Ralstonia pickettii 12D uid58859

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|241114279|ref|YP_002973754.1| heavy metal translocating P-type ATPase [Ralstonia pickettii 12D]
    MSDCGSKGCGCAATNVVTPADGDAAAVDLKRSRYRIDNMDCPTEETLIRNKLAALPGVVNLEFNLMQRSLAVQHRLPSPA
    PIEQALAAVGMRAVRADESPAGQSTVLTIRQMD
    CPTEETLIRGKLAGMAGVSDMQFNLVQRTLAVQHAADALPQVLAAIQ
    SLGFDAEVRDRSAAAPLPEQDAAPTKWWPLAIAGANAVLAEVVYWLNGGNHWVVVILALAAILTGGLSTYKKGWIALKNR
    NLNMNALMSIAVTGAMVIGHWPEAAMVMVLFALAEVIEARSLDRARDAIRGLMDLAPETATVQRSDGSWSDVDAKTVAVG
    SRVRVKPGERIALDGTILQGRSSVNQAPITGESLPVEKAAGDSVFAGTINESGSFEYRVTAAASDSTLARIIHAVEAAQG
    SRAPTQRFVDQFARLYTPIVFAVALAVAIVPPLVFGATWLDWIYKALVLLVIACPCALVISTPVSIVSGLAAAAKRGILI
    KGGVYLEEGRKLKWLALDKTGTITHGKPAQTDVVAWNGADASAAQILAASLAARSDHPVSLAVARAAQDQGLALRDVTDF
    AALPGRGVRGHVNGALYHLGNHRLVEELGVCSPALEAQLAVLETQGKTVVMLIGQDGVRALFGVADTIKDSSRQAIKELH
    ALGIKTLMLSGDNPHTAEAIAQQVGIDEARGNLLPEDKQREIERRSAQGTIGMVGDGINDAPALARADIGFAMGAAGTDT
    AIETADVALMDDDLRKLPAFVRLSRSTAGVLKQNIALALGIKVVFLALTFTGQATMWMAVFADMGASLLVVGNGLRLLRK


    >gi|241114313|ref|YP_002973788.1| Heavy metal transport/detoxification protein [Ralstonia pickettii 12D]
    MDTIELKIKGMSCGSCVSSVTHALQRVPGVDAVDVDLARGIARVSGNAQAAPAMLAALAAAGYEAESLSTGAGAKTEHAH
    HGDVPTGTAHKSGGCCH

    >gi|241114345|ref|YP_002973820.1| heavy metal translocating P-type ATPase [Ralstonia pickettii 12D]
    MSECGPKGCDCAAVNVAPPAPDATGVDLKRSRYRIDNMDCPTEEALIRNKLATLPGVVKLEFNLVQRSLTVNHRLPSPAS
    IEQALSAIGMQAVRAEETRSAQSTVLTIRQMD
    CPTEEALIRGKLAGVPGVAGLDFNLVQRTLAVRHAAHTLPQVLAAIQS
    LGFDAEVRDTSAAAPASVPDAAPTKWWPLAISGANAVLAEVVYWLNGGNHWVVVVLALAAILTGGLTTYKKGWIALKNRN
    LNMSALMSIAVTGAMVIGHWPEAAMVMVLFALAEVVEARSLDRARDAIRGLMDLAPETAMVQRSDGSWGDVDAKTVAVGS
    RVRVKPGERIALDGEVLQGRSSVNQAPITGESLPVEKAEGDPVFAGTINESGSFEYRVTAAASDSTLARIIHAVEAAQGS
    RAPTQRFVDQFARLYTPIVFAVALAVAILPPLLFGAAWLDWIYKALVLLVIACPCALVISTPVSIVSGLAAAARRGILIK
    GGVYLEEGRKLKWLALDKTGTITHGKPALTDVMAWNGTDPSAAERLAASLAIRSDHPVSQAVARAAQDKGLTPGEVADFA
    AMPGRGVRGHIDGALYHLGNHRLVEELGVCSPALETNLATLETQGKTVVMLIGPDGVRALFGVADTIKDSSRQAIKDLHA
    LGIKTVMLSGDNPHTAEAIAQQVGIDKARGNLLPEDKQREIEQLSAQGTIGMVGDGINDAPALARADIGFAMGAAGTDTA
    IETADVALMDDDLRKLPAFVRLSRSTAGVLKQNIALALGIKVVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLRK

    >gi|241114359|ref|YP_002973834.1| Protein-disulfide reductase [Ralstonia pickettii 12D]
    MGWSVAATRTGGGGRVRGVAPAQLVLLLLAVLWFCVAGSGGVAHAAEEENLLPPEQAFRFAARQLDDRSIEVHFDIADGY
    HLFRERFVFAAQPAGVKLGTPEFPPGQVKFDEALGKQMEIYHGGVTIRVPVAVVPADGEWLLTVTSQGCADKGICYPPMH
    SVYKVGGGLLGGLFDKHRSSRPMTSPVPPAMPILPSLGEGQIGPAVPSAAPRNDDGDRVAHVLAGHQLGRIATVFFGLGL
    LMTLTPGVLAMVPILSSIVVGEHVTRGRALVVSLAYVLGTAVADAGVGVAAGLLGERFSTGLLTPWALGAFTMLAVALAL
    SMFGLYELGRLPPMTASSNRWSGGRIAVAAAAGVISALVVVRSVPVPLSGTLTDAEQTGDAIGSGGALFGMAIGMGAPLV
    LVGVATGYLVPRAGHWLMVTKRFLGFLLLGEALWAVSPLLPPWALMAAWAMLLLIASAFLGAFGSLGPEPRSLTRLGKGM
    GMVAALAGAILLVGLASGGRDLLQPLSHLRAGLMAPASTAGPALVRFERIRSVAELDARLVQAAAAGKPVLLDFYADW
    CV
    SCKEMERLTFSDPRVQARLADVVLLQADVTRNSADDRTLLKRFGLFGPPGIILYGADGRESPVRVIGFQSASLFLDSLAK
    AFGDDGKH

    >gi|241661646|ref|YP_002980006.1| alkylhydroperoxidase like protein, AhpD family [Ralstonia pickettii 12D]
    MSQAPRIAYFQLAPKAFNNLLNLSNGLRRDLLGARLVDLVLLRVSQINGCAFCIDMHWSDLMKMGEDPRHLNAVAGWREA
    PFFTERERAALRWAELVTNTPHSDASDEEFARLRTHFSDEEIAELSFVIVTINSWNLLNVSLRNPVPLNAPYAAAA

    >gi|241661765|ref|YP_002980125.1| DSBA oxidoreductase [Ralstonia pickettii 12D]
    MKKLAAFLIALATGAGFLMTAPANATPTAGKEYKVLQTPQPVPAGKIEVTEFFWYGCPHCYDFENTWTAWVAKQGKDVVI
    KRVPVAFNAKLEPHTRIYYTLEALGKLDAKDASGKTLHDRVFDQLHKNYRSMSELDDIAKFMAANGVDEKQFRDTYNSFS
    VNANTKRAAQLADQYKIEGVPTVVVQGKYTTSPADAGSNVGAAQTLDYLVDQVRNRKM

