTRELALEAAGVRDNAQGAIVIDKAMRTSAQNIYA
    AGDCTDQPQFVYVAAAAGTRAAINMTGGDAALDLSAVPAVVFTDPQVATVGYSEAEAHHDGIETDSRLLTLDNVPRALAN
    FDTRGFIKLVADAGSGRLIGVQAVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFSKDVKQLSC
    CA
    G

    >gi|187928874|ref|YP_001899361.1| Protein-disulfide reductase [Ralstonia pickettii 12J]
    MGWSVAATRTGGGGRVRGVAPAQLVLLLLAALWFCVTGTGGVAHAAGEQDLLPPEQAFRFAARQLEDRSIEVHFDIADGY
    HLYRERFAFAAQPAGVKLGTPEFPPGQVNFDEALGKQMETYHGGVTIRVPVAVAQVDGKWLLTVTSQGCADKGVCYPPMH
    SVYKVGGGSLGGLFDKHRSSTPMTSPAPPATPTLPSLGGGQIGPAVPSAAPRNDDGDHIARVLASRQLGKIVTVFLGFGL
    LLTLTPSALAMVLILSSIVVGEHVTRVRALLVSFAYVLGTAVGVGAAAELLGERLSARLQAPWALGAFAALAVALALSMF
    GLYELGRQLPTTAPSNRWSGGRIAVAAASGVISTLVVVRSVPVPLSSTLAYLKQTGDAIGSGGALFGLAIGMGVTLVLVG
    VATGYLLPRAGHWLMVTKRFLGFLLLGEALWAVSPLLPPWALMAAWAMLLLIAAAFLGAFDSLGPEPRSMARLGKGMGMV
    AALAGAILLVGLASGGRDLLQPLSHLRAGPMAPASTAGPALVRFERIRSVAELDARLVQAAAAGKPVLLDFYADW
    CVSCK
    EMERLTFSDPRVQARLAGVVLLQADVTRNTADDRILLKRFGLFGPPGIILYGADGRESPVRVIGFQSASLFLDSLAKAFG
    DDGKR

    >gi|187928878|ref|YP_001899365.1| glutaredoxin 2 [Ralstonia pickettii 12J]
    MEPLNVILLVQAHCAFCESAKAMLVRLSADYPLSVFTLPLESEVGQEIAAKHGILFAPGILVNGEALCYGRPSERKLRRE
    FERRFKTSEQ

    >gi|187928886|ref|YP_001899373.1| heavy metal translocating P-type ATPase [Ralstonia pickettii 12J]
    MNDQRSHPQTPSPAPGHVKGVECGNSCTEGGGHQHATAKRLTLVTAIEERDPVCGMTVKPNTPYQSSYAETRYGFCSTTC
    QRKFDADPKLYTHSQVASAADDANAAPDTVYTCPMHPEIRQDHPGN
    CPKCGMALEPAMPSLEADENPELAAFRRRFWWTL
    PLTIAVVALVMLGGRVTGVAPAAQGWVEFALSAPVVLWAGFPIYTRCLQSFRNRSPNMWTLIGLGTGAAFVYSVAATVAP
    DLFPRSFVVHGRIAVYFEAAAVIISLTLLGQVFELKARSQTSAAIKSLLGLAPKTARRLNPDGSEEDIPLTHVHVGDLLR
    IRPGEKVPTDGIVMEGASAIDESMITGEPLPVSKRAGDHVIGATLNTSGSLVMRSEKVGAQTVLSQIVQMVAQAQRSKAP
    MQRMADQVAGVFVLVVVAIAVLAFFGWGLFGPEPSWVFGLVNAVAVLIIACPCALGLATPMSIMVASGKAATQGILFRDA
    AAIEHFRKVDTLIVDKTGTLTEGRPVFERALAVDSLDETAVLRLAASLDQGSEHPLAATIVAAARERGLTLGKAEHFASD
    AGMGVQGRVDGHQLILGNASLMRREQVDIESQALRANVLGQYGASVMYLAVDRKLAGLLAVSDPVKASTPEALAALKAAG
    IRVVMASGDSTATARAVAGPLGISEVHGEVKPADKLALVAKLQSEGHVVAMAGDGINDAPALAKADVGIAMGTGTDVAMH
    SAQVTLVKGDLRGLARARELSQATIANMKQNLGFAFVYNALGIPLAAGLLYPFTGWLLSPMIAALAMSLSSVSVISNALR
    LRAQVF

