Ralstonia eutropha H16

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|38637883|ref|NP_942857.1| cytochrome C-type biogenesis protein [Ralstonia eutropha H16]
    MTRFLLPLAAFLALTIALAAGLRHDPRELPSPLVGKPAPAFSLPLLEPEGRTLAAADMRGKVWLLNVWASWCAACRTEHP
    VLVDFAARSHVPLYGLNYKDETGAARDWLQRMGNPYAASLVDADGRVGIDYGVYGVPETFVIDQSGVVRYRQAGPVTREV
    LERKLMPLIEQLEKSGDGHA

    >gi|113866085|ref|YP_724574.1| SAM-dependent methyltransferase [Ralstonia eutropha H16]
    MGEQQQTSSNGGDQAALWNGPSGHAWVAEQAVLDDMLRPLEGRLVDTVGKTSAQHVLDVGCGTGSTTIALARKLGAQGRC
    TGIDISEPMLAAARARAQHNGSTASFIRADAQDYAFAPASFDSIVSRLGVMFFSDPVRAFANLRRAATPDATLH
    CIAWRS
    ASENPFMTTAERAAAPLLSNLPPRQPGAPGQFAFGDRQRVQAILEEGGWGGIDVEPIDFACTLPEPALVDYLSRLGPVGL
    ALREADASTRASVIETVRAAFEPYVHGATVRYTAACWMITARAAASSLTAGESAHA

    >gi|113866096|ref|YP_724585.1| glutathione peroxidase [Ralstonia eutropha H16]
    MIRRPLLSSLAAALTLAAASTALLPAPVRAADKPAAAPAAGACPASLNFTFPRLQDDVPQNLCQYAGKVVLVVNTASYCG
    FTPQYEGLEALYAKYGARGLVVLGFPSNDFSQEPGSQKEIADFCYNTYGVKFPMLGKSHVRGSDANPMYALLAKQTGTTP
    KWNFYKYLIGRDGQVVASYGSRTRPDDKELVAKIESLLGAQR

    >gi|113866097|ref|YP_724586.1| glutathione S-transferase [Ralstonia eutropha H16]
    MKLYYTPGVCSMAVHIALREAGLPVTLAKVDLLRHKLAEPENGTDDYYTINPRGYVPLLQLDDGSRHTEAASLLQYIADL
    VPERALLPAAGTRERLEATGWITLVSTELHKVFSPWLWHKETAQSTQDECKARLHRRFSELDQHLQTRHYLMGDTFTVAD
    AYCFTIVGWARILKLPLNDYPALQQYLSRVAARPAVQEAMRAEGLVRD

    >gi|113866192|ref|YP_724681.1| Thiol:disulfide interchange protein DsbA [Ralstonia eutropha H16]
    MKKLAALFAMFAAVGGLLMSAPSRAAPAEGKEYQVLKAAQPVAAGKIEVTEFFWYGCPHCYDFEPDLEAWVRKQGGNVVF
    KRVPVAFRDDLLPHTKIFYALEAIGKLDAMHNKVFNAIHVDRKRMTDPNEIADFMAKNGVDRKAFLDAYNSFTVTTNSQR
    ANKIADAYKIDGVPTVVVQGKYVTSPSIAGNKQGAIQTMDYLVDQVKAKKM

    >gi|113866194|ref|YP_724683.1| putative periplasmic metal ion binding protein [Ralstonia eutropha H16]
    MWRDAIGQQHAAASGVVRIASLVPSVTELLFALGMARQMVARTGFCIHPEPAVCAVPKVGGTKDVNVARLRELAPTHVVV
    NIDENRRETVDEIRAFVPNVIVTHP
    CAPEDNLGLYQLLGGIFGCHAEAEALCTALQVQLDAIRVRAWPARRVLYAIWQDP
    WMTVSRDTYISRMLALANWHTWPEGSAALQACAGGDCSRPNAPGDRYPTFRWSDALVRELDLVLLSTEPYRFTEDHADAL
    ERQLGKPVLLVDGEMLSWYGSRAIDGVRYLAALAAAN

    >gi|113866336|ref|YP_724825.1| peroxiredoxin [Ralstonia eutropha H16]
    MTTAAPATKSSRKPWPIVAAVVVLALLGWFGYRALAPANTAPAATFTLLSGEKVSTADLKGKVYMINFWATSCATCVKEM
    PDMVRTYEQFKGKGLEFVAVAMNYDPPMYVMNYARTRGLPFKVAMDSDGTAARAFGNVQLTPTTFVVDKDGRILKRYVGE
    PEWDALHKLLDGALAKSA