    >gi|241661791|ref|YP_002980151.1| glutathione peroxidase [Ralstonia pickettii 12D]
    MLFPTTVSPRRPRLQLHASGALRRHHVLMIIIAIAIAVIALLLPRTGHAATAGVAPTVQAPVAAGACPASLNFRVKRLQD
    DAPQDLCQYAGRVVLVVNTASY
    CGYTHQYEGLEALYAKYRDKGLTVLGFPSNDFQQEPGNSKQIADFCYNTYGVKFPMFS
    KTAVVGAVASPLYAWLATQTGQPPKWNFHKYLLDRNGRVAAVFPSSVEPSDPALIKRIDALLAEPSTRSSR

    >gi|241661818|ref|YP_002980178.1| Redoxin domain protein [Ralstonia pickettii 12D]
    MASTLTPSAAPVSGATSGGRRWLLPVIVLVLAVAGWFGWRAFSPSQQVPAATFTLLDGQKLSTQDLKGKVYLVNFWATSC
    TT
    CIKEMPNMVQTYNKYKGEGLEYVAVAMSYDAPMYVMNFSQTRQLPFKVAMDADGSAAKAFGDVQLTPTTFLVDRDGRI
    LKRYVGEPEWSSFDALLKQTLGKQA

    >gi|241661846|ref|YP_002980206.1| UBA/THIF-type NAD/FAD binding protein [Ralstonia pickettii 12D]
    MNDDQLLRYSRHILLDEIGIEGQTRLLESHVLVIGAGGLGAAALPYLAAAGVGTLTIVDDDTVDLTNLQRQIIHTTESVG
    QPKVASAQAAIARLNPDVRVNALQRRLDADAIGALLQGVSVVLDCSDNFDTRQAINLACVRAGLPLVSGAAIRFDGQISV
    FDSRTGGPCYACLFPPDEPAPEVA
    CATMGVFSPLVGMVGTVQATEALKLIVGIGHSLAGRLLMLDGLTMEWTTMRIARQP
    SCPVCGGKH

    >gi|241661849|ref|YP_002980209.1| Rhodanese domain protein [Ralstonia pickettii 12D]
    MKFFADYNNLALLAVAIVSGLLLLWAPIQRRIAGGGGAKVSAPVATQLINRRNAVVVDVRESGEYAAGHLPQAKHAPLGE
    LEGKAPSLAKNKETPIILV
    CQTGQRAGRAQAVLKQAGYSEVYSLEGGLAAWQQAGLPVVK

    >gi|241661850|ref|YP_002980210.1| glutaredoxin 3 [Ralstonia pickettii 12D]
    MAHVVMYSTTVCPYCVAAERLLKQRGVEQIEKILIDREPGKREEMMTRTNRRTVPQIYIDERHIGGFDDLSALDREGGLV
    PLLAA

    >gi|241661868|ref|YP_002980228.1| electron transport protein SCO1/SenC [Ralstonia pickettii 12D]
    MTMLSFRHFRAALFAMLAVAVLALAACSDKPAFKNLDITGSKSFGTDFSLTDHTGKRRTLEDFRGKVVVMFFGYTHCPDV
    CPTTLAELRAVMDTLGKDADRVQVLFVTVDPERDTQDLLAKYVPAFDPRFIGLRPANEAELKKVASDFKVFYSKVPGSSP
    DNYTMDHSAGSYMFDPKGNLRLFIKHGQGPEPIAHDIKQLLAD

    >gi|241661871|ref|YP_002980231.1| OsmC family protein [Ralstonia pickettii 12D]
    MSIVVSKDTEGLFRHKVTFPEGVTYTDVPKPTGEGSAPDPHAYFDAALASCKALTVTLYARQRKYPLDSIDVAVEHDGTQ
    ERQGRYKLRTVLTLHGDLSDEQRADLLRVAGK
    CPIHKLMTEVEISVDTELAEHA

    >gi|241661929|ref|YP_002980289.1| cytochrome c biogenesis protein transmembrane region [Ralstonia pickettii 12D]
    MTLFIISFLGGALTVLAPCILPVIPFVFARVDQPFVKSGLPMLVGMASTFAAVGTLGAAAGSWAVEANEYGRIAATALLG
    LMGAAMVFPRLAERLTRPLVSVGLDLSNAANAHTAMAGNCVLPSFIRGVATGLLWAPCAGPILGLILTGAVLQGPNVKTS
    LLLLAYGAGAVSSLALVLLTGHRIFAAMKRSLGIGEWFRKGLGITVLSGAVVVMTGVDTGWLAQVSSGSVEASVERMLLQ
    HFAPRQTGKMPIVDGQQQAKRNAPGGRLILVQAQQNRQPLNLPVEGLFPPLTGAVDWLNSPPLTVEALRGKVVLVNFWTF
    G
    CINCRNVLPYVREWDRKYKDQGLVVVSVHAPEFAYEKNIENVKRAASELGATFPIAIDNRFEIWKAFNNNYWPANYFID
    SQGRIRFHHFGEGEYEKSERAIQQLLKEARVGNRPVPMTATTLEKLNAALALQRAGDFVAAGGGAG

    >gi|241661947|ref|YP_002980307.1| protein of unknown function DUF395 YeeE/YedE [Ralstonia pickettii 12D]
    MSIDFTHFTPGAALVGGLIIGLAAAVLVLGTGRIAGISGIVGGLLLRPRGDMDWRIAFLIGLMGAPVVAALLGHPVVPEI
    AAGWGEVLAAGFLVGIGTRYAGG
    CTSGHGVCGLSRGSVRSLVATLSFMTAGIVTVFVVRHVFGG

    >gi|241661998|ref|YP_002980358.1| OsmC family protein [Ralstonia pickettii 12D]
    MDCTVSWTGPDGMAFLAETGSGHLVTMDGAPDGGGRNLAPRPMEMVLLGTGGCTAYDVVLILKRGRQDVQGCSVKLHADR
    AETDPKVFTRIHFTFTVTGRNLKRETVERAVQLSHEKYCSASIMLAKTAEITHSLELVDLATQPTASE

    >gi|241662003|ref|YP_002980363.1| iron-sulfur cluster assembly accessory protein [Ralstonia pickettii 12D]
    MNAVAQAATPDVNEVPAPLVFTDSAADKVKQLIEEEGNPELKLRVFVQGGGCSGFQYGFTFDEETNEDDTTMTKNGVSLL
    IDSMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV

    >gi|241662222|ref|YP_002980582.1| Rhodanese domain protein [Ralstonia pickettii 12D]
    MQQLAPTTLAQWLADASRAKPVLLDVRWTEEVEICAIPGITHIPMDQIPARASELNADQDIVCICHHGGRSAQVAQFLIQ
    RAGFDAARVYNLQGGVHAWANQVDPQMATY

