Ralstonia eutropha JMP134 uid58047

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|72383940|ref|YP_293294.1| alkylhydroperoxidase AhpD core [Ralstonia eutropha JMP134]
    MTTRLHTIPVQDATGQTAELFGAIRKAIGKVPNAYATIGSNAPAVLANALQTGQILKNGALSARELEAINLAVSEHTGCD
    Y
    CVAAHTLMGKLAGYSGQQMRQLREGSYPDDVKIDALVRFVLELVSTRGTVPAESVQAVRAAGYTDGQIVEIIQAMSAIL
    FTNMVNRVNDTALDFPAVA

    >gi|72383956|ref|YP_293310.1| alkylhydroperoxidase AhpD core [Ralstonia eutropha JMP134]
    MSKRLDYVQIAPAGVKALGGVYGYVMQSDLSPVLVDLVYLRVSQINNCAYCLDMHTRDLLKKGVKVEKLALVQAWREGGD
    LFDLRERAALAWAESVTLVAQTGVPDAAYEVARSVFNERELVDLTIAIGLMNTYNRMAISFRNTPQAVMEP

    >gi|72384297|ref|YP_293650.1| mercuric reductase MerA [Ralstonia eutropha JMP134]
    MTHLKITGMTCDSCAAHVKEALEKVPGVQSALVSYPKGTAQLAIVPGTSPDALTAAVAGLGYKATLADAPLADNRVGLLD
    KVRGWMAAAEKHSGNEPPVQVAVIGSGGAAMAAALKAVEQGAQVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRES
    PFDGGIAATVPTIDRSKLLAQQQARVDELRHAKYEGILGGNPAITVVHGEARFKDDQSLTVRLNEGGERVVMFDRCLVAT
    GASPAVPPIPGLKESPYWTSTEALASDTIPERLAVIGSSVVALELAQAFARLGSKVTVLARNTLFFREDPAIGEAVTAAF
    RAEGIEVLEHTQASQVAHMDGEFVLTTTHGELRADKLLVATGRTPNTRSLALDAAGVTVNAQGAIAIDQGMRTSNPNIYA
    AGDCTDQPQFVYVAAAAGTRAAINMTGGDAALDLTAMPAVVFTDPQVATVGYSEAEAHHDGIETDSRTLTLDNVPRALAN
    FDTRGFIKLVIEEGSHRLIGVQAVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLSC
    CA
    G

    >gi|72384298|ref|YP_293651.1| mercuric transport protein periplasmic protein [Ralstonia eutropha JMP134]
    MKKLFASLALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAISKVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKAT
    ADAGYPSSVKQ

    >gi|72384299|ref|YP_293652.1| putative mercuric transport protein [Ralstonia eutropha JMP134]
    MSEPKTGRGALFTGGLAAILASACCLGPLVLIALGFSGAWIGNLAVLEPYRPIFIGVALVALFFAWRRIYRQAAACKPGE
    VCAIPQVRATYKLIFWIVAALVLVALGFPYVMPFFY

    >gi|73539748|ref|YP_294268.1| glutathione peroxidase [Ralstonia eutropha JMP134]
    MNRRQTAFAASVRRAMFATALALAAASAALLPHPARAADKPAAMPAAAPAGNCPASLNFQFPRLQDEAPQNLCQYAGKVV
    LVVNTASY
    CGFTPQYEGLEALYSKYRDRGLVVLGFPSNDFSQEPGSSKEIADFCYNTYGVKFPMLGKSHVRGGDVNPMYA
    LLAKETGTAPKWNFYKYLIDRSGNVVGSYNSMTKPDDKQFVAKIEQLLSSPR

    >gi|73539823|ref|YP_294343.1| rhodanese-like protein [Ralstonia eutropha JMP134]
    MEHLSPADAQALLQQSPEALFIDCRSEMEYLFVGHPKGAHNVPWNDGPDWEVNPHFVQVVKKLAGQASARPVLLICRSGN
    RSTAAARALEGAGFSSVYNVLHGFEGDLDAERHRNTVNGWRFEGLPWEQY

    >gi|73539835|ref|YP_294355.1| DSBA oxidoreductase [Ralstonia eutropha JMP134]
    MKKLAALIATFAAVGSLLMTAPAHAAPTEGKEYQVLKAPQPVPAGKIEVTEFFWYGCPHCFDFEPELEAWVKKQGKDVVF
    KRVPVAFRDDLLPHTKIFYALESIGKLDAMHAKVFNAIHVDRKRMLDPNEIADFMAKNGIDRKAFLDAYNSFSVTTNAQR
    ANKIADAYKVDGVPTVVVQGKYVTSPSIAGTKTGAIQAMDYLVTQVRDKKL

    >gi|73539939|ref|YP_294459.1| YeeE/YedE [Ralstonia eutropha JMP134]
    MLIDLANFTPGFSLAGGLVIGAAAAVLVLFNGRIAGISGILGGLLTLPRGDMAWRLAFLAGLIGAPIVAGLVGKPAIADI
    QASWGEIMIAGFLVGIGTRYASG
    CTSGHGVCGISRGSIRSLVATLTFMAAGFLTVFVQRHLIGG

    >gi|73539990|ref|YP_294510.1| putative transmembrane protein [Ralstonia eutropha JMP134]
    MTNPASATSKPRKLWPIAVAVVVLAVLGWFGYRALSPSSQVPAATFTLLSGEKVSTGDLKGKVYLINFWATSCATCVKEM
    PDMVRTYEQYKGKGLEFVAVAMNYDPPMYVMNYAKTRGLPFKVAMDSDGAAAKAFGNVQLTPTTFVVDKDGRILKRYVGE
    PEWDALHKLLDGALEKAA

    >gi|73540006|ref|YP_294526.1| selenophosphate synthetase [Ralstonia eutropha JMP134]
    MAESIRLTQYSHGAGCGCKISPKVLDVILAGSGAQNLDPRLWVGNASRDDAAVYAIDGDDSGRGVVSTTDFFMPIVDDPF
    DFGRIAATNAISDIYAMGGDPLMAIAILGWPVNVLPPEVAREVVAGGRKACDDAGIPLAGGHSIDAPEPIFGLAVTGMVD
    RMHMKRNDTATAGCRLYLTKPIGIGVLTTAEKKGLLRPEHAHVARDWMCVLNRPGSAFGRLAGVRAMTDVTGFGLLGHLV
    EMADGSGLTARLDYAAVPVLPEIRRYIDAGCVPGGTQRNFDSYGHRIGTLTDEQRALLCDPQTSGGLLVAVEPAGEAAFL
    DACTRLGLDLAPIGELAARGEHAVEVA

    >gi|73540008|ref|YP_294528.1| molybdopterin biosynthesis protein MoeB [Ralstonia eutropha JMP134]
    MNDDQLLRYSRHILLDELGIEGQERLLGAHALVIGAGGLGAAALPYLASAGVGRISVVDNDHVDLTNLQRQIIHTTDNVG
    RLKVESAREGMLRINPGVQVDVIAARVGDADLEQLVAQADVVLDCCDNFATRQAVNRACVHHRVPLVSGAALRFDGQISV
    FDRRQDNAPCYACLFPPSEPAPEVA
    CATMGVFAPLVGMVGTVQAAEALKLLSGVGQSLAGRLLMVNAMTMEWTTMQLART
    PDCPVCAGH

    >gi|73540012|ref|YP_294532.1| glutaredoxin GrxC [Ralstonia eutropha JMP134]
    MARVVMYSTQVCPYCVMAERLLKSKGVETIEKVLIDREPGKREEMMSRTGRRTVPQIYIGDTHVGGFDDLSALDRQGGLT
    PLLAA