    >gi|113866360|ref|YP_724849.1| molybdopterin/thiamine biosynthesis family protein [Ralstonia eutropha H16]
    MSDDGLNDEQLLRYSRHILLDELGIEGQRRLLAGHALVIGAGGLGAAALPFLASAGVGRITVVDDDEVDLTNLQRQIIHT
    TANVGRPKVDSAREGMLRINPGLEIVTVPARVGDAELAQLVASADVVLDCCDNFATRQAVNRACVRHKVPLVSGAALRFD
    GQISVFDRRQPDAPCYACLFPPAEPAPEVA
    CATMGVFAPLVGMVGTVQAAEALKLLAGVGESLAGRLLMVNALSMEWTTM
    RLARTPDCPVCAGH

    >gi|113866363|ref|YP_724852.1| rhodanese-related sulfurtransferase [Ralstonia eutropha H16]
    MNFFADYNNLALIALAVVSGGLLAWPAISRSTRGKTVNTATATQLINKRGAVVVDIREPAEYAKGHLPQAKSAPLADLPS
    RAAGLAKDKAAPIIVV
    CQTGQRSGKAQAALKEAGYSEIYALEGGIAAWQQAGLPLVK

    >gi|113866364|ref|YP_724853.1| glutaredoxin-like protein [Ralstonia eutropha H16]
    MARVVMYSTVVCPYCLMAERLLKSRGVETIEKVLIDREPGKREEMMARTGRRTVPQIYIDETHVGGFDDLSALDRQGGLV
    PLLAA

    >gi|113866383|ref|YP_724872.1| Sco1/SenC family cytochrome oxidase assembly protein [Ralstonia eutropha H16]
    MPRLSPASGLFAAFRRFSLLAALALAVAACGQQKASFRNVDITGAADFGKDFSLTDHHGKVRTIADFKGKAVVMFFGYTH
    CPDVCPTTMAELKAVMEKLGPDADRVQVLFVTVDPERDTQALLAQYVPAFDARFLGLRPADEAALQKLTKDFKVFYAKVP
    GSSPNNYTVDHSAGSYVFDPDGKLRLFIRHGQGPDPIAHDLKQLLS

    >gi|113866510|ref|YP_724999.1| redox protein, regulator of disulfide-bond formation [Ralstonia eutropha H16]
    MECKVTWMGADGMSFVAQTGSGHIVAMDGAPDGGGHNLAPRPMEMVLLGTGGCTAYDVVLILKRGRQDVSGCSVQLQAER
    AGEDPKVFTRINFHFVVTGKNLNPATVERAIKLSHEKYCSASIMLAKTAEITHTMEIVEA

    >gi|113866514|ref|YP_725003.1| iron-sulfur cluster insertion protein ErpA [Ralstonia eutropha H16]
    MNAVAEAPVTEDVPAPFVFTDSAADKVKQLIEEEGNAELKLRVFVQGGGCSGFQYGFTFDEEVNEDDTTMVKNGVTLLID
    SMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV

    >gi|113866618|ref|YP_725107.1| methylated-DNA [protein]-cysteine S-methyltransferase [Ralstonia eutropha H16]
    MPATYDAILPAPFGKIGVRTDGARIRAIVYLPGHVEARAPADALTQQLAAQLEAYYANPDAAFDLPLAPAGSDFQQRVWQ
    AISAVPRGAVTTYGTIAEAIGAMPRAVGQACGQNPFPIVIP
    CHRVVSARGIGGFSPHAEDGFYLDVKRWLLRHEGAMLI

    >gi|113866780|ref|YP_725269.1| thioredoxin reductase [Ralstonia eutropha H16]
    MPHRPQERIMAKHAKVLILGSGPAGYTAAVYAARANLEPVLITGLAQGGQLMTTTDVENWPGDAKGVQGPELMQRLLAHA
    EEFKTEIIFDHIHTAKLVDDNGQPARPFRLIGDAGEYTCDALIIATGASAQYLGLPSEESFMGRGVSA
    CATCDGFFYKNQ
    EVAVVGGGNTAVEEALYLSHIASKVTVIHRRDSFRAEPILVDRLLQREKEGRVVIRYDSVLDEVLGDESGVTGIRVRGTK
    TGQAEDLKLAGVFIAIGHKPNTDLFEGQLAMENGYLVTKSGLQGDATATSVPGVFAAGDVQDHVYRQAITSAGTGCMAAL
    DAQRFVEALK

    >gi|113866931|ref|YP_725420.1| hypothetical protein H16_A0906 [Ralstonia eutropha H16]
    MSDPAFAISRYPVPALTDLPDDIRARILEVQEKAGFVPNVFLALAHRPDEFRAFFAYHDALMLKEGGLTKGEREMIVVAT
    SGANQCLY
    CVVAHGAILRIYEKKPLVADQVAVNYLKADIPQRQRAMLDFAMKVCKASHEVGDADFAALREHGFSEEDAWD
    IAAITAFFGLSNRMANTVSMRPNDEFYLMGRVPKAK