    >gi|187928897|ref|YP_001899384.1| heavy metal translocating P-type ATPase [Ralstonia pickettii 12J]
    MSECGSKGCGCAAPSVVTPADVDTASVDLKRSRYQIDNMDCPTEEALIRNKLAALPGVVKLEFNLMQRSLAVHHQLPSPA
    PIEQALSAIGMRAIRSDETSAGQSTVLTIRQMD
    CPTEETLIRGKLAGLPGVTGLDFNLVQRTLAVHHAAGSLPQVLAAIQ
    SLGFEAEVRDTSAAAPASAQDATPTKWWPLAIAGTSAVLAEVVYWLNGGNHWVVVVLALAAILTGGLSTYKKGWIALKNR
    NLNMNALMSIAVTGAMVIGHWPEAAMVMVLFALAEVIEARSLDRARDAIRGLMDLAPETATVLHSDGSWTDVDAKSVEVG
    SRVRVKPGERIALDGTVLQGRSSVNQAPITGESLPVEKAEGDPVFAGTINESGSFEYRVTATANDSTLARIIHAVEAAQG
    SRAPTQRFVDQFARLYTPIVFAVALLVAIIPPLVFGAAWLGWIYKALVLLVIACPCALVISTPVSIVSGLAAAARRGILI
    KGGVYLEEGRKLKWLALDKTGTITHGKPAQTDVLAWNGADASAAQFLAASLAARSDHPVSQAVARAARDTAQAPRDVTDF
    AALPGRGVQGHIDGALYHLGNHRLVEELGVCSPALEANLAALETQGKTVVMLIGPDGVRALFGVADTIKDSSRQAIKDLH
    ALGIKTLILSGDNPHTAEAIAQQVGIDEARGNLLPEDKQREIEQLSAQGTIGMVGDGINDAPALARADIGFAMGAAGTDT
    AIETADVALMDDDLRKLPAFVRLSRSTAGVLKQNIALALGIKVVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLRK


    >gi|187928930|ref|YP_001899417.1| heavy metal translocating P-type ATPase [Ralstonia pickettii 12J]
    MSRQHSHREAASPRQSADTAHDHNEPTQPHAHHCNVHGHHAHSAGAPRAVPGDEASVSPPASASTIYTCPMHPEIRQDHP
    GT
    CPKCGMTLEPIMPAGEEEENAELMDFRRRFWISLPLTAMVFVLAMAGYRLIPLNPAWKNWLELVLATPAVLWAGLPFF
    ERCVQSFLHRSPNMWTLIGLGTSAAYLYSVVATVAPDVFPSTFAASGRVEVYFEAAAVIISLTLLGQMLELKARSQTSAA
    IKSLLGLAPKTARRIDADGSEEDVPIAHVHVGDLLRVRPGEKVPVDGVVVEGASALDESMITGEPIPVSKRAGDHVIGAT
    LNTSGALVVRSEKVGAQTVLSQIVQMVAQAQRSKAPMQRMADKVAGVFVIGVVAIAVMTLVAWGIWGPQPSWAHGLINAV
    AVLIIACPCALGLATPMSIMVASGKGAEHGILFRDAAAIENLRKVDTLIVDKTGTLTEGRPSFDRAIGLNGFSDMDVLRL
    AASLDQGSEHPLAAAIVAQAREQGLALERPEDFESASGIGVRGHVAGRSLALGNTSLMQAHAVAVDAASTEADAMRARGA
    SVMYLAVDGVLAGLLSVSDRVKTTTPQALTQLRADGLRIVMATGDGNVTAQSVAKQLGIVEFRGEVKPADKLALVATLQE
    RGLVVAMAGDGINDAPALAKADVGIAMGTGTDVAMNSAQVTLVKGDLRGIARARALSEATIANMKQNLGFAFLYNALGVP
    LAAGVLYPFTGLLLSPMIAALAMSLSSASVVANALRLRATRL