    >gi|241662235|ref|YP_002980595.1| thioredoxin [Ralstonia pickettii 12D]
    MKNDLHLVCPHCQSINRVPTAKLSEHPNCGRCQQPLFTGEPIELTTATFSRHVERSDLPLLVDFWAPWCGPCKMMAPQFQ
    QAARQLEPRVRLAKVNTEAEPHLAAQFGIRSIPTLALFQGGREIGRQAGALGAQDIVRWASAQVGR

    >gi|241662260|ref|YP_002980620.1| arsenate reductase [Ralstonia pickettii 12D]
    MSHITIYHNPACGTSRNVLGLIRNSGEEPTVIEYLKTPPDRATLKALIAAMGVPVRAVLREKGTPYAELNLSDPKWSDEQ
    LIDFMLQHPILINRPIVVTPLGTRLCRPSEAVLDLLPQPQRGAFNKEDGEPVVDAEGRRV

    >gi|241662297|ref|YP_002980657.1| DSBA oxidoreductase [Ralstonia pickettii 12D]
    MRIPRFAPSRTVLVVALLAAAALTTAAWLGLRPPSPPAEPDSPSAEATPAPATAPAGPPWRYGRADARFTVVEYADLECP
    FCRAYFAVLKRWIDAHPDVSWQWHHLPLPLHEPAASAGARLVECVGEAGGQAAFWQAAEWVYTHTRGDGQGLPEGLRYPD
    LTPAAQHCLDSDRPDTLIRAQSASAAQEGIKVTPTLRLQDRQSGKTLLLHGPVEGDALLSAIDLLAAGAATEPASKEMPA
    ESLGDMPR

    >gi|241662383|ref|YP_002980743.1| Peroxidase [Ralstonia pickettii 12D]
    MSLRLGDIAPDFEQDSSEGRIKFHEWLGNSWGVLFSHPADYTPVCTTELGLTAKLKDEFAKRNVKAIALSVDSVESHKGW
    INDINETQNTSVNFPIIADPDRKVSQLYDMIHPNASETFTVRSLFVIDPNKKIRLTITYPASTGRNFNEVLRVIDSLQLT
    EYHSVATPGNWQDGDDVVIVPSLKDEEVIKQKFPKGYKALRPYLRLTPQPNK

    >gi|241662397|ref|YP_002980757.1| peptide methionine sulfoxide reductase [Ralstonia pickettii 12D]
    MENQQLNQDNEPSKSVEIATLGGGCFWCLEAVFQEVQGVQSVVSGYAGGHVDRPSYRAVCSGNTGHAEVVAVKFDPAVIP
    YREILDIFFAIHDPTTVDRQGNDVGPQYRSAIFAQTPEQLATARTAIAELGASDIFEAPIVTELVDAADGKVTFWRAEDE
    HQNYFRDHPAQGYCAFVISPKVAKFRKQFAHRLQG

    >gi|241662409|ref|YP_002980769.1| thioredoxin [Ralstonia pickettii 12D]
    MSDITSQNFAQEVVETSRQIPVLVDFWAPWCGPCRTLGPMLEKLEAEYAGKWKLAKINSDENPELSAQFHVRSIPYVVAF
    VDGKPVDQFVGVLPEAQLRAFLDRVIPQPAEVAYREGLAASQAGEIAHAREAFQNALAFDPGFDAARFALVNLLLDTGDA
    HAAQGEFALLSPKAPQDARYAPLETRLRATERADTLPDAGALRTVVQAQPDNLQARLDLAQQYIAGQDYEAALEQLLAIV
    ERDRAFRDDIARKTMVSVFDMMRDAPQAVSHWRRQLASKLN

    >gi|241662563|ref|YP_002980923.1| iron-sulfur cluster assembly protein IscA [Ralstonia pickettii 12D]
    MITLTDKAAQHVSRYLTRRGKGVGLRVGVKTTGCSGLAYKLEYADEIATEDQVFESNGVKVIVDPKSLPYIDGTELDYAR
    EGLNEGFRFNNPNVKDECGCGESFRV

    >gi|241662601|ref|YP_002980961.1| glutaredoxin 2 [Ralstonia pickettii 12D]
    MIELTLYGRTYCHLCEDMKNALEPLRRGFSFVLHEVDIDSDPALEARFDELVPVLMTGAPETPPEDARELCHYFLDVQAV
    QAWLTAQSAHN

    >gi|241662681|ref|YP_002981041.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia pickettii 12D]
    MTSATTLVANSPQPVEQRIDVLVVGAGPVGLFAAFQAGVLGLSCVLVDALDRPGGQCTELYPEKPIYDIPALVSCTAQEL
    VDRLMAQCAPFNYPILCGRRAETVETLESEHGRRFRVTTSAGDVFDCAAVLITAGNGAFTPQRVALPEAAALEGRHLHYA
    VRDTARFAGKRVVIAGGGDSALDWALALRKVAARVTLVHRREGFRAADASVAEMRAAVAAGEMDFVLGMLSRLDSTPDGT
    LTGAAIRGRDGETVLPCDELIALYGLVSEPGPIVNWGVEMRAGRITVETTAYETSRPGVFAAGDIALYPNKQKLILSGFH
    EVAMALRRAYRYANPDKTLVHTHSSNDAGLQTKLHVTAE

    >gi|241662728|ref|YP_002981088.1| thioredoxin [Ralstonia pickettii 12D]
    MSEQIKYVSDASFEADVLKSDKPVLVDFWAEWCGPCKMIAPILDEVSKDYGEKVQIAKINVDENQGVPAKFGIRGIPTLI
    LFKNGAVAAQKVGALSKSQLTAFLDSHL

    >gi|241662796|ref|YP_002981156.1| dihydrolipoamide dehydrogenase [Ralstonia pickettii 12D]
    MSKEFDVLVIGAGPGGYIAAIRAGQLGLNVACCEDNPYDDPKGEPRLGGTCLNVGCIPSKALLASSEEFENVNHHLADHG
    ITVDGVKVDVAKMLKRKDDIVGKMTKGIEFLFRKNKVTLLKGHGKFVGKTDAGYQVEIAGKAGTEVVTAKHVIIATGSKA
    RHLPGVKVDNVTIADNEGALKFGEVPKKLGVIGAGVIGLELGSVWRRLGAEVTILEALPSFLGAADESVAKEANKLLTKQ
    GLKINVGVKVGEIESSAKGVKVNYTDAAGSAQVLECDKLIVSIGRVPNTDNLGLEAIGLAADQRGFIEVDEHCATKLPNL
    WAIGDVVRGPMLAHKAEDEGVAVAERIVGQKPHIDYNCIPWVIYTYPEIAWVGKTEQQLKAEGRETKAGQFPFLANGRAL
    GMGASDGFVKVIADAKTDEILGVHIVAANASDLVAEAVVAMEFKAAAEDIGRICHPHPSMSEVMREAALAVDKRQLNM