    >gi|73540091|ref|YP_294611.1| mercuric reductase [Ralstonia eutropha JMP134]
    MAQGFDAIIIGTGQAGPALAARLSGAGMKLAIIERARFGGTCVNTGCIPTKTLIASAYAAQLARRAAEYGVTIGGPVAVD
    MKRVKARKDEISGRSSNGVEQWMRGLANITVYQGHARFENAHSVQVNGELLEATQIFVNVGGRALVPPMPGLDQVPYLTN
    AGMMDVDFLPEHLIVIGGSYIGLEFGQMYRRFGARVTVVEKGPRLIQREDEDVSQAVREILEAEGIDIRLNANCLSARRD
    GDHLAVGLDCASGAPEVHGTHLLMAVGRVPNTDDLGLDKAGVETDARGYIKVDEQLRTNVPGIWALGDCNGRGAFTHTSY
    NDHEIVAANLLDNDPRKVSDRIAAYAMFIDPPLGRAGMTETEARQSGRKILVGTRPMSRVGRAVERGESLGFMKVVVDAD
    TRVILGAAILGLTGDEVIHSILDVMYAGAPYTVISRAMHIHPTVSELVPTLLQELRVPG

    >gi|73540172|ref|YP_294692.1| OsmC-like protein [Ralstonia eutropha JMP134]
    MECKVTWMGADGMSFVAQTGSGHIVAMDGAPEGGGHNLAPRPMEMVLLGTGGCTAYDVVLILKRGRQEVTGCDVRLEAER
    AGEDPKVFTRINFHFVVTGKNLNPATVERAIKLSHEKYCSASIMLAKTAEITHTLEIVEG

    >gi|73540177|ref|YP_294697.1| iron-sulfur cluster insertion protein ErpA [Ralstonia eutropha JMP134]
    MNAVAEAPVTEDVPAPFVFTDSAADKVKQLIEEEGNAELKLRVFVQGGGCSGFQYGFTFDEEVNEDDTTMVKNGVTLLID
    SMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV

    >gi|73540284|ref|YP_294804.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Ralstonia eutropha JMP134]
    MPYRVNGFFGSLASVAVNPGKTIKIQASLDAIAMPAPFDAILPAPFGKVGVRADDVRIREIFYLPEDVESIAPRSDVILR
    LAAQLDAYYADAGATFDVPLAIAGTPFQQQVWQAICAVPRGGLTTYGDIARKLGGVARAVGQACGQNPLPIVIP
    CHRVVS
    ASGIGGFAHHAEDGFHLEVKRWLLRHEGAMLI

    >gi|73540454|ref|YP_294974.1| rhodanese-like protein [Ralstonia eutropha JMP134]
    MQVIQPTELAQWLADASRAKPVLLDVREPWEVQTCAMPGITHIPMRDIPARAAELDEDADIVCICHHGMRSMQVAAFLER
    QGYAKVYNLTGGVDAWASQVDPAMPKY

    >gi|73540503|ref|YP_295023.1| YeeE/YedE [Ralstonia eutropha JMP134]
    MPEIDIAALSRTVLLSTFVLTFLFGAILQRTHFCTMGAVSDIVNMGDWSRMRMWGLAIGVAMIGTGVLAWAGLIDPTKTI
    YAANKLGWLSALSGGLMFGFGMVLASG
    CGSKTLVRIGAGNLKSLVVFVFLGLSAYMTLRGLFGVVRVNTVDAVSVTLPVT
    QDLPSLLSQGTGVARGALQLGLGLVLGGALVVWALVARGFRTFDNMLGGVGVGLIIVAMWYVSGHIGYVAEDPNTLDELF
    VATNSGRMESLSFVAPYAYTLDWLMMFSDKSKVLTIGIVSVFGVIAGASVYALATRTFRWEGFGNAEDVANHMIGGILMG
    AGGVTALG
    CTVGQGLSGVSTLAIGSFIAFGGILAGAVLAFRYQIWRLERMAFA

    >gi|73540515|ref|YP_295035.1| methionine sulfoxide reductase A [Ralstonia eutropha JMP134]
    MEHGLDTATLGGGCFWCLEAVYQQVNGVRAVESGYTGGHVSHPSYQQVSEGDTGHAEVIRVTFDPAVINYREIIEIFFAI
    HDPTTLNRQGNDVGPQYRSIIFTHSEAQRAVAEYVMRELVANKVFDAPIVTQIEPEQPYWRAEASHQNYFQEHPSQGYCA
    FVISPKVAKFRERFASKLRR

    >gi|73540525|ref|YP_295045.1| thioredoxin [Ralstonia eutropha JMP134]
    MKPPRLQSAPLPSQSFYSRTRCLPDRLAAMSDVTLQNFEPEVIEASRQAPVLVDFWAPWCGPCRTLGPMLEKLEAEANGK
    WKLTKVNVDENPELAAHFGVRSIPHVVAFADGEAVDQFIGVLPESGLREFLSRLTPNPAQLALQDAQSLAAAGDRQAAGD
    AFQSLLALDPGSDAARLAYISFLLDGNALAEAEAEFGRLSPQAAQEDAYAALRTRLEAMKGVSDLPDEQTLTSRIAADPR
    DLPARLDLARLLIARQQYEPALEQLLAIVRMDRGFEDDVGRKTMISVFDMLGDHPDVVSRWRRQLSTSLN

    >gi|73540580|ref|YP_295100.1| 3-mercaptopyruvate sulfurtransferase [Ralstonia eutropha JMP134]
    MPNPLISVAALQALQAAPARNVVVIDCSFDLANPAAGREAYQQGHVPGAFYLHLDNELSGPKTGHNGRHPLPDPDAFTDR
    LRALGVNRDTEVVAYDAQGSMYAARLWWMLRWIGHAAVTVLDGGKPAWVKAGLPLEHGAAPEPETPGNIQRGEPLVATVD
    AAALLENLNPPTRLVVDARTPDRFRGENETLDPVGGHIPGAVNRFFKDNLTPEGQFKPAAELRAELGAVLGQTAPAHAVM
    Q
    CGSGVTACHNLLALEVAGLEGAALYPGSWSEWCADPTRPVATGPAA

    >gi|73540714|ref|YP_295234.1| gst-related protein [Ralstonia eutropha JMP134]
    MLKLCGFAASNYYNKVKLALLEKNVPFEEVLAWIGETDTTATPAGKVPYMITESGSLCESEVINEYLEAAYPQTPLLPRD
    PMQAGKVREIVTFLELYLELTARELYPEAFFGGKVSDNVKERQLKLLSRYVPAFAKLAKFSPYVAGDTFTLADCAAAVHL
    PLVSSCTKIIYGKDLLADLPVKEYLKTLSERPSVQKVNADRKANTELMLSRNK

    >gi|73540744|ref|YP_295264.1| putative thioredoxin protein [Ralstonia eutropha JMP134]
    MSDAAAGTSASSDAHPDHRAFDALGMQSVDSTSIDAAVAAAGDKLVCVFFWGVDCFNCEMAKKAMLANPEPIRALDLHWL
    HANVYAHPDLGRRFGLHGIPVFMFFRNGKKLGRATGWHGHGQFAAAVANARLKSEGKPLAG

    >gi|73540762|ref|YP_295282.1| HesB/YadR/YfhF:Iron-sulphur cluster assembly protein IscA [Ralstonia eutropha JMP134]
    MITMTEKAARHVARYLERRGKGVGLRLGVKTTGCSGLAYKLEYVDELHPEDEVFESHGIKVIVDAKSLPYIDGTELDYAR
    EGLNEGFRFNNPNVKDECGCGESFTV