    >gi|187928980|ref|YP_001899467.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ralstonia pickettii 12J]
    MKTIGDKLEPFKVVGVKPGFNNHEENGESAFEDITETSFPGKWKVIFFYPKDFTFVCPTEIVAFAKLNDDFADRDTIVLG
    GSTDNEFVKLAWRREHKDLNKLNQWSFADSTGALVDQLGVREHEAGVALRATFIVDPDNVIQHVSVNNLNVGRNPDEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|187929024|ref|YP_001899511.1| dihydrolipoamide dehydrogenase [Ralstonia pickettii 12J]
    MSVVEIKVPDIGDFDAVEVIEVLIKAGDTVAPEQSLIVLESDKASMEVPSEVAGKIVDVKVKVGDKVSKGTVIATAEAGA
    AAAPGPAQAPAPAPAPAAAPAASAPAPQAAKHAGGADIECEMLVLGSGPGGYSAAFRSADLGMNTVLVERFSTLGGV
    CLN
    VGCIPSKALLHTAAVMDEVKAMAAHGIVYSEPTVDINQLRKHKESVIGKLTGGLAGMAKARKVQVVRGVGTFLDPNHLEV
    QLTDGDGKATTGEKKVIRFAKAIIAAGSEAVKLPFIPEDPRIVDSTGALELREVPGRMLVIGGGIIGLEMATVYSTLGAR
    IDVVEMLDGLMQGADRDLVKVWDKMNKSRFDKVMLKTKTVGVEAKPDGIYVKFEGEAAPAEPQRYDMVLVAVGRTPNGKR
    IGAEKAGVAVTDRGFIDVDKQQRTNVPHIFAIGDLVGQPMLAHKAVHEGHVAAEAAHGEKAYFDAKQIPSVAYTDPEVAW
    AGLTEDQCKAQGIKYGKGVFPWAASGRAIANGRDEGFTKLIFDEETHRIIGGGIVGTHAGDLIGEICLAIEMGADAVDIG
    KTIHPHPTLGESVGMAAEIYEGVCTDVPPARKR

    >gi|187929046|ref|YP_001899533.1| alkylhydroperoxidase like protein, AhpD family [Ralstonia pickettii 12J]
    MLNWVEYRKELLGRIGEIGQITPDTVKGYKTLSAATTGSLDAKTRELIALAVAVTTRCDGCITVHTAEAIKHGATHEEIA
    DALSVAISLNAGAALVYSARVMDAVQAYEKA

    >gi|187929168|ref|YP_001899655.1| uncharacterized peroxidase-related enzyme [Ralstonia pickettii 12J]
    MTEIIRAHGFTNESLEWQAWLDVVDLDRATPEQIAVLEESHPKAKTSDYYRFLVHQPEILRQRSAAFNAIMYAPGGLSRA
    DRELASAVVSRVNGCVY
    CASVHAQRFEQLAKRNDVIKQVLEDPHIAGTNARERAIVLFSIDLTLHPGHLRGEDLKPLKAA
    GLTDAEILDLIHAVAIFAWANRLMLNLGEPVFPDAA

    >gi|187929475|ref|YP_001899962.1| uncharacterized peroxidase-related enzyme [Ralstonia pickettii 12J]
    MTTTTPPISRFPVPSLADIPEDIRARILEVQEKSGFVPNVFLALSHRPDECRAFFAYHDALMLREGSSLTKGEREMIVVA
    TSAANQCLY
    CVVAHGAILRIYEKNPLVADQVAVNYRKADITPRQRAMLDFAMKVCTASHTVNDADYEALRAHGFDDEDIW
    DIAGITAFFGLSNRMANVISMRPNEEFFLLGRLPREKKA