    >gi|241662799|ref|YP_002981159.1| heavy metal translocating P-type ATPase [Ralstonia pickettii 12D]
    MTTTFAPIHPTAPVAGKGSPVGPSGAGASHITCYHCASPLEGATAVHADIGGKSREFCCAGCQAVAQTLHASGMGHVYDG
    PIAFAKPIEGDRRTEAEAVWATYDLPVMRERFVRTRADGAEELSLAISGMR
    CAACVWLIERALSRVPGMREATVNYATER
    ARIVGDAGVIRLSAVFAAIADVGYEAWPDQPSARRTAEARERRSLLIRLGLAMLGMMQVMMYAWPVYLHGGDIPVNQTRL
    MQWASLVLTVPVVLISARPIFINAWRQVRHAHVGMDAPVALGIGAAFIASVFATLRGHGETYFDSVTMFVAFLLAARYLE
    LRARQSAASGAEALVRQLPATCRRFNAVSGALETIPVATLQQGDCVEVRAGEVLPADGTIEHGTTEIDESLLSGESVPRP
    RDVGATVLAGSYNVVSAIRVRVNRVGTQTRLAAIVDLLERALTDKPRMAELADRVAGRFVAVLLGWALLTAIAWWWIDPT
    RVFAVTVAVLVVSCPCALSLATPSALAAASGALARRGVLVTRGHAIESLAAVTDVLLDKTGTLTEGRLRLLSIETFADVD
    AEHCLALACAMEQSENHPIAQSLRAGTSNAMPLPTLGRVKNVPGQGVYAMAENRLMRLGTQSFAATHYANQPVATIRYGA
    EAPMEEVPPAAACTSVWLGRDGQPLARFTLADTPRADAPACLGALRAQGLRLHLVSGDAPETVHWWANRLGIDHAVGGSS
    PEDKRAYVHKLQADGARVLAVGDGINDAPLLAQAQVSIAIGSGAPLAQAGADAILTEPRLIAISEAVSIGRRALRVVRQN
    LGWAFAYNAISIPMATLGWLSPLAAGIGMSVSSLLVALNAWRLSRAV

    >gi|241662822|ref|YP_002981182.1| Rhodanese domain protein [Ralstonia pickettii 12D]
    MTSSVTAQTLKAWLHDGAEIALFDVREHGQYGEAHLFYAVPLPYSRHEIDAPRLAPRRAVRMVVYDDDDGVADRAAGRLS
    TIGYTNVHVLQGGAQAWAQAGFTLFAGVNVPSKTFGELVERAYHTPRVTARELAAMLERSDDVVIVDGRPVCEYLKMTIP
    SSICCPNGELGLRIRELVPDATTPIVVN
    CAGRTRSIIGAQTLISLGIPNPVMALENGTQGWYLEDLPLEHGSTRRYPDVV
    APATVKDMREASQQLAVRFAVPEVDAATLARWVAQDEHSLYLCDVRTPEEFASGSLQGAQHAPGGQLIQATDQYVGVRNA
    RLVLFDADGVRAPIVASWLRQLGHDAYVLRDGLDSHASLAVTTTALPQPLPEFSAQALATALAAGTAHVIDLRPSMSFRR
    AHVPGATWAIRPRLPALAPDRDTVLIADDPRIAALAAADWSARAPEAASRLNLLAGGIAAWTAAGYATEGSDSAPPDADC
    IDYLFFVHDRHDGNKAAARQYLAWETGLLAQLDAQELGAFRVGAAAAQP

    >gi|241662854|ref|YP_002981214.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ralstonia pickettii 12D]
    MPVTIDKPLPDFSAPATSGITFSPASQRGKIVVLYFYPKDNTPGCTTEAMNFRDQYDAFEAAGAVVFGISRDSLKSHENF
    KAKLEMPFELISDADEAVCNIFDTIKMKKMYGKDVRGIERSTFLIDSKGVLRKEWRGVKVPNHVDDVLAAVRAL

    >gi|241662913|ref|YP_002981273.1| Disulphide bond formation protein DsbB [Ralstonia pickettii 12D]
    MQANSRAFFLLIAVISFGVVGYALYLQHVEGLQPCPLCILQRFAFLGIGVFSLLAALSSATRLLWHGLGMLSGLAGLCVA
    GYHVSLLLNPKAT
    CGIDPIENWVNALPTAKWLPQVFEADGLCVGPMPPVLGLSVPVWSLIWLLILSLTLVVGMIRRERR

    >gi|241662929|ref|YP_002981289.1| arsenate reductase and related [Ralstonia pickettii 12D]
    MTTLHGIPNCDTVKKARTWLESNGVAYTFHDFKKQGVSADMLAGWLKHVPLATLLNRKGTTWRALSDADKARAEDEAGAI
    ALMQANPSLIKRPVLVHGKSVNVGFSADQYAALF

    >gi|241663096|ref|YP_002981456.1| protein of unknown function UPF0061 [Ralstonia pickettii 12D]
    MTASPAALPDDSLASPFDWPGRPAAAPGFSALGERFLTRLPPMPMPAGAIGEPYLVGFSPDAAASLGISRAELDTAAGLA
    VFTGNAVATWSDPLATVYSGHQFGVWAGQLGDGRALLLAEFQTADGPYEVQLKGAGRTPYSRMGDGRAVLRSSIREFLCS
    EAMAGLGIPTTRALCVTGADAPVRREEIETAAVVTRLATSFVRFGHFEHFAASEQLPQLRALADYVIDRFYPASRSEPQP
    YLALLREIARRTAELMADWQAVGFCHGVMNTDNMSILGLTLDYGPFGFLDGFDANHICNHSDSGGRYAYAQQPQIGYWNL
    FCLAQALLPLFGEDPHVFVNLSDEAQAQPAIDAAQNVLLTYRDVYGAAFYARYRAKLGLSTAQDADEALFGDLFKLLHNQ
    RADYTLFFRHLADVRRDDTPAAAEARTVRDFFFDRAAADVWLAAYRQRLQAEPQSDDERAAAMQRVNPKYVLRNHLAEIA
    IRRAKEKDFSEVENLRAVLARPFDDHPGFEHYAQPAPDWASSLEVS
    CSS

    >gi|241663097|ref|YP_002981457.1| methionine-R-sulfoxide reductase [Ralstonia pickettii 12D]
    MTVKKSDAEWRDQLSDIEYRVTREAATERPFTGKYWDHWERGVYNCVCCGTPLFESSTKFDAGCGWPSYFQPINGEVIDE
    KTDRSHGMLRIEVQCKNCGAHLGHVFEDGPAPTGLRY
    CINSAALKFGD