    >gi|113867123|ref|YP_725612.1| glutathione S-transferase [Ralstonia eutropha H16]
    MLKLCGFAASNYYNKVKLALLEKNVPFEEVLAWIGQTDLAATPAGKVPYIITESGPLCESEAIVDYVEAAYPQTPLLPLD
    PYQAAKVREIVVFMELYLELTARELYPEAFFGGKVSDGVKDRQHKLLTRYVPAFAKLAKFSPYIAGDTFTLADCAAAAHL
    PLVSSCTKIIYGTDLLADLPVKDYLKTLSARESVQKVNADRKANLELMASRSK

    >gi|113867158|ref|YP_725647.1| thioredoxin [Ralstonia eutropha H16]
    MTTEPGAGPATFPAPHLDHRAFEAFGMREVDDGSIDAAIAAAGDALVCVFFWGEDCFNCEMAKKAMLANPEPIRALELRW
    LHANVYAHPGLGRRFGLHGIPVFMFFRNGKKLGRATGWHGHGQFAAAVANARLKASGKPLAG

    >gi|113867180|ref|YP_725669.1| iron sulfur cluster assembly protein (IscA) [Ralstonia eutropha H16]
    MITMTEKAAKHVARYLERRGKGVGLRLGVKTTGCSGLAYKLEYVDELLPEDAVFESHGIKVIVDAKSLPYIDGTELDYAR
    EGLNEGFRFNNPNVKDECGCGESFTV

    >gi|113867298|ref|YP_725787.1| hypothetical protein H16_A1279 [Ralstonia eutropha H16]
    MMTNRLATETSPYLRQHAENPVDWYPWCEEAFRRARDDDKPVLLSVGYATCHWCHVMAHESFENPRIAGLMNDRFISIKV
    DRQERPDLDDIYQKVPQMMGQGGGWPLTVFLTPQGEPFYGGTYFPPDDRYGRPGLARVLLSLSEAWTHRREALRDTIEQF
    QQGFRQLDDTVLSREDAEEAAEVQDLPAQTALALARNTDPTHGGLGGAPKFPNASAYDLVLRICQRTHEPALLDALERTL
    DGMAAGGIHDQLGGGFARYSVDERWAVPHFEKMLYDNGQLVTLYANAYRLTGKQAWRRVFEGTIAYIVRDMTHPDGGFYA
    GEDADSEGEEGRFYVWTAPEVKAVLGESEGALACRAYGVTEGGNFEPGRSVLQRAVTLTPLEEARLEGWRERLLAARAQR
    VRPGRDDNILAGWNGLMIQGLCAAYQATGNPAHLAAARRAASFIQDKLTMPDGGVYRYWKDGTVKVPGFLEDYAFLANAL
    IDLYESCFDRRYLDRAAELVALIIDNFWDDGLYFTPNDGEPLIHRPRAPHDGAWPSGISASVFSFLRLHELSGEDRYRDL
    AEHEFQRYRAAASAAPAGFVHFLAAADFAQRGAFGIILAGDKAAAAALVESVHRTYLPARVLAFAEDVPVGQGRLPVDGR
    PAAYVCRHRACSAPVTSGEALLERCAGVTVSPQ

    >gi|113867392|ref|YP_725881.1| dihydrolipoamide dehydrogenase (E3) component ofpyruvate dehydrogenase [Ralstonia eutropha H16]
    MSVIEVKVPDIGDFDAVEVIEVLVKAGDTVEVEQSLIVLESDKASMDVPSSAAGKVVEVKVKVGDKVGQGAVICTIEAQQ
    AAAAPAPAQAPAPAQAPAPAAAAPAPAPAAASHSGGADIQCEMLVLGAGPGGYSAAFRAADLGMNTVLVERYSTLGGV
    CL
    NVGCIPSKALLHNAAVIDEAKALAAHGILFGEAKIDLDGLRHYKNQVVGKLTGGLAGMAKARKVQVVRGIGNFLDPHHME
    VELTEGEGKRSTGKKTVIRFEKAIIAAGSQAVKLPFIPEDPRIVDSTGALELPEVPNKMLVIGGGIIGLEMATVYSTLGA
    DIDVVEMLDGLMNGADRDLVKVWEKKNKDRFGKVMLKTKTVGVEAKPDGIYVKFEGEAAPAEPQRYDLVLVSVGRSPNGK
    RISAEKAGVAVSERGFINVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEAAHGEKAYFDAKQIPSVAFTDPEVA
    WAGLTEDECKEKGIKYSKGVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGGIVGTHAGDLISEVCLAIEMGADAVDI
    GKTIHPHPTLGESIGMAAEIYEGTCTDVPPPRKR