    >gi|73540879|ref|YP_295399.1| rhodanese-like protein [Ralstonia eutropha JMP134]
    MNVRVLISPADLAEMMRTESVVLIDTRDAASYAEAHLPGAVNIHEIFTYLATTTQEGLAALREAFAEAFGKAGLSGKEVA
    VVYEQSMTTGFGQSCRGYVLLRYLGYPRDKIKVLHGGYRAWHAAGFPSSTDTPMPAPARFPLASTQASILVDLEEMKKTV
    ADPHIVKLDVRDVDEWIADSSSPYGKDFCPRKGRIPNSVWIEWYRMMKPTPAGQMFKSPAEILAECATVGIRRETPVVVF
    CFKGARASNSFVALEEAGIADVRLYLGSWNEWSRDLSLPIEEGVPY

    >gi|73540885|ref|YP_295405.1| alkylhydroperoxidase AhpD core [Ralstonia eutropha JMP134]
    MSGMPEFKTVVKDVSAQMRRLRETQPDLMAAFSQLAAAGTKEGALSKKTREMIALGIAVAGRCDDCIGFHIQALIKLGTT
    RTELEEVLGTAVYMGGGPSMMYATHALAAFDEFSS

    >gi|73541000|ref|YP_295520.1| dihydrolipoamide dehydrogenase [Ralstonia eutropha JMP134]
    MSVIEVKVPDIGDFDAVELIEVLIKPGDTVEQEQSLIVLESDKASMEVPSPVAGKVVDVRVNVGDKVGQGTVICTVEAEA
    AAAAPAPAPAPAPAAAPAPAAAPAPAPAAASHAGGADIQCEMLVLGAGPGGYSAAFRAADLGMNTVLVERYATLGGV
    CLN
    VGCIPSKALLHNAAVIDEAKALAAHGILFGEAKIDLDGLRHYKNQVVGKLTGGLAGMAKARKVQVVRGIGTFLDPHHLEV
    DATEGEGKQTTGKKTVIRFEKAIIAAGSQAVKLPFIPEDPRIVDSTGALELPEVPNKMLVVGGGIIGLEMATVYSTLGAD
    IDVVEMLPGLMSGADRDLVKVWEKKNKDRFGKVMLNTKTVAVEAKPDGIYVKFEGEQAPAEPQRYDLVLVSVGRSPNGKR
    IGAEKAGVAVTDRGFINVDSQMRTNVPNIFAIGDVVGQPMLAHKAVHEAHVAAEAAHGEKAYFDAKQIPSVAFTDPEVAW
    AGLTEDQCKEQGIKYSKGVFPWAASGRAIANGRDEGFTKLIFDEETHRIIGGGIVGTHAGDLISEVCLAIEMGADAVDIG
    KTIHPHPTLGESIGMAAEIYEGTCTDVPPPRKR

    >gi|73541059|ref|YP_295579.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ralstonia eutropha JMP134]
    MKTVGDKLEAFHVVGVKPGFNNHEENGQSAFEDITEKSFEGKWKIIYFYPKDFTFVCPTEIVAFAKLNGDFADRDAIVLG
    GSTDNEFVKLAWRREHKDLNKLNQWQFADVTGSLIDQLGVRDQAAGVALRATFVVDPHNVIQHVSVNNLNVGRNPDEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|73541089|ref|YP_295609.1| methionine sulfoxide reductase B [Ralstonia eutropha JMP134]
    MTTSKTEAEWREQLSDIEYRVTREAATERPFTGRYWDHWDNGIYKCVGCGTPLFESATKFDAGCGWPSYFRPINGEVIAE
    HADHTHGMVRVEVRCKECGSHLGHVFEDGPAPTGLRY
    CINSAALKFDDRDPAERDG

    >gi|73541090|ref|YP_295610.1| hypothetical protein Reut_A1396 [Ralstonia eutropha JMP134]
    MSDTHPSQTTPRDAADSVATLSAPFPTMPGFAELGERFFTRLRPTPLPSAYLVSVAPNAAALLGMPVEAASEPDFIEAFV
    GNSVPDWADPLATVYSGHQFGVWAGQLGDGRAIRLAQAQTDTGPWEIQLKGAGLTPYSRMADGRAVLRSSIREYLCSEAM
    AALGVPTTRALSIIGSDAPVRRETIETAAVVTRLAPTFIRFGHFEHFAAHEDVAALRQLADFVINNFMPACREAAQPYQA
    LLREVSLRTADMVAHWQAIGFCHGVMNTDNMSILGLTIDYGPFGFLDAFDANHICNHSDTQGRYAYSQQPQVAFWNLHCL
    AQALLPLWLEPGADEAARDGAVAQAREALDPFRDRYASEFFRHYRAKLGIHMPAGGDKEDEPLLTSLFQLLHEQHVDYTL
    FWRNLARISSADGSGDAPVRDLFLDRAAWDTWAESYRNRLRAEQSDDAARRVAMLAVNPKYVLRNHLAEIAIRRAREKDF
    SEVDRLLAVLSRPFDEQPEAEAYAALPPDWAGGLEVS
    CSS

    >gi|73541141|ref|YP_295661.1| hypothetical protein Reut_A1447 [Ralstonia eutropha JMP134]
    MSEIIQSHGFTNEVLDWKAWLDIVELDQATPEQVAVLDESHPKARVQDYYRFLVHQPEILRQRSTAFNAIMYAPGGMPRA
    ERELATTVVSRLNGCVY
    CASVHAQRFEQLAKRNDVIKQVFEDPRTAGTTEREKAIAKLSVELTENPAGVSAESLAALREV
    GVSEAEILDLIHSVAIFAWANRLMLNLGEPVFPADATAA

    >gi|73541168|ref|YP_295688.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia eutropha JMP134]
    MMPSSTVVIVGAGQAGLQAATSLRQAGFDGRIRLVGDEPCIPYERPPLSKSYLAGETGLDGLWLRPEMFYGKERIELELG
    QTATAIDRQTRQVELASGRKVAYDRLVLATGARFRPLSVPGAELDGVLPLRTLADADALRPRLAEAREVVVIGAGFIGLE
    FAAVARKAGVAVHIIEMTQRLMGRVVSEQTSRFYTRAHRDWGSAFLFGTGVARILGNRRVSGVETSDGRTLPADLVLIGI
    GVVPNTEIAAAAGLAIDNGIIVDQNLASTDPTIFAIGDCANYPSRFGRCRLESVQNAVDQGQAVAAAIVGESIPYDKVPW
    FWTDQADLKLQIAGITAGHDRSVLRGDPESRSFSVFFFRDGTLIGVESINRPADHVVARRLLLADPRLSPEQAVDPDFDL
    RAHAIRFSRRERAQT

    >gi|73541178|ref|YP_295698.1| NADPH-glutathione reductase [Ralstonia eutropha JMP134]
    MQTYDYDLFVIGAGSGGVRASRIAAGYGARVAVAEEYRTGGTCVIRGCVPKKLLMYASHFAQAVDDAAGFGWRAPTPVHD
    WASLIAAKNAEIARLEAIYVRMLQSAGVDAITGRAQIVGPHRVEVNGVIFTAKVILVASGSVPVEPAIQGAELMITSNEA
    FYLDTLPKRIAIIGGGYIACEFAGIFNGLGSDVTQLYRGQQILRGFDDELRNHLGAEVSKSGVDLRVAVDVAAVGKRGDG
    LVVHLTTGQAIEVDAVMAATGRRSNTSGMGLESAGVLLDESGAIKVDEYSATSNPDIYAVGDVTNRLNLTPVAIHEGHAF
    ADTVFGGRKRASAHDNVPFAVFSQPQAASVGLTEAQARRRHAKVDVYSSAFRPMRTALSGRDERALVKLVVDASTDRVLG
    AHIVAADAAEIILGIAVAIKAKATKADFDATLGVHPTLAEEFVTLRNRR