    >gi|187929510|ref|YP_001899997.1| Rhodanese domain protein [Ralstonia pickettii 12J]
    MSERAHYATLITAPQLAALQQSAPEAVVVIDCSFDLANPAAGRDAYHASHVPGAFYMHLDNELSGPKTGTNGRHPLPDAE
    ALIARLQALGVNDDTQVVAYDRQGSMYAARLWWLLRWVGHADVAVLDGGLQAWEAAYFPVDQVIPEEPQLNATPGNITRK
    PSLVQLVTADIVQKYLGHADKPVVDARAPDRYRGENETLDPVGGHIPGARNRFFRDNLQADGTFKPAEQLRADFAGVLAG
    ARPQDATLQ
    CGSGVTACHNALAMEIAGLTGAALYAGSWSEWCSDPSRPVATGPNP

    >gi|187929602|ref|YP_001900089.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ralstonia pickettii 12J]
    MRSDTECRSPRAWSRRTWLQAASTVALGTGLGSPSHDAHAASLEVGRPAPALVLHTIDGRNISTEDLHGHVVILSFWATW
    CGPCHQELPLLSDYAAKHAHRGLRVLGFSLDEPASLSAVREMAAAWSFPVGLLGSAYAGGYGRIWRIPVNFTIDRNGLLA
    DNGWDSREPAWTAERLDRIVTPLLR

    >gi|187929630|ref|YP_001900117.1| thioredoxin reductase [Ralstonia pickettii 12J]
    MAKHAKVLILGSGPAGYTAAIYAARANLNPVLVTGLAQGGQLMTTTDVENWPADKEHLQGPELMQRFLEHAERFKTEVLF
    DHIHTAHLKEKPIRLVGDSGEYTCDALIVSTGASAQYLGLPSEEAFAGRGVSA
    CATCDGFFYKGQEVAVVGGGNTAVEEA
    LYLANIASKVTLIHRRDKFRAEPILIDRLHEQEKKGKIEIKTNMVLDEILGDESGVTGARLKGTHENEGKTEEIKLAGVF
    IAIGHKPNTDIFRGQLDMNDTGYIRTKSGLDGMATATNIPGVFAAGDVQDHIYRQAITSAGTGCMAALDAQRYLESLE

    >gi|187929843|ref|YP_001900330.1| methylated-DNA/protein-cysteine methyltransferase [Ralstonia pickettii 12J]
    MYRHIFACPLGDLLLTATDTHLTGAFFPGQKTIPVNTARMSPGADVPVIREAQAQFTAYFAGKLHDFDLPMAPDGTPFQQ
    DVWRLLCDIAFGNRTTYGQITARLGLTREHARAVGTAVGRNPISIAIP
    CHRVVGADGALTGYAGGLPRKAALLRLEGHPA
    QVGQRLPMPDDDRQSTLALLPA

    >gi|187929888|ref|YP_001900375.1| methylated-DNA/protein-cysteine methyltransferase [Ralstonia pickettii 12J]
    MPSPFDAVLEAPFGKLGVRVADGALRELVYLPEGTPLANSSDALIARLARQLDAYYSDPRATFDVPLARAGTDFQHRVWQ
    AISAIPCGSVITYGTIAQQIGSVPRAVGQACGDNWFPILIP
    CHRVVSASGIGGFSHHTDGYLLNIKHWLLRHEGVMLI

    >gi|187929921|ref|YP_001900408.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Ralstonia pickettii 12J]
    MKLRYVLPLAAFLVLVIALAAGLSRDPRELPSPLVGKPAPAFRLTALESTAGPLTPQDLRGKVWMLNVWASWCTACRAEH
    AVLNAFAKQSAVPIYGLNYKDDADAARAWLKQMGDPYVTSLIDADGKVGIDYGVYGVPETFVIDRAGVVRYRQVGPVTAE
    SMERRIAPLLQQLEQEGGHA

    >gi|187929924|ref|YP_001900411.1| transcriptional regulator, AraC family [Ralstonia pickettii 12J]
    MQTSARPVPDTTLVEHDPRWARVLARDASADGQFVYAVKTTGVYCQPSSPSRLPRPENVEFFETPADAEAAGYRPSRRAG
    PDQTTVRAQQTALVAQACRRIEAADTPPTLDALAQDASLSPYHFHRLFKSVTGLTPKAYADAHRARKLRAQLERGSSVTE
    AIYDAGFNASSRFYEASDNVLGMTASRYRAGGAQTTIRFAVGECSLGSILVAQSDRGICAILMGDDPDALVRDLQDTFPK
    AELIGGDASFENLVAKVVGFVEAPSIGLDLPLDVRGTAFQERVWQALREVPPGSTTSYTEIAARIGAPRAVRAVAQACAA
    NHIAVAIP
    CHRVIRRDGNASGYRWGVERKLALLEREAQSAA