    >gi|113867474|ref|YP_725963.1| peroxiredoxin [Ralstonia eutropha H16]
    MKTVGDKLEAFHVVGVKPGFNNHEENGQSAFEDITEKSFEGKWKIIYFYPKDFTFVCPTEIVAFAKLNGDFADRDAIVLG
    GSTDNEFVKLAWRREHKDLNKLNQWQFADVTGSLIDQLGVRDHAAGVALRATFIVDPDNVIQHVSVNNLNVGRNPEEVLR
    ILDGLQTDELCPCNRAVGGATL

    >gi|113867528|ref|YP_726017.1| methionine sulfoxide reductase B [Ralstonia eutropha H16]
    MTTTKTDAEWREQLSDIEYRVTREAATERPFTGRYWDHWDNGIYHCVGCGTPLFESATKFDAGCGWPSYFRAINGEVIAE
    HVDHSHGMTRVEVRCKECGSHLGHVFEDGPAPTGLRY
    CINSAALKFDDRDPAQRAADDAHAAGSDDNPRRDPQR

    >gi|113867529|ref|YP_726018.1| hypothetical protein H16_A1518 [Ralstonia eutropha H16]
    MPDTPQSQAPQPSDAATPATLSAPWRTAPGFAELGAQFFTRLRPTPLPAPYLVGVAPAAAALLGWDAGIGSQQDFIETFI
    GNQVPDWADPLATVYSGHQFGVWAGQLGDGRAIRLAQAETATGPWEIQLKGAGLTPYSRMADGRAVLRSSIREYLCSEAM
    AALGVPTTRALSIMGSDAPVRRETIETSAVVTRLSPTFIRFGHFEHFAAHDDVAALRKLADFVIDNFMPACRDDAQPYQA
    LLREVSLRTADLIAHWQAVGFCHGVMNTDNMSILGLTIDYGPFGFLDAFDANHICNHSDTQGRYAYSQQPQVAFWNLHCL
    AQALLPLWLPPEDADQEGARDAAVAAARAALDPFRDRYAAAFFRHYRAKLGLRPPAGGDDKSDEPLLTSLFQLLHGQRVD
    YTLFWRKLCGISSTDASRDAPVRDLFLDRAAFDAWVADYRVRLRAEQSHDAARELEMLAVNPKYVLRNHLAETAIRHARE
    KDFTEVDRLLAVLSRPFDEQPEAEHYAALPPDWASGLEVS
    CSS

    >gi|113867595|ref|YP_726084.1| hypothetical protein H16_A1584 [Ralstonia eutropha H16]
    MSEIIKSHGFTNEVLDWKAWLDVVELDQATPEQVAVLEESHPKAKVQDYYRFLVHQPEILRQRSTAFNAIMYAPGGMPRA
    ERELSTTVVSRINGCVY
    CASVHAQRFEQLAKRNDVIRQVFDDPHTAGTTAREQAIAKFSIELTERPAEVTAEQLKPLREA
    GVTDAEILDLIHSIAIFAWANRLMLNLGEPVFPEQSGE

    >gi|113867673|ref|YP_726162.1| redox protein, regulator of disulfide-bond formation [Ralstonia eutropha H16]
    MSKIEKVLATGKTHTMHSSAGVTSRGHNGTLDIALSPGNSTTPAHVFTTVQPHPTAEQLFAGAWSACYIAAVGLVAKEMK
    LELPSDLAVDIEVDLGQTGADYFLQARLNLRAPGLPQDVATQLAHAADAI
    CPYSKATRGNIEVALNVFTS

    >gi|113867746|ref|YP_726235.1| hypothetical protein H16_A1750 [Ralstonia eutropha H16]
    MRLDYTKAAPGGVKAFGSVYGYVMQSGLDDVLVELVYLRVSQINGCAYCLDMHTRDLVKRGVSVGKLALVQVWHEAGALF
    SDREKAALAWAETVTRVSETHVPDDAFGAASAVFSEKELADLTMAISLMNAFNRLAISFRRAPQVEGQGDA