    >gi|241663167|ref|YP_002981527.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ralstonia pickettii 12D]
    MKTIGDKLEPFKVVGVKPGFNNHEENGESAFEDITETSFPGKWKVIFFYPKDFTFVCPTEIVAFAKLNDDFADRDTIVLG
    GSTDNEFVKLAWRREHKDLNKLNQWSFADSTGALVDQLGVREHEAGVALRATFIVDPDNVIQHVSVNNLNVGRNPDEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|241663212|ref|YP_002981572.1| dihydrolipoamide dehydrogenase [Ralstonia pickettii 12D]
    MSVVEIKVPDIGDYKDVDVIEVMVQAGDAVTVDQALITLETDKATMDVPSDVAGKIVEVKIKVGDKVSQGTVIATAEAGA
    AAAPAPAQAPAPAATPAAAPAATAPAPQASKHAGGADIECEMLVLGSGPGGYSAAFRSADLGMSTVLVERFSTLGGV
    CLN
    VGCIPSKALLHTAAVMEEVKAMAAHGIVYSEPTVDINQLRKHKESVIGKLTGGLAGMAKARKVQVVRGVGAFLDPNHLEV
    QLTDGDGKATTGEKKVIRFAKAIIAAGSEAVKLPFIPEDPRIVDSTGALELREVPAKMLVIGGGIIGLEMATVYSTLGAR
    IDVVEMLDGLMQGADRDLVKVWDKMNKGRFDKVMLKTKTVGVEAKPDGIYVKFEGEAAPAEPQRYDMVLVAVGRAPNGKR
    IGAEKAGVAVTDRGFIDVDKQQRTNVPHIFAIGDIVGQPMLAHKAVHEGHVAAEAAHGEKAYFDAKQIPSVAYTDPEVAW
    AGLTEEQCKAQGIKYGKGVFPWAASGRAIANGRDEGFTKLIFDEETHRIIGGGIVGTHAGDLIGEVCLAIEMGADAVDIG
    KTIHPHPTLGESVGMAAEIYEGVCTDVPPARKR

    >gi|241663234|ref|YP_002981594.1| alkylhydroperoxidase like protein, AhpD family [Ralstonia pickettii 12D]
    MLNWVEYRKELLGRIGEIGQITPDTVKGYKTLSAATTGSLDAKTRELIALAVAVTTRCDGCITVHTAEAIKHGATHEEIA
    DALSVAISLNAGAALVYSARVMDAVQAYEKA

    >gi|241663360|ref|YP_002981720.1| uncharacterized peroxidase-related enzyme [Ralstonia pickettii 12D]
    MTEIIRAHGFTNESLEWQAWLDVVDLDRATPEQIAVLEESHPKAKTSDYYRFLVHQPEILRQRSAAFNAIMYAPGGLSRA
    ERELASAVVSRVNGCVY
    CASVHAQRFEQLAKRNDVIKQVFEDPHIAGTNARERAIVLFSIDLTLRPGDVRGEDLKPLKDA
    GLTDAEILDLIHAVAIFAWANRLMLNLGEPVFPGAA

    >gi|241663593|ref|YP_002981953.1| uncharacterized peroxidase-related enzyme [Ralstonia pickettii 12D]
    MTTITPPISRFPVPELADIPEDIRARILEVQEKSGFVPNVFLALSHRPDECRAFFAYHDALMLREGSSLTKGEREMIVVA
    TSAANQCLY
    CVVAHGAILRIYEKKPLVADQVAVNYRKADITPRQRAMLDFAMKVCTASHTVNDADYEALRAHGFDDEDIW
    DITGITAFFGLSNRMANVISMRPNDEFYLLGRVPREKK

    >gi|241663629|ref|YP_002981989.1| Rhodanese domain protein [Ralstonia pickettii 12D]
    MSERAHYATLITAPQLAALQQSAPEAVVVIDCSFDLANPAAGRDAYHASHVPGAFYMHLDNELSGPKTGTNGRHPLPDAE
    ALVARLQALGVNDDTQVVAYDRQGSMYAARLWWLLRWVGHADVAILDGGLQAWEAAHFPVDQVVPEEPQLNATPGNITRK
    PSLVQMVTAEIVQKYLGHADKPVVDARAPDRYRGENETLDPVGGHIPGARNRFFRDNLQADGTFKPAEQLRADFTAVLAG
    ARPQDATLQ
    CGSGVTACHNALAMEIAGLTGAALYAGSWSEWCSDPSRPVATGPNP

    >gi|241663739|ref|YP_002982099.1| thioredoxin reductase [Ralstonia pickettii 12D]
    MAKHAKVLILGSGPAGYTAAIYAARANLNPVLVTGLAQGGQLMTTTDVENWPADKEHLQGPELMQRFLEHAERFKTEVLF
    DHIHTAHLNEKPIRLVGDSGEYTCDALIVSTGASAQYLGLPSEEAFAGRGVSA
    CATCDGFFYKGQEVAVVGGGNTAVEEA
    LYLANIASKVTLIHRRDKFRAEPILIDRLHEQEKKGKIEIKTNMVLDEILGDDSGVTGARLKGTHENEGKTEEIKVAGVF
    IAIGHKPNTDIFRGQLDMNDTGYIRTKSGLDGMATATNIPGVFAAGDVQDHIYRQAITSAGTGCMAALDAQRYLESLE

    >gi|241663955|ref|YP_002982315.1| methylated-DNA/protein-cysteine methyltransferase [Ralstonia pickettii 12D]
    MYRHIFACPLGDLLLTATETHLTGAFFPGQKTIPMSAARMSPGADIPIIREAQAQFTAYFAGKLHDFALPMAPEGTAFQQ
    DVWRLLRDIAFGNRTTYGQITAQLGLTREHARAVGTAVGRNPISIAIP
    CHRVVGADGALTGYAGGLPRKAALLRMEGHPA
    QVGERLPMPGDGRQGLLALLPA

    >gi|241663998|ref|YP_002982358.1| methylated-DNA/protein-cysteine methyltransferase [Ralstonia pickettii 12D]
    MPSPFDAVLEAPFGKLGVRVANGALRELAYLPESTPTVDSSDALIARLARQLDAYYSDARATFDIPLAPAGTDFQLRVWQ
    AISAIPCGSVITYGTIAQQIGSVPRAVGQACGDNWFPILIP
    CHRVVSASGIGGFSHHTDGYLLNIKHWLLRHEGVMLI

    >gi|241664031|ref|YP_002982391.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Ralstonia pickettii 12D]
    MKLRYVLPLAAFFVLVIALAAGLSRDPRELPSPLVGKPAPAFRLTALESTAGPITPQDLHGKVWMLNVWASWCTACRAEH
    AVLNAFAKQSSVPIYGLNYKDDAAAARAWLKQMGDPYVASLIDADGKVGIDYGVYGVPETFVIDRAGVVRYRQVGPVTAE
    SMERRIVPLLQQLEQEGGHA

    >gi|241664034|ref|YP_002982394.1| transcriptional regulator, AraC family [Ralstonia pickettii 12D]
    MQSSARPVPDTTLVEHDPRWARVLARDASADGQFVYAVKTTGVYCQPSSPSRLPRPENVEFFDTPADAEAAGYRPSRRAG
    PDQTTVRAQQAALVAQACRRIEAADTPPTLDALAQDAGLSPYHFHRLFKSVTGLTPKAYADAHRARKLRAQLERGSSVTE
    AIYDAGFNASSRFYEASDNVLGMTASRYRAGGAQTTIRFAVGECSLGSILVAQSDRGICAILMGDDPDALVRDLQDTFPK
    AELIGGDVGFEDLVAKVVGFVEAPSIGLDLPLDVRGTAFQERVWQALREVPPGSTISYTEIATRIGAPQAVRAVAQACAA
    NHIAVAIP
    CHRVIRRDGNASGYRWGVERKLALLEREAQSAA