    >gi|73541215|ref|YP_295735.1| arsenate reductase [Ralstonia eutropha JMP134]
    MSVTIYHNPACGTSRNTLAMIRNAGIEPTVIEYLDTPPDRQTLLALIRDAGLSVREAIREKGTPYAELGLADPALTDNQL
    LDAMLARPVLINRPFVVTELGVRLCRPSEVVLDILPAPQQGAFSKEDGEAVIDAQGRRIR

    >gi|73541295|ref|YP_295815.1| DSBA oxidoreductase [Ralstonia eutropha JMP134]
    MTQALRIDFVSDIACPWCAIGLSSLKHALEQLGDEVDAEVVVRSFELNPDMPPEGQTLLDYASRKNGSTATQVAERLALI
    RERGASAGFDFAPRTHVYNTFDGHRLLHWASTQGKALALKEALLKAYHGNGKDPSNHEVLLEAVKAAGLDAAQAQRVLES
    GEYAAEVRAEVAEFQAMGINSVPSIIFDNRYLVAGGQSADAFAQIIREVLAKRQG

    >gi|73541495|ref|YP_296015.1| alkylhydroperoxidase AhpD core [Ralstonia eutropha JMP134]
    MQQRLDFYKPSPAVIKAIMALEEQIARSGLDKPLVELVRLRASQINGCAFCIDLHTTDARKGGEDDRRLATVSVWRETPF
    FTDRERAALAWTEAVTLVSQDHVPDAVWEAVRPHFDDAELVNLTLLVAAINTWNRFAISFRKTPA

    >gi|73541583|ref|YP_296103.1| hypothetical protein Reut_A1894 [Ralstonia eutropha JMP134]
    MNVLLYGIPNCDTVKKARTWLDANGVAYTFHDFKKQGVDEAMLRGWLKHVPLSTLLNRKGTTWRALSDADKARAEQEASA
    IALMQQSPSLIKRPVLAHNGKVSVGFSADQYASQF

    >gi|73541620|ref|YP_296140.1| disulfide bond formation protein B [Ralstonia eutropha JMP134]
    MQANSRAYFLLIAFISFGLVGFALYLQFEKGYQPCPLCIMQRFAFIGIGLFSLLAVIAQNTRSLWQGLGMLSGVGGIAVA
    VYHVSLLLNPKAS
    CGIDPLENWVNALPTAKVLPQVFYSDGLCTAPLPPVLGLSVPAWSLIWLFILTLTLAVGLIRREKNF
    R

    >gi|73541637|ref|YP_296157.1| DSBA oxidoreductase [Ralstonia eutropha JMP134]
    MTQPLRIDFVSDISCPWCAIGLSSLQLALSRLGDAVDAEIAVHPFELNPDMGPGGETIVEYLGKKYGRTPEQVAETQAMI
    RDRGAAVGFAFGPRTRVYNTFDAHRLLHWAGLEGRQLPLKLALLKAYHGDGRDPSDHDVLVDVAELVGLDGARAREVLQG
    GDYADEVREAERENQSMGISSVPAIIFNRRYLVTGGQPVEAFEQAIQSILAETAKE

    >gi|73541684|ref|YP_296204.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ralstonia eutropha JMP134]
    MTVSLNKAVPDFSAPVTGDGGTFRLSEHRGKTVVLYFYPKDNTPGCTTEAMNFRDQYDDFIKAGVTVFGISRDSLRSHEN
    FKAKLELPFELISDPDEAVCNLFDVMKMKKLYGKEHRGVERSTFIVDGKGILRHELRGIKVPNHVDEVLEIVRGL

    >gi|73541731|ref|YP_296251.1| ATPase, E1-E2 type:copper-translocating P-type ATPase:heavy metal translocating P-type ATPase [Ralstonia eutropha JMP134]
    MSAPHANLLADPPSSALQNASVKRTAPAARSACFHCGQPVPAGQALAEEMAGQRRVFCCGGCQTLARTLHSAGFAHLYGD
    EARFARPIDDSARRESEPVWAAYDTPELRSQFVRPLEGGRAEITLAPESIR
    CAACAWLIEQHLGRLPGVESTIANVATRR
    VVVRWRDAEQTVSGLLAALAEIGYVAWPFEVSRSDEADRRARRSLLMRMAVAMLGMMQVMMYAWPIYTHEATIDPGMLQL
    MRWASLALTLPVVFYSASPIFSGARRSLRQRHLGMDVPVAIGVAAGFVASTVATVRGVGEVYFDSVTMFVAFLLAARYLE
    LRVRQASRSGAEMLARQLPATCERLGAEGAAPERVPVARLQHGDRIRVRAGEIIPADGTIVSGASELDESMLTGESRPVH
    RTVGDMALAGCYNTASPLEIAVDHVGAGTRLAEIVAVLDRALAEKPRLAALADRVAGWFVATLLVLAALTGVVWALWIDP
    SRALLVTVAVLVVSCPCALSLATPAALAAAGAALSRRGLLLTRSHALETLAGVTDVVLDKTGTLTEGCFALTGQQTLGPK
    PAAQCLALAAAMEAGSEHPIGRALVSAAGSAGVDIGGASMATVRNVPGQGVEAQMQGKRFRLGRTAFVAGIRNVNGEEQI
    KEADTVSVPGSTQVWLGDEAGMLAVFALSDKARESTPQLLEALSRHGARCHLVSGDSAETVQWWASRFGMDHAIGAVSPE
    GKRDYVAKLQRKGAVVLAVGDGINDAPVLAQAQVSIAIGSGAPLAQAGADAVLTHGNVADIAHALALARQTRRVVRQNLG
    WAFFYNVVAIPLAATGVVTAWMAGIGMSVSSLLVVANAWRLLRAGRNGV

    >gi|73541733|ref|YP_296253.1| dihydrolipoamide dehydrogenase [Ralstonia eutropha JMP134]
    MSKQFDVLVIGAGPGGYIAAIRAGQLGLNVACCEGNAYDDPKNEPRLGGTCLNVGCIPSKALLASSEEFENAQHHLADHG
    ITVGDVKVDVSKMLKRKDDIVGKMTKGIEFLFRKNKVTLLKGYGKFVGKTAEGFQVEVAGEVVTAKQVIIATGSKARHLP
    GITVDNDLVSDNEGALKFPAVPKKLGVIGAGVIGLELGSVWRRLGAEVTVLEALPAFLGAADEGVAKEAQKQLTKQGLKF
    SLGVKVDEVTTGKSGVTVKYTDKDGAAQTLEVDRLIVSVGRVPNTDNLGLEAVGLAADQRGFIEVDDHCATKVPGLWAIG
    DVVRGPMLAHKAEDEGVAVAERIAGQKPHIDYNCIPWVIYTFPEIAWVGKTEAQLKAEGREFKAGQFPFMANGRALGMGH
    PEGFVKMLADAKTDEILGVHIVAANASDLIAEAVVAMEFKAASEDIGRVCHPHPSMSEVMREAALAVDKRQLNM

    >gi|73541805|ref|YP_296325.1| thioredoxin [Ralstonia eutropha JMP134]
    MSEQIKYVSDASFDADVLQSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDENQQVPAKFGIRGIPTLI
    LFKNGAVAAQKVGALSKSQLTAFLDGNL