    >gi|113867753|ref|YP_726242.1| putative cytochrome c biogenesis protein [Ralstonia eutropha H16]
    MSLLILAYLGGILTILSPCILPVLPFVLSRTGQPFLRGKLPMLAGMALTFAAVATLASAGGAWAVQANAYGRLAALALLA
    LFGLSLLLPQVADTLARPLVALGNRLTGNPAASTQAASPSPWGSLLLGIATGMLWAPCAGPILGIVLTAAALQGASVSTS
    LALAAYAAGAATSLAAALGIGAHMFAAMKRSMGASEWVRRGLGAGVLGGVLAIGLGADTGLLARLSASGPVRIEQALVDV
    LHKARPAPQAAHAAAQPGTGMLLAANDMPVAMPDRLPVEGRMPALDGAVQWINSAPLTRDHLRGKVTLVYFWTYS
    CINCI
    RTLPYLRAWADKYKEQGLTVIGVHTPEFAFEKSPDNVQRAVANFRIGFPVAVDSNYRIWRAFQNSYWPAAYFVDAHGNIR
    HHQFGEGDYANSERVIQALLAEAGRPSTARDVVAPLAEGAQAAPDLSNLRSGETYLGYLQAANFASPGGMRQDAPQRYSV
    GKLRLNQWGLAGQWTVGAERAALDKADGSIVHRFHARDLHLVLGPAPDGRAVRFLVTIDGKPPGDSHGADIDAAGNGAVT
    QTRLYQLVRQAGKVGEHTFEIRFLDPGAQAYAFTFG

    >gi|113867755|ref|YP_726244.1| Thiol-disulfide isomerase and thioredoxins [Ralstonia eutropha H16]
    MLTAPIPRSGRGQGGRAPRGIRFHHNSARASIMRTKLYRLVPIGLLIAAVGIAVFGQRGLAPTVGDQGRAPEFTGIHQWL
    NSPPLSMEGLRGKVVLVDFWTYA
    CGNCINTLPYVKQWHDKYKDQGLVVVGVHTPEFPFEKSTANVQAAIRRFDIRYPVAQ
    DNAYATWSAFSNQYWPALYLIDANGRIVYKHYGEGSYAETEDTIRKLLAQRK

    >gi|113867767|ref|YP_726256.1| hypothetical protein H16_A1776 [Ralstonia eutropha H16]
    MFDMKDLARLRKLDENAPEAMKSFRAFDQAAFADGALSVQQKQIIAVAVALTTQCPYCIALHTKAAHDAGATNAQLAEAA
    LVAAAIRAGGAVTHATHLFRD

    >gi|113867770|ref|YP_726259.1| thioredoxin reductase [Ralstonia eutropha H16]
    MSKDSALGARGVSRPAASTCESSAIEEDASVREHPRYQQMFPVLTDEEVARVCRFGNPCHYVKGDFLYRAGSICPGVFII
    LSGKVRIVIRDGLSQQRILHTYTMRGEFTSDITQLSSKPAVVDAHVIEDVEAVLLRPDELSAMIVNEAGPGDKIMRALIL
    RRVLAIERGRGVVFVAAPGNARLLELQNFLRRNAFPNLTLDAEEDAEAIALLQRLTPQPDDFPLVVCPDGTVLRNPDVGQ
    LASCLGLIPDFNPAHVYDVAIIGAGPGGLAAAVYASSDGLSAAVFDCRAPGGQAGTSARIENYLGFPTGITGQDLASRAF
    IQAQKFGAHIGIPCEVKALYCDRHPLAVELADHRRISARTVVIASGAEYRRPVVDGLERFER
    CGVYYWATPIEARLCRNE
    PVLLLGGGNSAGQAAVFLASHAEHVHMFIRGSRLADSMSRYLIERIGSLENLTLHTGTELTALEGGVRLERVHYRGAGGI
    EGSMTTHHLFVFIGALPNTDWLRRCGVVLDGNGFVLTGADVSEASLLPLQTSVDGVFAIGDVRSGSTKRVASAVGEGAAV
    VAQIHQFLSPVRPAQRERT

    >gi|113867779|ref|YP_726268.1| redox protein, regulator of disulfide bond formation [Ralstonia eutropha H16]
    MTQSGQTLYTGKTHTTGGRDGAARSDDGRLDVRLSSPGSSGSGTNPEQLFAAGWSACFISAIGFAARASKIALPPDLAVD
    AEVDLANSEGAYFLRARLNVSLPGVDTETARALVDTAHLN
    CPYSKVTRGNLDVEINLV

    >gi|113867784|ref|YP_726273.1| hypothetical protein H16_A1800 [Ralstonia eutropha H16]
    MARTVALKPEQVPADSKPTLDAFTKNIGFTPNMMASFAQSPIAFNAWATLLGSLSKALDVKTRDGIGLAVSEVNGCNYCL
    TVHSFTAEHMAKLSAEEIILARKGHASDPKRDAALQFARKVIEARGNVSDADLKAVRDAGYTDANVMEIVALVAMYSLTN
    FFNNVFDPEKDFPAVTPAGSI