    >gi|241664051|ref|YP_002982411.1| putative thioredoxin protein [Ralstonia pickettii 12D]
    MLHSTATSPDAHGAIPVDKTAFAAFGMREVNTETFDAAVAAAGDALVCVFFWGVDCFNCEMAKKAMLAQSGAVRELGLKW
    LHANVYAHPELGQRFALHGIPVFMFFHRGKKLGRATGWHGHAQFAAAVANARNKLAGKPLV

    >gi|241664088|ref|YP_002982448.1| Glutathione peroxidase [Ralstonia pickettii 12D]
    MTDVYAFEADSLTGQRVPLSQYRGKVLLIVNTASKCGFTPQYAGLEAVYKRLHDKGLEVLGFPCNQFGKQEPGGADEIGA
    FCEKNYGVSFPMFGKIDVNGSNAHPLYKWLTSEKPGVLGIGAIKWNFTKFLLRRDGTVYKRYAPLTKPEEIADDIERLLA
    EPDPA

    >gi|241664201|ref|YP_002982561.1| Redoxin domain protein [Ralstonia pickettii 12D]
    MSRRTTLTALLMAGLIAAVTGLYFGHRATEPKTPADTAVAAFYSSKLPDANGAPLDLAAFRGQPVVINFWAPWCGPCVEE
    MPELSALAQEQKAKAKFVGIGIDSASNIQTFLGKVHVTYPIAVAGFGGTELGRQLGNEVGGLPFTVILNAQGEITFRKMG
    RVHADELREALQRT

    >gi|241664208|ref|YP_002982568.1| Redoxin domain protein [Ralstonia pickettii 12D]
    MANVTLGGNPIEVGGQFPTAGSKAPAFTLVGADLKDVSLADFAGKRKVLNIVPSLDTPVCATSTRKFNEAAAKLDNTVVL
    SISADLPFAAGRFCTTEGIANVKPLSTFRDKGFKQAYGVDITSGPLAGVTARAVVVLDADDTVLYSQLVPEIKDEPNYDA
    ALAALK

    >gi|241664301|ref|YP_002982661.1| Redoxin domain protein [Ralstonia pickettii 12D]
    MIQPGQPLPDATLYEFFEVEKDGCALGPNAFSVQHLAEGKTIVIFGLPGAFTPTCSARHVPGYLANYDALRAKGVDEIWC
    VSVNDAFVMGAWARTQGTDDKIRMLGDGSAEFTSKLGLDQDLSKRGMGVRSQRYAMVVKDGVVTALQVEAPGQFSVSSAE
    SILAVL

    >gi|241664351|ref|YP_002982711.1| thiol:disulfide interchange protein [Ralstonia pickettii 12D]
    MSFRIRVAAIASAVAVAAIGAGYVLSAGAAEPALDKVKATVQKALGPNVEIKSVAKSPLAGLYEINLGSQVVYSDATGRY
    VLNGDLLDTQTATNLTQERLAELNRVKWSDLPLDRAVKWVKGNGARKIAVFSDPN
    CPYCHKLEQMLTQVDNVTVYTFLFP
    ILSEDSNTKAKQIWCSADRAKAWRDWMTAKTAPGGAGTCDTPLEANLKLGQQLNVTGTPAIIFPDGSRAPGLIDAATLER
    KFAALKKS

    >gi|241664384|ref|YP_002982744.1| glutaredoxin-like protein [Ralstonia pickettii 12D]
    MSTTHEKIDQIVKGHPVVLFMKGTAQFPMCGFSGRAIQILKACGVDRPHTVNVLEDDEIRQGIKDYANWPTIPQLYINGE
    FIGGSDIMMEMYQSGELQPLLAA

    >gi|241664438|ref|YP_002982798.1| Glutathione S-transferase domain protein [Ralstonia pickettii 12D]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLFNFEKELFTHVSVLENEKGKAAEKNHEKARAAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIEVSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR

    >gi|241664503|ref|YP_002982863.1| Protein-disulfide reductase [Ralstonia pickettii 12D]
    MRRVLQLLMLLMAVAMLRVPAYGGDEFLPPEQAFRFSAMQVDGQTVEVKFGIADGYYMYRERLAVAADPATVTFAPLELP
    AGKIKRDENFGKEVETYRHELVFHVRAQSASVPFTLIVTSQGCADQGLCYPPMKSRFQVRPSSASVVPVAPAATAADSIE
    PEGKQGRIASTLDSGNLGAIAALFFGLGLLLTFTPCVLPMLPIVSAIVVGEHATRMRAAFVSVGYVLGMAIVYTALGVAA
    GLAGQGLQAALQNAWVLGAFALLIALLSLSMFGLYELRLPAAWHHHLTQASNKLSGGQVVGAAVMGALSALIVSPCVTAP
    LAGALVYISQTGNAAVGGTALFALSMGMGVPLILVGVGAGNLLPRSGHWLVVTKAVFGFILLAVAWYIVQPVLPSWVAMV
    GWGALLIGAAVFLRTFDSLPDGAGNVQRLGKVIGVVLALAGAAQLVGVAAGGRDPLQPLAGVLRASTVASTSTLTFKRVK
    SVTELGAEVRNASAAGKPVMLDFYADW
    CVSCKEMERLTFTDVRVRKALADVVLLQADVTANNADDQALLKRFGLFGPPGT
    VFFDTQGREVQARVIGFERADTFLASLRRALGASGAAQPAKAST

    >gi|241664678|ref|YP_002983038.1| OsmC family protein [Ralstonia pickettii 12D]
    MSIENVLYRANARATGGRDGRAITDDGRLDVRLTTPTELGGAGGEGTNPEQLFAAGYSACFLGAIKFVGARDKIRVPADV
    SVQGTVGIGVIPNGFGIEVDLKISLPGMDPAEAQTLIDRAHIV
    CPYSNATRGNIDVRLSLV

    >gi|241664681|ref|YP_002983041.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ralstonia pickettii 12D]
    MRSDADMNPMQGPGPRRAWLRAAGALAMGAGLGGRQAAAHAASLEVGRPAPPLVLHTLDGRSIATDDLRGQVVILTFWAT
    W
    CGPCRTELPLLSAYAARHADKGLRVLGFSLDEPAELPAVREVAAKLSFPVGLLGSAYAGGYGRIWRLPVNFTVDRKGLL
    ADNGWDSREPAWTAERLERVVTPLLR

    >gi|241664703|ref|YP_002983063.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ralstonia pickettii 12D]
    MHTLRRFLMWTAAAIVFAATQFANHAQAVEVGDVVALPDVQLLDGTRVPGDAWHGHPVIIATWASWCPFCALQNPRLQKL
    YDATRGTDLRILTISIDANPQLAKDYVAKRRFTFPVTMETDALCAATGPRKGLPELLVLDAKGRVVRKEVGEMLEDDVAD
    LARYAHSPKQ