    >gi|73541833|ref|YP_296353.1| DSBA oxidoreductase [Ralstonia eutropha JMP134]
    MTHSNILSVEAYFDLICPWCLIGKRHLETAIDLLARERPDVTVQLEWRSYPLIPATPPDGIPYRDFYVARLGSPQAVAVR
    QAQVIAAAREAGLTLALDRIETFPNTMLAHRLVRFVREQDGAAAAATLVDNLFMRYFMRGANIGDGQVLREALTECGIPS
    PLEQGTPVQHDMDWLPPLNGPDDPPPRAGLGVPHFIFNGTHSVSGSRPPAALLEAMLRALARAKQIATRAVA

    >gi|73541974|ref|YP_296494.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia eutropha JMP134]
    MDLSIPNPVADTTKAADAGTAGGQPLEIDALIVGAGPVGLFQVFELGLLEIKAHVIDSLKVVGGQCVELYPDKPIYDIPA
    VPSCTGQELTDNLLKQIEPFGPTFHLGQEVAVVERRDDGRFFVETSLGTRFITKTIFIAAGVGSFQPRTLKVDGIDKFDG
    KQLFYRVKDPSRFHGRNLVIVGGGDSALDWTLDLVGKAESVVMIHRRDGFRAAPASVAKMKELCEQMEMQFLVGQIGGYE
    EKDGVLTEIKVTGADGVTRRLPVDDVLVFFGLSPKLGPIAEWGLDLERKQIKVDTEKFQTNIPGIFAVGDINTYPGKKKL
    ILSGFHEAALAAFGAAPYIFPEKKIHMQYTTTSPKLHKVLGVESPVFD

    >gi|73542217|ref|YP_296737.1| alkylhydroperoxidase AhpD core [Ralstonia eutropha JMP134]
    MTRPAHPISRYPVPELAALPDDIRQRILEVQDKAGFVPNVFLTLAHRPDEFRAFFAYHDALMLKDGGLTKGEREMIVVAT
    SAANQCLY
    CVVAHGAILRIYEKKPLVADQVAVNYLKADIPPRQRAMLDFALKVCKASHEVNEADFEALREHGFTDEDAWD
    IAAITAFFGLSNRMANTIGMRPNDEFFLMGRVPKSK

    >gi|73542286|ref|YP_296806.1| thioredoxin reductase [Ralstonia eutropha JMP134]
    MAKHAKVLILGSGPAGYTAAVYAARANLEPVLITGLAQGGQLMTTTDVENWPGDAKGVQGPELMQRLLAHAEEFKTEIIF
    DHIHTAKLVDESGNPARPFRLIGDAGEYTCDALIIATGASAQYLGLPSEESFMGRGVSA
    CATCDGFFYKNQEVAVVGGGN
    TAVEEALYLSHIASKVTVIHRRDSFRAEPILVDRLLQREKEGRVEIRYDSVLDEVLGDDSGVTGLRIRGAKSGETQDLKL
    AGVFIAIGHKPNTDLFVGQLAMENGYLVTKSGLSGDATATSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRYIEAL
    K

    >gi|73542318|ref|YP_296838.1| hypothetical protein Reut_A2633 [Ralstonia eutropha JMP134]
    MSPDAYLEMAETEAAHWWFRGRRDILATVLAGLDLPPDASILEIGAGTGGNLEMLSRFGKVSAVEMDGVALQLAREKTGE
    VYDIRCGRCPDDMPFAEGSFDLVCLLDCLEHIADDDGALDCAAKMLKPGGVVLLTVPAYQWLWSRHDVFLHHRRRYSKES
    LQTLVSC
    CGLHLARITYFNTLLSPLAITARLGDQLRGCEKATGAAVPARSINNALHALFSAERHWLARASLPFGISLMAI
    VRAP

    >gi|73542483|ref|YP_297003.1| glutathione peroxidase [Ralstonia eutropha JMP134]
    MSNVYQFEAKSLAGQPVPLSQFRGKVLLIVNTASECGFTPQYAGLQALHDAYAARGLEVLGFPCNQFGKQEPGDAQQIGQ
    FCESRFSVKFPMFAKIDVKGPDAHPLYQWLTSAKRGVLGTQAIKWNFTKFLLRRDGTVYKRYGSITKPEEIRADIETLLA
    DPAA

    >gi|73542548|ref|YP_297068.1| putative thioredoxin-related transmembrane protein [Ralstonia eutropha JMP134]
    MNAPTQKPVRRSRLWLWVAVAVVACAAGALAGQFVFAPKAASDHAVETFFQTRLPDPSGADIDLSKLRGKTVVINFWAPW
    CGPCVEEMPELTALHAEYAPRKVEFVGIGIDSAANIQQFVKKVPVAYPLAVAGFAGTELSRNFGNAAGGLPYTVVINPDG
    SVKYRKMGRVTSDELRAVLPRS

    >gi|73542554|ref|YP_297074.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Ralstonia eutropha JMP134]
    MSNVTLGGNAIEVAGKFPQPGDKAADFKLVGKDLKDVTLADFAGKRKVLNIVPSLDTPVCQASTRKFNEAASGLANTVVL
    TISADLPFAMGRFCSAEGLDNVVPLSTMRGAEFKGNYGVDIKSGPLAGVTARAVVVLDENNVVKYSQLVPEIKTEPDYDA
    ALAALK

    >gi|73542657|ref|YP_297177.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ralstonia eutropha JMP134]
    MIAVGQRVPDATLQEFFDTQSEGCSLGPNAFSVSDLVKGRKIVVFALPGAFTPTCSAKHVPGYVAEAQALRDAGVDEVWC
    VSVNDAFVMGAWGREQHTEGKVRMMADGSAEWTRALGLDQDLSARGMGVRSKRYAMVLDDGVVTHLQVEAPGEFKASSAE
    AMLEALRG

    >gi|73542719|ref|YP_297239.1| thiol:disulfide interchange protein [Ralstonia eutropha JMP134]
    MFQLMRRHPAWTTAIAGGLAAAGFALHAMAAGEPGTDRIKESLQKMLGGRAEVKSVTKSPVPGLFEVNVGGQVVYTDATG
    RYVINGEMIDTKTGTNLTEERLADINRIKWSDLPLARAIKWTKGDGSRQVAVFSDPN
    CGYCKRIEQTFQQMDNITVYTFL
    YPVLSPDSETKAKQVWCSADRTKAWRDWMLNKVALTGNGNCKTPLDDNLALGQRMNITGTPAVFFMDGTRIPGAADAGTL
    ERKLASIKK

    >gi|73542731|ref|YP_297251.1| glutaredoxin-like protein [Ralstonia eutropha JMP134]
    MSDVQQKIDQIVKGNPVVLFMKGTAQFPMCGFSGRAIQILKACGVDSPATVNVLDDEGIRQGIKEYANWPTIPQLYVNGE
    FIGGSDIMMEMYQNGELQTLLKG

    >gi|73542774|ref|YP_297294.1| glutathione S-transferase [Ralstonia eutropha JMP134]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLFNFEKELFTHVYVLENEKGKAAEKNHERARAAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLLKYAERIFSRPAYIEALTPSEKVMRR