    >gi|113867892|ref|YP_726381.1| MIP-(macrophage infectivity potentiator)-like protein [Ralstonia eutropha H16]
    MSRVPLVNPATATGDSQALLAEIHGAFGVAPNMFRAVANSPAALRSMWRAFGALGGGVLDAALGEKIAVAVADRNQCEYC
    LAAHTALGQKAGATAQEMSEAQAGRAQDARTAAALSFALKLVNQRGQVSDTDVAQLREAGFNDEQIVEILAHVALNLFTN
    YVNVAFAVPVDFPKIKLRAAA

    >gi|113867962|ref|YP_726451.1| hypothetical protein H16_A1982 [Ralstonia eutropha H16]
    MLIDLANFTPGLSLVGGLIIGAAAAVLLLFNGRIAGISGIFGGLLSLPRKDMAWRLTFLAGLVGAPVIASLLGKPAIADI
    QASWGEILAAGFLVGLGTRYASG
    CTSGHGVCGISRGSIRSLVATLTFMVAGFLTVFVQRHLIGG

    >gi|113868047|ref|YP_726536.1| arsenate reductase [Ralstonia eutropha H16]
    MTVLLYGIPNCDTVKKARTWLDANGVAYTFHDFKKQGVDEAMLRGWLKHVPLATLLNRKGTTWRTLSDADKARAEQEAGA
    IALMQQSPSLIKRPVLAHDGKVMVGFSADQYAGQF

    >gi|113868088|ref|YP_726577.1| disulfide bond formation protein B [Ralstonia eutropha H16]
    MQANSRAYFLLIALVSFGLVGVALYLQFEKGYQPCPLCVMQRFAFIGIGIFSLLAAVAQNTRSLWQGLGMLSGIAGIAVA
    VYHVSLLLNPKAS
    CGIDPLENWVNALPTAKALPQVFYADGLCTAPLPPVLGLSVPAWSLIWLFILTLTLAVGLIRREKNF
    R

    >gi|113868184|ref|YP_726673.1| ArsR family transcriptional regulator [Ralstonia eutropha H16]
    MRTLKNHLYEQVARIGKAVASPKRLELIELMCQGEKTVEVLAAQAEISVKLASAHLKELRQARLVETRKDGKYVQYRLAS
    TSVADLWVTLRSAAEERLVELQVALASIIGHGDDLEGFDRAAILKKARAGEVLVLDVRPAEEFATAHLPHARSLPLDELR
    KRLAELPKDMPVVAY
    CRGPFCLMAKDAVEFLRKKGYRAFHLTDGVAEWRAHGLPIEA

    >gi|113868245|ref|YP_726734.1| bacterioferritin comigratory protein [Ralstonia eutropha H16]
    MTVSLNKAVPDFSAPMTGDATFRLADYRGKTVVLYFYPKDNTPGCTTEAMNFRDQYEDFQKAGVQVFGISRDSIRSHENF
    KAKLELPFELISDADEAVCTLFDVIKLKKLYGKEHRGIERSTFIIDGKGILRHELRGIKVPNHVDEVLEIVRGL

    >gi|113868298|ref|YP_726787.1| dihydrolipoamide dehydrogenase [Ralstonia eutropha H16]
    MSKQFDVLVIGAGPGGYIAAIRAGQLGLNVACCEGNPYDDPKGEARLGGTCLNVGCIPSKALLASSEEFENVQHHLGDHG
    ITVGDVKVDVAKMLKRKDDIVGKMTKGIEFLFRKNKVTLLKGYGKFVGKSAEGFQVDVAGEVVTAKQVIIATGSKARHLP
    GIKVDNDLVSDNEGALKFPAVPKKLGVIGAGVIGLELGSVWRRLGSDVTVLEALPAFLGAADEGVAKEAQKQLTKQGLKF
    SLGVNVNEVTTGKNGVTVKYTDKDGKAQTLEVDRLIVSVGRVPNTDNLGLDAVGLAADQRGFIEVDDHCATKVPGLWAIG
    DVVRGPMLAHKAEDEGVAVAERIAGQKPHIDYNCVPWVIYTFPEIAWVGKTEAQLKAEGREYKAGQFPFMANGRALGMGH
    ADGFVKMLADAKTDEILGVHIVAANASDLIAEAVVAMEFKAASEDIGRVCHPHPSMSEVMREAALAVDKRQLNM

    >gi|113868368|ref|YP_726857.1| thioredoxin [Ralstonia eutropha H16]
    MSEQIKYVSDASFDADVLQSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKINVDENQQVPAKFGIRGIPTLI
    LFKNGAVAAQKVGALSKSQLTAFLDGNL