    >gi|187929941|ref|YP_001900428.1| putative thioredoxin protein [Ralstonia pickettii 12J]
    MIQNIATSHDAHAAIPVDKTALAAFGMREVNTETFDAAIAAAGDALVCVFFWGVDCFNCEMAKQAMLAQPAAVRELGLSW
    LHANVYAHPELGQRFALHGIPVFMFFHRGKKLGRATGWHGHAQFAAAVANARNKLAGKPLV

    >gi|187929978|ref|YP_001900465.1| Glutathione peroxidase [Ralstonia pickettii 12J]
    MSDVYAFEADSLTGQRVPLSQYKGKVLLIVNTASKCGFTPQYAGLEAVYKRLHDKGLEVLGFPCNQFGKQEPGGEDEIGA
    FCEKNYGVSFPMFGKIDVNGSNAHPLYKWLTSEKPGVLGIGAIKWNFTKFLLRRDGTVYKRYAPMTKPEEIADDIERLLA
    EPDPA

    >gi|187930096|ref|YP_001900583.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ralstonia pickettii 12J]
    MSRRTTLTALLMAGLIAATTGVYFGHRATEPKTPADTAVAAFYSSKLPDANGAPLDLAAFRGQPVVINFWAPWCGPCVEE
    MPELSALAQEQKAQVKFVGIGIDSASNIQTFLGKVHVTYPIAVAGFGGTELGRQFGNEVGGLPFTVILNAQGEITFRKMG
    RVHADELREALQRT

    >gi|187930103|ref|YP_001900590.1| Redoxin domain protein [Ralstonia pickettii 12J]
    MANVTLGGNPIEVGGQFPTAGSKAPAFTLVGADLKDVSLADFAGKRKVLNIVPSLDTPVCATSTRKFNEAAAKLDNTVVL
    SISADLPFAAGRFCTTEGIANVKPLSTFRDKGFKQAYGVDITSGPLAGVTARAVVVLDADDTVMYSQLVPEIKDEPNYDA
    ALSALK

    >gi|187930151|ref|YP_001900638.1| Redoxin domain protein [Ralstonia pickettii 12J]
    MIQPGQPLPDATLYEFFEVEKDGCALGPNAFSVRHLAEGKTIVIFGLPGAFTPTCSARHVPGYLANFDALRAKGVDEIWC
    VSVNDAFVMGAWARTQGTDDKIRMLGDGSAEFTSKLGLDQDLSKRGMGIRSQRYAMVVKDGVVTALQVEAPGQFSVSSAE
    SMLALL

    >gi|187930201|ref|YP_001900688.1| putative thiol:disulfide interchange protein [Ralstonia pickettii 12J]
    MSFRIRVAAIASAVAVAAIGAGYVLSAGAAEPALDKVKATVQKALGPNVEIKSVTKSPLAGLYEINLGSQVVYSDATGRY
    VLNGDLLDTQTATNLTQERLAELNRVKWSDLPLDRAVKWVKGNGARKIAVFSDPN
    CPYCHKLEQMLTQVDNVTVYTFLFP
    ILSEDSNTKAKQIWCSADRAKAWRDWMTAKTAPGGAGTCDTPLEANLKLGQQLNVTGTPAIIFPDGSRAPGLIDAATLER
    KFAALKKS

    >gi|187930217|ref|YP_001900704.1| glutaredoxin-like protein [Ralstonia pickettii 12J]
    MSTTHEKIDQIVKGHPVVLFMKGTAQFPMCGFSGRAIQILKACGVDRPHTVNVLEDDEIRQGIKDYANWPTIPQLYVNGE
    FIGGSDIMMEMYQSGELQPLLAA