    >gi|73542835|ref|YP_297355.1| protein-disulfide reductase [Ralstonia eutropha JMP134]
    MSMGFALLARSYGAGWARHIAAVLAVMVAWLCLVTGAHAATEDDFLPPEQAFRFAARQIDPQTIEVRFDVASGYYLYRER
    FAFAARPDTVRLGQPEFPHGKVKFDETFGKEMETYRDAVVIRLPVQSAPADGKWSLVVTSQGCADKGLCYPPMESVYKVG
    GSPLGNLFADRPRSEATVPPAASARPGTEAVAPPARLDENDRIAGVLASRNLGVVLALFFGLGLLLTFTPCVLPMVPILS
    SIVVGEHATRSRALVVSLAYVLGMAVVYTAIGVAAGLLGEGLAAALQTPAVLAAFAALMVALSLSMFGLYELQLPQHWQT
    RLTATSNRRQGGQVIGAAAMGAISALIVGPCVTAPLAGALAYIAQTRDAVTGGTALLAMALGMGVPLVLVGVGAGNLLPR
    AGHWMEATKRFFGFLLLGVAIWMVTPVLPAWLTMALWAALLLVAAVFLGAFDALGAEARGLARLGKGLGVLAALAGAILL
    LGLASGGRDPLQPLAHLSLARVAGGGAETAAGPQSVRFERVRSVAELDARVAQAAAAGKPVLLDFYADW
    CVSCKEMEHLT
    FTDAKVRARMSEIVLLQADVTANNADDKALLKRFGLFGPPGIILFGADGRERPVRVIGYQSAGRFLDSLERAFGTRPST

    >gi|73542933|ref|YP_297453.1| hypothetical protein Reut_A3250 [Ralstonia eutropha JMP134]
    MLRVRSSLIAWLLAFGLMAGAGGARALEVGDTVRLPDVQTLDGRTLTAASLAGKPLIVEVWASWCPFCAMQNPRLQKLYE
    RTRGTRLQVLTISIDKDPREATEYLRKRGYTFPVTMDSPALRTAISPRKGLPELYVIDARGRVVQKEVGEMLEDEVAALD
    RYAKP

    >gi|73542954|ref|YP_297474.1| arsenate reductase [Ralstonia eutropha JMP134]
    MITIYHNPRCSKSRETLALVEAAAERLGEPVEVVEYLKSPPSLSTLRQLQTMLGVSAREMMRDNEPPYQELDLADPGLTD
    AELLAAVADNPILLQRPVVVRNRRAAIGRPPEKVVSLLG

    >gi|73542958|ref|YP_297478.1| alkylhydroperoxidase AhpD core [Ralstonia eutropha JMP134]
    MANTMARMEYQQFTQTAPAVYAALAALSKAVTDSGLDKALVELVKLRVSQINGCAFCLQFHLNIIRKLDVDPRKLDLLAA
    WRDAGVFSDREQAALAWAEALSDLSGHGPGDAIYAQVREQFSEQELVFLGTAIASINFWNRIAVGYRFTPPTSDIGAAR

    >gi|73543058|ref|YP_297578.1| ATPase, E1-E2 type:copper-translocating P-type ATPase:heavy metal translocating P-type ATPase [Ralstonia eutropha JMP134]
    MSNASLSPTLTGSQAPEWRLPIDGMTCASCVRRVENALAKVPGVQDVAVNLATEQATLHADSGAVLPAAAKAVADAGYEV
    PRETVELNIADMT
    CASCVGRVERALRAVPGVLDAQVNLATERASVTLLRGAADADSLAAAVARAGYGATPVTETLPSAAP
    GDAARDFWTGPWPVIFSAALSVPLVAPMVLEWFGMHWMLPGSVQWLLATPVQFVFGWRFYKAGWKAVRARAGNMDLLVAL
    GTSAAYGLSLWLMWRMPDGMPHLYFESAAVVITLVRLGKWLETRAKRQTADAIRALAALRPDTARVRRDGQEVTVPLGSV
    RVGDEVVVRPGERIPVDAVVIEGSSHADESMLTGESVPVPKGPGDKLTGGAINFEGLLVARTVAVGAETVLARIIRMVEH
    AQAAKAPIQRLVDQVSAVFVPVVLGIALVTLLGWGLFAGDWETALLNAVAVLVIACPCALGLATPTAIMAGTGAGARAGI
    LIKDAEALEIAHRVSVVAFDKTGTLTVGRPEVVALHAADPEDADGARLLARLAALQAGSEHPLARAVLNAAQTRGITAPA
    ATDVQALPGRGIAGVVDGQALQLGSERLREALGADAGTLQAAAERLRDEGRTVSWLVETQPPRVTGLVAFGDAIKPGAPA
    AIARLRAAGVRTVMLTGDNKGAAARVAQALGLDEVQAEVLPEDKAARVRALGQDGAVVAMVGDGINDAPALAAADVGIAM
    STGTDVAMHAAGITLMRGDPALVADALAVSHRTVRKIRQNLFWAFFYNVVGIPLAAAGLLNPVVAGAAMAFSSVSVVSNA
    LLLRRWHPGGETGETGAKA

    >gi|73543093|ref|YP_297613.1| hypothetical protein Reut_A3411 [Ralstonia eutropha JMP134]
    MTVYFPERDVAAISAALSARPQSRLVACLCAQWCGTCRDYLKAFSALAARHPEDCYVWIDIETHADRLGDIDIENFPTLL
    VQPIAGGPVQFYGTLLPHIEVLERMLARGTALPGAQEDVPEVLKWLLSEGRRAA

    >gi|73543117|ref|YP_297637.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase:pyridine nucleotide-disulphide oxidoreductase dimerisation r
    MERVPRSRGKGGKPMRTRKADFVVIGGGSAGVACARRAASHGASVVLIERDEIGGTCVNRGCVPKKMLSYGATWAAILSG
    CLSHTGGHEDWRDAIVRVNAEVARLNVVYAQRLLEAGVDILRGDAVVTAPDEVRVGDEVIRAKRILIATGARPKTLDIPG
    GELASNSDDVFTWQTVPGSIAVIGGGYIGVEQASILSRYGVKVDLLVAGDRLLPHFDAEIAEALAGALETKGVRLHLNAS
    VNLISQANGALEVCYRPGNKPGQTESIRAQAALVAVGRVSNVDGLGLDAIGVKLGDKGGIKVDRQFRSSVRSIHAIGDAI
    EGLHLTPVATSQGRWLADRLFGRRGERADFDFVPTAVFCEPAIGAVGLTEAQAIEEAGKPERIRTVVKRFVSLENRFGGN
    GMQSVFKLVLNARTGRVLGVHLMDNAAPEIVQAMAVALRLGVRESHLETTLQLHPTVAEELFG

    >gi|73537302|ref|YP_297669.1| FAD dependent oxidoreductase [Ralstonia eutropha JMP134]
    MPTYDAVIVGSGINSLVCAAVLARSGKRVCVLERNSTLGGCIRTEALHAPGYLHDTLSTAHPLFVTSPGYAELKDDLHQA
    GLSYANNDTPTGVLLPGNRSLILATSRERNVSAFNALASGDGDAYLAAMQEVEQNAGLVFSLLGNELWSADVAKTVAGRL
    WKQGVHDTVAFFSPALMSCRSWLETRIRSDLVRALLAPWVLHTGLGPESAMSALMGKVVAFSLEAVGLPIVQGGNARTVE
    AFRQIVESHGGAFHVNADVEDVLVENGSARGVRTRDDRVFMGKEIICNVTPGQLYGKLLAPAHVPPALRQQAAEYRYGKG
    NMQIHLSLSAPPDWPHAHLRNVIYLHLTSGLDGVSRAVSEAERGLLPAEGTICVAQPCAVDPSRSPAGGWVLWIQVPECP
    RTIKGDALGEIDAPADGRWTPEIRERYADRIIDRIARQVPNLKASIVGRTVLSPADLEAMNINLVGGDPYSGECSIDQFM
    VWRPLRGARNHATPVKHLHHIGASTHPGPGLGGTSGYHVANALARKRAKSNRT