    >gi|113868521|ref|YP_727010.1| hypothetical protein H16_A2559 [Ralstonia eutropha H16]
    MAGMPALTLYGRAYCHLCEDMKVALEPLRRDFSFALHEVDVDADAGLEDRFGELVPVLMPGTPADLQGGAVELCHYFLDE
    AAVRVWLAAHGSARTTR

    >gi|113868554|ref|YP_727043.1| thioredoxin reductase [Ralstonia eutropha H16]
    MDLSIPNPVADTTKQVDGGSPAGGQPQEIDALIVGAGPVGLFQVFELGLLEIKAHVIDSLKVVGGQCVELYPDKPIYDIP
    AVPICTGQELTDNLLKQIEPFEPTFHLGQEVAVVERREDGRFFVETSLGTRFITKTIFIAAGVGSFQPRTLKVEGIDKFD
    GKQLFYRVKDPSRFHGRNLVIIGGGDSALDWTLDLVGKAESVVMIHRRDGFRAAPASVAKMKELCEQMEMQFLVGQVGGY
    EEKDGVLTEIKVTGADGVTRRLPVDDLLVFFGLSPKLGPIAEWGLDLERKQIKVDTEKFETNIPGIFAVGDINTYPGKKK
    LILSGFHEAALAAFGAAPYIFPEKKIHMQYTTTSPKLHKILGVDSPVFD

    >gi|113868622|ref|YP_727111.1| glutathione S-transferase [Ralstonia eutropha H16]
    MLRIWGRLSSINVQKVVWCARELHLDHERVDIGVTKGDLDTEAYVRLNPNRQIPVIEDFRGTDVGGEPFVLWESNAIVRY
    LCARYGEGTLWPEDVKARASADRWMDWQTTAFSPAMVTAFLNLVRKPKAERDEAAIKASCERTEPLAELLDKALAGREFI
    GGDRFTMADISLACAAHRWMGLPLKHQSRPNLERWLSAMRARPAADGILELPLR

    >gi|113868695|ref|YP_727184.1| rhodanese-related sulfurtransferase [Ralstonia eutropha H16]
    MQKPLISVTALQSLLATPGGCVVIDCSFDLADPAAGREAYRTGHLPGAFYLHLDNELSGPKTGSNGRHPLPDADDLVARL
    QALGVDDDTPVVAYDAQGGMFAARLWWLLRWLGHDAVAVLDGGKDAWVKAGLPLEHDATEEPELPGKFQRRKSLAPTVDA
    AALVDNLERASLLVVDARAPDRFRGENETLDPVGGHIPGAVNRFFKDNLGADGRFKPAETLRAEFGAVLGARAPAQAVMQ
    CGSGVTACHNLLALEAAGLGGAALYPGSWSEWCADPARPVATGAA

    >gi|113868753|ref|YP_727242.1| thioredoxin domain-containing protein [Ralstonia eutropha H16]
    MSDVTLQNFETEVIEASRQAPVLVDFWAPWCGPCRTLGPMLERLESEAGGQWKLVKVNVDENQDLAAHFGVRSIPHVVAI
    ADGQAVDQFIGVLPESGLREFLGRLMPRPAQTALHDALQLAAEGDRAGAEAKFDEAIALDPETDAARLAYIGFLLDGNAI
    AEARSQFEALSPQAAQQDAHAALRMRMDAMEGLSGLPDEPTLSARIAADPRDLAARRDLARLLIARQQYEPALEQLLEIV
    RTDRTFEDDIGRKTMLSVFEMLADRPDVVSHWRRQLSTALN

    >gi|113868763|ref|YP_727252.1| methionine sulfoxide reductase A [Ralstonia eutropha H16]
    MEHGLETATLGGGCFWCLEAVYQQVDGVVAVESGYTGGHVDHPTYQQVCEGDTGHVEVVRVTFDPSVINYRQILEIFFAI
    HDPTTPDRQGNDVGPQYRSAIFTHSEAQRATAEYVMRELAAAKVFDAPIVTQVEPEQPYWRAEASHQNYYQDHPSQGYCA
    FVISPKLAKFRKQFGGKLRK

    >gi|113868776|ref|YP_727265.1| peroxiredoxin [Ralstonia eutropha H16]
    MALRLGDIAPDFEQDSSEGRIRFHAWLGDSWGVLFSHPADYTPVCTTELGLTAKLKDEFARRGVKAIALSVDNVDSHRGW
    IQDINETQSTTVNFPILADGDRKVSQLYDMIHPNANETLTVRSLFIIDPKKKVRLIITYPASTGRNFNEILRVIDSLQLT
    DNHSVATPGNWQDGDDVVIVPSLKDEAVIREKFPKGYQAVRPYLRLTPQPNK