    >gi|187930270|ref|YP_001900757.1| Glutathione S-transferase domain [Ralstonia pickettii 12J]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLFNFEKELFTHVSVLENEKGKAAEKNHEKARAAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIEVSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|187930335|ref|YP_001900822.1| Protein-disulfide reductase [Ralstonia pickettii 12J]
    MTFSSFVSVRRVMQLAMLLVAVATLCMPAHAADDFLPPEQAFRFSATQVDGQTVEVKFAIADGYYMYRERFAVAADPAAV
    ALALLDMPAGKVKFDETFNKDVETYRHEIAFHVKARNATAPFTLIVTSQGCADQGLCYPPMKSRFHVEPAAASPAAPSAG
    GGDALGRIASTLGSGNLGAIAALFFGLGLLLTFTPCVLPMLPILSAIVVGEHATRSRAAIVSVAYVLGMAFVYTAVGVAA
    GLAGQGLQAALQNAWVLGAFAVLMVALSLSMFGLYELQLPAAWRDHLTKASSKHGGGEIVGAVVMGALSALIVSPCVTPA
    LAGALAYIAQTGNAAIGGMALFAMSIGMGVPLVLVGVGAGNLLPRAGHWLIVTKAVFGFILLAVALWIVQPVLPAWAVMI
    AWGGLLIGAAVFLRTFDSLPDGAGNVQRLGKVAGVVLALAGAAQLVGVAAGGRDPLQPLSGLIRASAGASAQAEAHGVTF
    KRVKSIAELDAEVRNASASGRAVMLDFYADW
    CVSCKEMERLTFTDTRVRKALADVVLLQADVTANSADDQVLLKRFGLFG
    PPGTIFFDAQGRELKARVVGYERADTFLESLRRTIGTTQAAKPTA

    >gi|187930510|ref|YP_001900997.1| OsmC family protein [Ralstonia pickettii 12J]
    MSIENVLYRANARATGGRDGRAITDDGRLDVRLTTPTELGGAGGEGTNPEQLFAAGYSACFLGAIKFVGARDKIRVPADV
    SVQGTVGIGVIPNGFGIEVDLKISLPGMDPAEAQTLIDRAHIV
    CPYSNATRGNIDVRLSLV

    >gi|187930517|ref|YP_001901004.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ralstonia pickettii 12J]
    MRTLRRFLMWTAAMVLVASTAQAVEVGDVAALPDVQLLDGTRVPGDAWRGHPVIIATWASWCPFCALQNPRLQKLYDATR
    GTDLRILTISIDANPQLAKDYVAKRGFTFPVTMETDALCAATGPRKGLPELLVLDAKGRVVRKEVGEMLEDDVADLARYA
    HNPKQ

    >gi|187930534|ref|YP_001901021.1| arsenate reductase and related [Ralstonia pickettii 12J]
    MQIYHNPRCSKSRTALEQAQSFAAKNGEQLEVIEYLATPPTLADLKKLAAQLDTPLRSLIRENEDEYAQLNLADASDDAL
    LKAIAAHPKLLQRPVLVRNGRATIGRTPEALDVFLK

    >gi|187930569|ref|YP_001901056.1| Glutathione S-transferase domain [Ralstonia pickettii 12J]
    MKLYYSAGACSLAVHIALREVGAQFDLTAVDLAKHLTADGTDFYTISPRGYVPLLELADGSRHTEAAALLQYVADLDPTQ
    ALIGKPGSAHRLAVIEWLTFVSTELHKGFGPLWYKDTPEATRQGAKDKLAKRFAELDARLAKQPYLADTYSVADAYAFAV
    LNWTNFLALPMGAYPHVQAYMARVGARPQVVAALKAEGLIKADAASTVA