    >gi|241664720|ref|YP_002983080.1| arsenate reductase [Ralstonia pickettii 12D]
    MQIYHNPRCSKSRSALEQAQSFTAKNGEQLEVIEYLTTPPTLADLKQLAAQLDTPLRSLIRENEDEYAHLNLADASDDAL
    LKAIAAHPKLLQRPVLVRNGRAIIGRTPEALDAFLK

    >gi|241664758|ref|YP_002983118.1| Glutathione S-transferase domain protein [Ralstonia pickettii 12D]
    MKLYYSAGACSLAVHIALREVGAQFDLTAVDLTKHLTADGTDFYTISPRGYVPLLELADGSRHTEGAALLQYVADLDPAQ
    ALIGKPGSAHRLAVIEWLAFVSTELHKGFGPLWYKDTPEATRQGAKDKLAKRFAELDARLAKQPYLADTYSVADSYAFAV
    LNWTNILALPMGAYPNVQAYMARVAARPHVVEALTAEGLIKADATSAVA

    >gi|241664796|ref|YP_002983156.1| heavy metal translocating P-type ATPase [Ralstonia pickettii 12D]
    MTAASLPDVPSTDLDIGGMTCAACAGRVERALRAVPGVTEASVNLATERARVQGGAASDALIAAVTAAGYEARVATDETA
    AAPAAAEPDFWEGAGPVCIAAALSVPLVLPMVAGWFGGDWMLPAWVQWLLATPVQFVIGARFYKAGWKALRAGAGNMDLL
    VALGTSAAYGLSLWLWWRAGADGMHHAPHLYFESAAVVITLVRLGKWLEVRAKRQTAQAIRALQALRPDTARVRGADGTL
    RDTPVAQVRVGDVVSVRAGERIPVDAVVLEGASHVDESMLTGESLPVPKREGDHVTAGAIATDGVLLVRTTAVGADTMLS
    RIIRLVEDAQAAKPPIQQLVDRVSAIFVPAVLVAAVLTLAGWFIAGAAWETAIVNAVAVLVIACPCALGLATPSAIMAGT
    GAGARRGILIADAQALERAQQVDFVVFDKTGTLTVGQPRVTAVEAASGIDADTLLDQLAALQAENTHPLAQATRDYAKER
    GRAITPAQSPEVLAGRGTRGIVNGASLQLGNARWMDELGLDRSALQARADALEAQGNTVSWLAQRDEGGVQLRGLIAFGD
    ALKPGAKEAVAALQARGVRTALVTGDNAGAAHSVARALGIDEVAAQVLPQDKAARVTAWQQGGHVVAMVGDGINDAPALA
    AADVGIAMATGTDVAMQAAGITLMRGEPRLVNDALDLSRRTVTKIRQNLFWAFIYNVVGIPLAAFGLLNPTFAGAAMAFS
    SVSVVTNALMLRRWRATGDKA

    >gi|241664868|ref|YP_002983228.1| alkylhydroperoxidase like protein, AhpD family [Ralstonia pickettii 12D]
    MEPLLDFYQSNPAAIQAVMGLEKALGRSTLEKPLTELVRLRASQINGCAYCVDLHTADARKGGEDDRRLATVSVWHETPF
    FTDRERAALAWTEAVTLVAETRVPDDVWQAVRAQFSDAELVDLTLLVSTINTWNRLAISFRKLPA

    >gi|241664935|ref|YP_002983295.1| Thioredoxin domain protein [Ralstonia pickettii 12D]
    MPLLSPDSDAAALHAGIRSGQLLVACLCAEWCGTCRSYRTTFTELAQRHPECCFVWVDVEDHADALGDFDVENFPTLLVQ
    RGSDVLFFGPVLPHAGVVEGLISRDLGVAPAVPAAPDLRGWLLEST

    >gi|241664995|ref|YP_002983355.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia pickettii 12D]
    MAANPAHAFDLIVIGAGSAGLAAARRSAQLGARTLLIDRAQVGGTCVNRGCVPKKLLRYGAAWSQTMARCLLAAHTSDAS
    EAWADAIARTRAEVARLHEAHVVQLADAGVQWLSGMASLRGRGIVRVQAESGKTTLRARQIVLAAGARPTPLPVPGAELA
    CTSDDVFGWDTLPASLIIAGGGVIAVEMASTLARFGVRVTVLTRDARVLPEFDATVAEAAAQSLAGCGVDLILNADVVRV
    ERDAVNGGGVAVYASAEGSDVPRVLRAQRMLSAIGRTSNIAGLGLEAAGVTLDAHGRIAVDRHFRTRARGVHAVGDVCGG
    SPLQLTPVAVAQGRYVAERLFGKGIKLPDMNTVPMAVFCDPAIASVGLTEADARTRWPELGKRGPDTDKRALADRIDVVV
    RRFVSLEQRFAGSGMESLIKLVCNARSGRVLGAHIVDNAAPEIIQALAVAVRMGVRLKHLQSTVGLHPTVAEELLSM

    >gi|241665094|ref|YP_002983453.1| alkylhydroperoxidase like protein, AhpD family [Ralstonia pickettii 12D]
    MSYIKTLAAVDQASAEGKQKEILDKARQQVGFIPNMYANMANAPAVLDTYLHGYGLFRGESGFSPAEQEVVFLAVSQVNG
    CNY
    CTAAHSMIADKMSGVPAPVLAAIRERQPIPDAKLAALFDLTQDIVRTLGMPNEGKVDAFLDAGYREQDVLYIILAVA
    VKVLSNYSNHAFGTEVDSRFSAYRVG

    >gi|241665099|ref|YP_002983458.1| Thioredoxin domain protein [Ralstonia pickettii 12D]
    MKILRTISGLALAVSASVAMAGEIKPYTPQAFDQLTHAGKPVIVDVSATWCPTCKAQRPIVENLMKQAAYLDVTVLAVDF
    DTNRAALKKFKVNMQSTLVAFKGTSEVGRSVGDTTPSGIEDLIRKTVH

    >gi|241665107|ref|YP_002983466.1| disulfide isomerase/thiol-disulfide oxidase [Ralstonia pickettii 12D]
    MQPNVHPPSAMNHSRKTFSLGPVSWLTAVALSTASVAAYSQEKPAALQALEKKGVTIVGKMAAPTGLTAYAGFMEEQPVA
    LYVTPDGKHVIAGTVFDASGNDLTRAPLEEAVRKPMSERAWAELAHATWIADGRDSAPRKVYVFTDPN
    CPYCNKFWADAR
    PWVDSGKVQLRHIMVGILTPTSAGKAAALLADKNPAAALNAYEQSHVSLNAKVLSSGHPKPLDDAGLKPVATIPAAVKGK
    LDANERLMASLGFQATPAILWRDSDGALRMKQGVPASSLSEVLGPR