    >gi|73537742|ref|YP_298109.1| cytochrome c biogenesis protein, transmembrane region [Ralstonia eutropha JMP134]
    MTLLILAYLGGALTILSPCILPVLPFVLSRTGQPFLRGRLPMLAGMALTFAVVASLASAGGAWAVRANAYGRIGALALLA
    LFGLSLLLPKVADTLARPAVALGNRLAGRAGSNGEASASPWGSLLLGIATGMLWAPCAGPILGLVLTGAALNGASVSTSL
    ALAAYAAGAATSLAAALGLGGRVFAAMKRSLGASEWLRRGLGAGVLGSVVIIGLGADTGLLARWSASGPARLEQALVDAL
    HKDRPAPQAANEVPAPGNGMLLAANDTRVGFPTPLPALPVEGRLPALDGAVQWLNSPPLSREQLQGKVTLVYFWTYS
    CIN
    CIRTLPYLRAWADKYKDQGLTVVGVHTPEFAFERSTDNVRRAVADFRIGFPVAVDSDYRIWRAFHNSYWPAAYFVDARGN
    IRHHQFGEGDYAKSERVIQTLLTEAGSRAVAGDVVSPDAAGAQAAPDLHNVRSEETYIGYSQATNFASPGEVRPDASRQY
    TVGKLLLNEWGLSGQWTVGPEQATLDRADGTIRYRFHARDLHLVLGPAANGQAVRFVVTIDGKPPGKSHGADTDAGGNGA
    VTQTRLYQLVRQAGEVGEHTFEIRFLDAGAQAYAFTFG

    >gi|73537745|ref|YP_298112.1| hypothetical protein Reut_B3911 [Ralstonia eutropha JMP134]
    MRTLFRAALAAALLVTVYLFGTGFSAYSSPAVGDQGKAPEFTEIDHWLNSPPLTMQSLRGKVVLVDFWTYSCINCINTLP
    YVKQWHEKYKDQGLVVVGVHTPEFPYEKSTANVQEAIRRFDIRYPVAQDNAYGTWSAFHNRYWPATYLIDADGRIVYQHY
    GEGRYAETEAAIQKLLAQRKSQPEQPKSK

    >gi|73537805|ref|YP_298172.1| ATPase, E1-E2 type:heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase:heavy metal translocating P-type ATPase [Ralstonia eutropha JMP134]
    MARTTPEHALPHEHVRSEGCGHDHARTRDDHGHHHGHDHDHGHDHHDHAPRAPACCGSACSTTISVAPAASVAIPAGAGS
    ASYRIDAMD
    CPTEETLIRNKLGGMAGVAALDFNLMQRVLTVHHTLASTESVVNAIASLGMKAEPLVPEQAAPLPAAEHKP
    WWPLALAGVAAIGAEVTEWAGLGNPWLPALLAIAAVALGGLTTYRKGWIALRNANLNINALMSIAVTGALVLREWPEAAM
    VMVLFALAERIEAASLDRARNAIRGLMAMAPEQATVRQLDGTWAGVPAAGVAVGAVVRLRPGERVALDGRVVRGQSALDQ
    APITGESVPVDKGVGDALFAGSINQSGEIEYEVTAPANDSTLARIIHAVEAAQASRAPTQRFVDQFARIYTPTVFAIALA
    VAVVPPLVTGASWVDWIYKALVLLVIACPCALVISTPVTIVSGLAAAARRGILIKGGVYLEQGKDLSWVALDKTGTITHG
    KPAQTDYAMLVEDAPHARAIAASLAARSDHPVSKAVATAAQADGIALLDVTAFEALAGRGTRGRIDGDDYCLGNHRLIHD
    MGACSPALEDRLEALERQGKTVVLLARLGKDGAAAALAMFAVADTVRDTSRQAIAELHALGVKTIMLSGDNPHTAQAIGA
    QVGIDEARGNQLPQDKADAIGTLAADTHAARGRVGMVGDGINDAPALARADIGFAMGAAGTDTAIETADVALMDDDLRKI
    PAFVRLSRSTSRILWQNITLALGIKAVFLALTLAGMGTMWMAVFADMGASLLVVFNGLRLARR

    >gi|73537900|ref|YP_298267.1| thioredoxin [Ralstonia eutropha JMP134]
    MPTKDHYLSDAPPREEIDTLQGPALLEFGTDWCGYCQRAQPALAQAFASYPGVRHIKVEDGSGRPLGRSFRVKLWPTLVF
    LRDGREVSRLVRPSDAAPILEAMAAIA

    >gi|73537987|ref|YP_298354.1| methionine sulfoxide reductase A [Ralstonia eutropha JMP134]
    MTTQSETAILAGGCFWGMQDLLRRYPGVLATRVGYSGGDVPNATYRNHGTHAEAIEIVFDPQQISYRQILEFFFQIHDPT
    TRNRQGNDIGTSYRSAIFYRDDAQKQVAEDTIADVNASGLWPGKVVTKLAPAGPFWEAEPEHQDYLERYPNGYTCHFIRP
    GWKLPQRG

    >gi|73538272|ref|YP_298639.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Ralstonia eutropha JMP134]
    MGNFLASAEALWPRIVSSAYLRTLLRTGPSHPSIHNTEPITMNDVIIIGGSFAGLAAALQLGRARRKVTVLDTGRPRNRF
    AGHSHGLLGHDHKPPLDILVEARQQLARYPTIRLVIARAESVSGAIDDFCVVTDDQESLRARRLILSYGVADQMPDVPGF
    AESWGTSIVP
    CPYCDGFEVAGQHWGLLWSGPQSHQSARLFRDWTDKLTVFADGHDIAADIQADLARRNMPVVDGRIVEIA
    HHTGHITTVNLDTGRNVAVDVLFAHPRNKPSASLHESLGLATVDTPTGIVLKVDERRQTSIPGIYAAGDLATPFLPSVTQ
    ASSQGAMAGIFAQQSMVV

    >gi|161611270|ref|YP_298645.2| dihydrolipoamide dehydrogenase [Ralstonia eutropha JMP134]
    MKTIQTDVAVIGAGTAGLAAYRAAIAAGKRAVIIEGGPYGTTCARVGCMPSKLLIAAAEAAHELRHTAPFGVHVDGQIRI
    DGREVMARVRSERDRFVGFVVRGVDGIPEADRIRGYASFIDNTTLEVAADDGNITVRASRVVIATGSRPVLPAPFKVFGD
    RLIVNDDVFAWEDLPRSVAVFGPGVIGLELGQALSRLGVRVRVFGVRGSLGPLTDPVIRRYADETFRKAFYLDTEASVTE
    MAREGDLARITYIDREGKSVAETFDYVLAATGREPNVRGLGLENTGLELDARGVPVFDPVTLQCGVSPVFIAGDANNILP
    LLHEAADEGKAAGENAATYPRVLPLARRAPLAVVFSDPQIAMVGKRFADLAEGSFVTGEVSFEDQGRSRVMLRNRGLMHV
    YADKATGQFLGAEWTGPRAENIAHLLAWSYQQGLTIAQMLAMPFYHPVVEEGLRTALRDAAAKLEG

    >gi|73538279|ref|YP_298646.1| glutaredoxin-like region [Ralstonia eutropha JMP134]
    MLQSREGQRIPNVAFRIRQDNEWKTVTSGDLFNGKTVVVFSLPGAFTPTCSSTHLPRYNELAPAFAKHGVDEILCVSVND
    TFVMNEWAKDQESQNITMIPDGNGEFTEGMGMLVDKADLGFGKRSWRYSMLVRDGVVEKMFIEPNEPGDPFKVSDADTML
    NHIAPDAKRPDQVVVFSKAG
    CSFCAKAKQQLSDAGYEYIEVPLDNKVRGKVLGAVSGEMTAPQVFINGKLIGGAAALEQY
    LGQ