    >gi|187930607|ref|YP_001901094.1| heavy metal translocating P-type ATPase [Ralstonia pickettii 12J]
    MTAASLADVTSTDLDISGMTCAACAGRVERALRAVPGVTEASVNLATERARVQGGAGSDALIAAVSAAGYEARVASDETA
    ASVVAEPDFWEGAGPVWIAAALSVPLVLPMIAGWFGGGWMLPAWVQWLLATPVQFVIGARFYKAGWKALRARAGNMDLLV
    ALGTSAAYGLSLWLWWRAGADGMHHAPHLYFESAAVVITLVRLGKWLEVRAKRQTAQAIRALQALRPDTARVRSADGTLR
    DTPVAQVRVGDVVSVRAGERIPVDAVVLEGASHVDESMLTGESLPVPKHEGDRVTAGAIATDGVLLVRTTAIGADTMLSR
    IIRLVEDAQAAKPPIQQLVDRVSAIFVPAVLVAALLTLAGWFIAGAGWETAIVNAVAVLVIACPCALGLATPSAIMAGTG
    AGARRGILIADAQALERAQQVDFVVFDKTGTLTVGQPRVTAVEAASGVDTDTLLDQLAALQAENTHPLAHATREYAMERG
    RAITPAQSPEVLAGRGTRGIVNGASLQLGNARWMDELGLDRGALQTRADALEAQGNTVSWLAQRDEGGVQLRGLIAFGDA
    LKPGAKEAVAALQTRGVRTALVTGDNAGAAHSVAHALGIDEVAAQVLPQDKAARVTAWQQSGHVVAMVGDGINDAPALAA
    ADVGIAMATGTDVAMQAAGITLMRGEPRLVSDALDLSRRTVAKIRQNLFWAFIYNVVGIPLAAFGLLNPTFAGAAMAFSS
    VSVVTNALMLRRWRATGDNA

    >gi|187930676|ref|YP_001901163.1| alkylhydroperoxidase like protein, AhpD family [Ralstonia pickettii 12J]
    MEPRLDFYQSNPAAIQAVMGLEKALAKSTLEKPLTELVRLRASQINGCAYCVDLHTADARKGGEDDRRLATVSVWHETPF
    FTDRERAALAWTEAVTLVAQTRVPDDVWQAVRAQFSDAELVDLTLLVSTINTWNRLAISFRKLPA

    >gi|187930745|ref|YP_001901232.1| Thioredoxin domain [Ralstonia pickettii 12J]
    MPLLLPDTDAATLHARIRSGQLLVACLCAEWCGTCRSYRKTFTELAARHPECCFVWVDVEDHADALGDFDVENFPTLQVQ
    RGNDVLFFGPVLPHAGVVEGLLSRDLHVAPAVPAAPDLRGWLLESA

    >gi|187930805|ref|YP_001901292.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia pickettii 12J]
    MPANPAHAFDLIVIGAGSAGLAAARRSAELGARTLLIDRAQIGGTCVNRGCVPKKLLGYGAAWSQTMARCLRAAHTSDAW
    ADAIARTRTEVARLHETHFARLADAGVQWLSGMASLRGRGIVRVQAESGKTTLRARQIVLAAGTRPTPLPVPGAELA
    CTS
    DDVFGWDTLPASLIIAGGGVIAVEMASTLARFGVRVTVLTRDARVLPEFDATVAEAAALSLAGCGVDLILNADVVRIERD
    AVNGGGVAVYASTEGSDVPRVLRAQRMLSAIGRTSNIAGLGLEAAGVTLDAHGRIAVDRHFRTRARGVHAVGDICGGSPL
    QLTPVAVAQGRYVAERLFGKGIKLPDMNTVPMAVFCDPAIAGVGLTEADARTRWPELGKRGPDTDKRALADRIDIVVRRF
    VSLEQRFAGSGMESLIKLVCNARSGRVLGAHIVDNAAPEIIQAMAVAVRMGVRLKHLQSTVGLHPTVAEELLGM

    >gi|187928917|ref|YP_001899404.1| protein of unknown function DUF411 [Ralstonia pickettii 12J]
    MTTPLSSQPISTSRRSLVVGLALLPAIALAQKSEPKPTVQVWKTPGCGCCKDWLSHLRDNGFDVVAHDVEDTVEARRTAG
    IPDRYASCHTAAVQGYALEGHVPAREVRRLLRERPKAIGLAVPSMPIGAPGMDGPAYGNRRMPHSVLLIGLDGTSTVFQA
    YS