    >gi|241665220|ref|YP_002983579.1| Rhodanese domain protein [Ralstonia pickettii 12D]
    MHDLFPLLAEYGAFAVFLNVLLTQAGAPLPAVPTLLVGGALTLNGPLFFMELLPAAITGALLGDGLWYLAGKRYGRHVMA
    LLCRVSLSPDSCVRRTRTQFERWGAPLLLVSKFVPGLSTVSSALLGTMRTPFSTFVLYNLAGSALWAIIWLMLGRVAHDS
    IDQALRQLDLLGARAIVLILLLAVAYVTVRWLQRWRFRKMLEMVRISPDELHALIESGAAPVIVDVRADSSRQLQPQRIP
    GAVLYAMSSQHNAIEIDGPDREIVIY
    CACPNEASAVAVARTLMSRGFKRVRPLHGGIDAWIARGYGVEHVVPVTPATLQA
    AEARA

    >gi|241665239|ref|YP_002983598.1| OsmC family protein [Ralstonia pickettii 12D]
    MKTLYQTQVTAEGGRAGHVRSADGVLDLPLSLPRELGGAGGAATNPEQLFAAGYAACFENAVLHVARLKQIKLASTAVTA
    TVGIGPREDGGFALTVSLAATLGGVDQATAEALVMAAHGV
    CPYSHAVRGNIDVQLTTVTR

    >gi|241665298|ref|YP_002983657.1| OsmC family protein [Ralstonia pickettii 12D]
    MALNILYTAHATATGGRNGHTQTEDGQVSHNLSVPKSMGGPGKPDTTTPEDLFAAGYAACFGSACDFVAKSMLKLNPSNI
    EIHCDVGIGTRPEGGFGLKVGLTARISGLSHGDAEALVAKAHEV
    CPYSNATRNNVEVTLKTEVV

    >gi|241665304|ref|YP_002983663.1| heavy metal translocating P-type ATPase [Ralstonia pickettii 12D]
    MKPDHAPSLPSRDHAAKPETSGCGGCCVHYQLVATDTSRHAHDHDHNHAHEADAPVDAAARARASGRTTVRIEQMDCPTE
    ERMIRTKLGSAEGVVALEFNLLERHLTIHHTVDDVTPFLEALRAIGMGGEVLEAHDRAAAAPAEPAGISRRTWLLGAGGV
    AAFGAEVIAWSLGDHAWPVLALALASIALAGGPTLRKGWIALRALTFNINFLMAVAVIGALLIGKWAEAAMVIFLFAVAE
    AIEARALVRARDAVRALTAIAPDTAELADGNGGWRDVAVEAVGIGARLRVRTGSRVPVDARIVSGRAALDESPVTGESLP
    VEKTIGDIVLAGTIVTDGVIEAQATAVAADSTLARIAGAIQQAQAQRAPTQRFVDRFSSIYTPAMMVLALAVAVIGPLVT
    TEGWLAWTYRALVLLVIACPCALVISTPVTVVSGLAAAARRGIVVKGGVYLESGRRLRALALDKTGTLTTGRPVLDAVML
    PDGSRRAVAELHATTDAAHLRALAVAAALDANTTHPIAVAIVQAAAAHGAVAAGAIQDLSVLPGHGVAGTLGGVRWHLGN
    AALVADRGFDTSAWRAAADRLQAEGMSAVTLCDAGGAVALFGVRDRERPESAQAIADLRALGVLPVMITGDDRRAAQAIA
    RTVGIDQVRAEQLPEDKQRVVGELAAQHGSVGMVGDGINDAPALARADIGFAMGAAGTATALEAADVAIMDDDPRKLASF
    IRISRRTVAVLRQNIALALGIKAVFLALAVMGEATLWMAIFADVGASLLVVFNGLRVMRTRAA

    >gi|241665322|ref|YP_002983681.1| Glutathione S-transferase domain protein [Ralstonia pickettii 12D]
    MSIDTALPLLYSYRRCPYAMRARLAMLQARRPFQTFEIVMRDKPAELLALSPKGTVPVLRLTDGSVLEESWDIMRWALES
    PDADGWWSRAQSEDNLLLLNTNDGAFKRHLDRYKYPDRYPHEETTRETARANAVATLLTPLEARLQRQRYLGGRAPCATD
    LAIFPFVRQFAAVEPDWFDDQPLPALHAWLAQWLGSDLFAVCMTKRPVQIAAVFPTFQPIH

    >gi|241665575|ref|YP_002983934.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia pickettii 12D]
    MTQRFDAIIIGTGQAGPPLAARLSGAGLKVAIVERGRFGGTCVNTGCIPTKAMVASAYAARMAQRAAEYGVVIDGGVTVD
    MRRVKARKDEISGRSSHGVEQWVRGLEHGTVFQGHARFESARAVRVGDELLEAERIFINVGGRALVPPMPGLDQVPFLTN
    STMMDVDFLPEHLVVIGGSYVGLEFGQMFRRFGSRVTIVEKGPRLIAREDEDVSQAVREILEAEGIDVQVNADCLSVRRD
    GAGVVVGLECGSGAREVSGSHLLMAVGRVPNTDDLGLDKAGVEIDKRGNIRVDEQLRTNVPGIWAMGDCNGRGAFTHTSY
    NDYEIVAANLLDSDPRKVSDRIQAYAMYIDPPLARVGMSLTEAKQSGRTLLVGNRPMTRVGRAVEKGESQGFMRVVVDAQ
    THEILGASILGVGGDEAVHSILDVMYAKAPYTTISRAMHIHPTVSELIPTLLQSMEPEQ

    >gi|241665616|ref|YP_002983975.1| peroxiredoxin [Ralstonia pickettii 12D]
    MSLINTQVQPFKAQAFHNGKFIEVTDESLKGKWSVLIFMPAAFTFNCPTEVEDAADNYAEFQKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAQFPLVGDPTHALTNAFGVHIPEEGLALRGTFVIDPQGVIKTMEVHDNAIARDVKETLRKLKAAQFVAN
    NPGNVCPAKWNEGAKTIKPSLDLVGKI

    >gi|241665617|ref|YP_002983976.1| alkyl hydroperoxide reductase, F subunit [Ralstonia pickettii 12D]
    MLDADVKAQLKAYLERLVQPIELVANVDDSEGSRDMMDLLRDVAEQSSMIVLTEQRDAAERAPSFLIRRTGADVSVRFAA
    IPTGHEFTSLVLALLQVGGYAPKLEADVIEQIRNIEGDFRFETYMSLT
    CQNCPDVVQALNVMSVINPRIQHVAIDGALYQ
    GEIEARQIMAVPTVFLNGETFGTGRMGVEEILAKIDTGAAARDAEKLAAKEAFDVLIVGGGPAGAAAAVYAARKGVRTGV
    VAERFGGQVLDTLGIENFISVQETEGPKFAAALEQHVRQYDVDIMNTQRAVKLTPADKPGGFAEVTLANGAVLKGRSVIL
    STGARWRNVNVPGEQEYKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGLVSHVTLLEFASELKADAVLVRKL
    QSLPNATIVTNAQTTEITGDGQKVNGLRYKSRVDGVEHTVALEGVFVQIGLVPNTEWLDGALERNRFGEIVVDARGQTSA
    EGVFAAGDATTTPYKQIIIATGDGAKAALSAFDHLIRVPLAEAA