    >gi|73538426|ref|YP_298793.1| thiol-disulfide isomerase and thioredoxins [Ralstonia eutropha JMP134]
    MKDIKVLGSGCANCRNTIALIEQVALDNGIAISIQKVEEMRDIVSYGIMRTPGVVVDGKVVHAGGIPTRDNVEEWLSS

    >gi|73538559|ref|YP_298926.1| DNA-O6-methylguanine--protein-cysteine S-methyltransferase [Ralstonia eutropha JMP134]
    MPSQCFRAPAEARERRVLRYARSGRSRRIPSQPPCSRRPDQRGRRARCARGGGLPTASDQLLGMRARDYRAGGTGAVIHF
    AVGQCSLGAILVAQSQRGICAILLNDDPDALVRELQDQFPNAQLIGGDAGFENLVAQVVGFVEAPSIGLNLPLDVRGTAF
    QERVWQALREIPPGTTVSYAEIAERIGRPTATRAVAQACGANHIAIAIP
    CHRVVRRDGDIAGYRWGVDRKRELLRREAEA


    >gi|73538596|ref|YP_298963.1| periplasmic protein thiol:disulfide oxidoreductase DsbE [Ralstonia eutropha JMP134]
    MTRFLLPLAVFLALAVALAAGLRHDPRELPSPLVGKPAPAFVLPVLDEDGQKLGAADLRGKVWLLNVWASWCTACRAEHP
    VLVDFAARSRVPLYGLNYKDQDSAARDWLRRMGNPYAASLVDADGRVGIDFGVYGVPETFVIDKAGVIRYKQVGPVTQEV
    LERKLIPLLESLQKGDGHA

    >gi|73538809|ref|YP_299176.1| peroxidase [Ralstonia eutropha JMP134]
    MAIRIGEEAPDFTAETTQGTIHFHEWIGDGWAILFSHPKDFTPVCTTELGYMAGLKPEFDKRNTKIIGLSIDPVGDHSRW
    AKDIEETQGHAVNYPMIGDADLKVAKLYDMIHPEASGGPRTAVDNATIRSVFWIGPDKKIKAMLAYPMSAGRNFDEVLRL
    LDSLQLNAKHAVATPVNWKPGDDVIIPTSVSDEDARKKYPNGFKTLKPYLRVVAQPK

    >gi|73538949|ref|YP_299316.1| OsmC-like protein [Ralstonia eutropha JMP134]
    MTKIEHVLYTGKTHTTGGRDGAARSNDGRLDIKLSPPGSTGSGTNPEQLFAAGWSACFIGAMGKAASVLKVKLPADVAVD
    AEVDLGTTDDAYFLQARLNVSLPGIPSDTAQALVEKAHQT
    CPYSKMTRGNIDVTINVV

    >gi|73539137|ref|YP_299504.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Ralstonia eutropha JMP134]
    MISYRQIDSPLGAMLLRVQDSFLTGVYFEGQKYYPAAAVSSVVPESAARIFDETARQIAAYFDGLLEAFSVPMRLVGTDF
    QRRVWEALRAIPFGETLSYGDLAGQLGLPPGHARAVGGAVGRNPVSVIVP
    CHRVLGAAGDLTGYAGGTDRKRALLRLEGH
    AAAARLPIMQQSALAFV

    >gi|73539290|ref|YP_299657.1| alkylhydroperoxidase AhpD core [Ralstonia eutropha JMP134]
    MTASFDPFAAAPAQMKSWMGMSLAVAGSLEPSLVSLVEVRASQINGCANCINMHTVDARAKGETEQRLYLLSAWREAPCY
    TERERAALGWTDALTRLSEGHALDRARAALDEHFSKEEQVKLTLMINVINGWNRLAVGFGMWVDPAAAKSAAKAVA

    >gi|73539359|ref|YP_299726.1| hypothetical protein Reut_B5537 [Ralstonia eutropha JMP134]
    MGELQTMLEHHGLMLVFLNVLAEQAGLPIPAYPMLFVAGALGVQETGPSIGAVLAAVIAACLIADTAWYFAGRRLGQPML
    RTICKVSMSPDTCIRQTQSLYLRVGPRSLVFAKLLPGAGALSTAMAGMTATPLPVFLFYDALGALVWAGAALLIGVVFSD
    FVDVILAAFSAYGHLAVMALLGAFALFLAWRVWWRFHMLRRTRRIPRMTVDELEARRRAGTLPLVLDVRAHGPVPIERIP
    GAVVVDMHGPLDALGGQLESRDIVVYCA
    CPNEISAAILAERLRVAGYGKTWALAGGFDEWKRLHGDDAPLHAAHAANDAA
    AS

    >gi|73539378|ref|YP_299745.1| OsmC-like protein [Ralstonia eutropha JMP134]
    MTIQATWQPSQDNTLCNLTNGQARWQADLDDTAGGDPKYPSPHDLLDSALAACTVLTLQLYAKRKGYAVDGIHASVSHEE
    TSGHYAMKREVRVTGNLEPKVLEDLLRVANK
    CPVHKSLSAEIVIDTTISG

    >gi|73539381|ref|YP_299748.1| OsmC-like protein [Ralstonia eutropha JMP134]
    MKLEKVLYTAHATATGGRDGRAVTSDGQLDAKLALPKEMGGKGDGLNPEQLFAAGYSACFIGAMRHVAAQQKIVLPADTS
    IEGSVGIGPIPQGFGIQAELKISVPGFEREAVEKLVEQAHQV
    CPYSNATRGNIEVTLTVV

    >gi|73540801|ref|YP_295321.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase:aromatic-ring hydroxylase [Ralstonia eutropha JMP134]
    MSTDNTTALPGAADTTTTDVLIVGAGPVGLFAAFQAGVLGLKCELIDVLDRAGGQCTELYPEKPIYDIPAVPGCLAQDLV
    DRLLEQCAPFAFPMHFNQRAESVAEVLPAQDGVHSRLLVTTDSGKRFDVAAVLVCAGAGAFAPQRVSLPEAPGLEGRHVH
    YAVRDVSRFAGKRVVVAGGGDSALDWALALRKVAARVTLLHRREGFRAADGSVAEMRAAVEAGEMDFVIGMLGALKTSGE
    GEHAALMEIEIRSRDGVQTLAADELVALYGLVSEPGPIAQWDMDMRAGRILVDTTTYESSRRGIFAAGDIAYYANKQKLI
    LSGFHEAALALRKAYHYAFPQKSLVHVHTSNNAALKEKLTHA

    >gi|73537911|ref|YP_298278.1| hypothetical protein Reut_B4078 [Ralstonia eutropha JMP134]
    MTALVIANIVLWIAVLALLFGLYALARQVGILYERVAPMGALMIDAGPRVGQPLQPFALQDVRGTSVTVGGHQAASTLLF
    FLSPT
    CPVCKKLLPVLKSIRASEGNWLRIVLASDGEQPEHLAFLRQAGLGDFDYVLSRELGMHLQIGKLPYAVLLDEHGT
    LRAKGLVNSREQLESLFTAMDLNVASVQQFLETHA

    >gi|73540030|ref|YP_294550.1| electron transport protein SCO1/SenC [Ralstonia eutropha JMP134]
    MGDTVCCPRHRGASDLPAPLDFRFPMTKPSQPHGLFASFRRFAALAFLALALAACGQQKASFRNVDISGGADFGKDFSLI
    DHNGKVRTISDFKGKVVVMFFGYTH
    CPDVCPTTMAELKAVMEQLGPDADKVQVLFVTVDPERDTQALLAQYVPAFDPRFL
    GMRPADEAALQKVAKDFKVYYAKVPGTSPNNYTMDHSAGSYVFDPEGHLRLFIRHGQGPEPIAHDIKQLLS