    >gi|113868781|ref|YP_727270.1| transporter component [Ralstonia eutropha H16]
    MPEIDLAALSRTVLLSTFILTFLFGAVLQRTHFCTMGAVSDIVNMGDWSRMRMWVLAIGVAMIGTGVLAWTGAIDPTKTI
    YTASKLGWLSALAGGLMFGFGMVLASG
    CGSKTLVRIGAGNLKSLVVFVFLGLSAYMTLRGLFGVVRVNTVDAVALTLPTT
    QDLPSLLAQGTGLARGALQLGLGLALGGVLVLWALAGRGFRSFDNLLGGIGVGLIIVAMWYVSGHLGYVAEDPNTLEELF
    VSTNSGRMESLSFVAPYAYTLDWLMMFSDKSKVVTVGIVSVFGVIAGAAAYALATRTFRWEGFGNAEDVANHMVGGILMG
    AGGVTALGCTVGQGLSGVSTLALGSFIALAGILAGAVLAFRYQIWRLERMA

    >gi|113868833|ref|YP_727322.1| rhodanese-related sulfurtransferase [Ralstonia eutropha H16]
    MQVIKATELAQWLADASRAKPVLLDVREGWEVQTCAMPGITHIPMRDIPARAAELDEDADIVCICHHGARSMQVAAYLER
    QGYGKVYNLTGGVDAWASDVDPAMPKY

    >gi|113869056|ref|YP_727545.1| glutathione peroxidase [Ralstonia eutropha H16]
    MSNVYQFEANSLAGQPVPLSQFQGKVMLVVNTASECGFTPQYEGLQKLYDEYHERGLEVLGFPCNQFGKQEPGDAQQIGQ
    FCETRFAVRFPMFAKIDVNGADAHPLYQWLTTEKRGVLGTQGIKWNFTKFLLRRDGTVFKRYAPTTKPDELRADIEMLLS
    DPAA

    >gi|113869123|ref|YP_727612.1| thioredoxin-like protein [Ralstonia eutropha H16]
    MAVVACAAGALAGHFVFSPKPASDQAVETFFQTRLPDAAGADLDLGKLRGKTVVINFWAPWCGPCVEEMPELTALHEEYK
    DRQVEFVGIGIDSAANIQQFTTKVPVAYPLAVAGFAGTELSRNFGNSAGGLPYTVVINPDGSVKYRKMGRVTAEELRAVL
    PRA

    >gi|113869129|ref|YP_727618.1| thiol peroxidase [Ralstonia eutropha H16]
    MSNVTLGGNAIEVAGKFPQAGDKAPAFSLVGKDLKDVTLADFAGKRKVLNIVPSLDTPVCQASARKFNEAASGLANTVVL
    TISADLPFAMGRFCTAEGLANVVPLSTMRGAEFKGNYGVDIKSGPLAGVTARAVVVLDENDTVKYSQLVPEIKTEPDYDA
    ALAALK

    >gi|113869220|ref|YP_727709.1| peroxiredoxin [Ralstonia eutropha H16]
    MITVGSRVPDATLQEFFETEGNGCALGPNAFKVADLVRGRKIVVFGLPGAFTPTCSAKHVPGFVQHAAALREAGVDEVWC
    VSVNDAFVMGAWGREQQTGGTVRMMADGSAEWTRALGLDQDLGARGMGVRSKRYAMVIDDGVVTRLDVEAPGEFRVSSAE
    AVLAALRG

    >gi|113869279|ref|YP_727768.1| protein-disulfide isomerase [Ralstonia eutropha H16]
    MFPFLRRRPAMSAAITAIAGGLAAAGFALHAMAAGEPGTDRIKESLQKMVGGRAEVKSVSKTPVPGLFEANIGGQVVYTD
    ASGRYILNGEMIDTRTGTNLTEERLAEINRIKWSDLPLARAIKWTKGDGSRQVAVFSDPN
    CGYCKRIEQTFQQMDNITVY
    TFLYPVLSPDSETKAKQVWCASDRTKAWRDWMLKQVALTGNGSCKTPLEENLALGHSMNVTGTPAVFFTDGTRIPGAADV
    ATLERKLASIKK

    >gi|113869291|ref|YP_727780.1| glutaredoxin-like protein [Ralstonia eutropha H16]
    MASHSPQAAPATRHRPTEKQTMSDVQQKIDQIVKSNPVVLFMKGTAQFPMCGFSGRAIQILKACGVDAPTTVNVLDDEGI
    RQGIKEYANWPTIPQLYVNGEFIGGSDIMMEMYQNGELQTLLKG

    >gi|113869342|ref|YP_727831.1| stringent starvation protein A (glutathione S-transferase) [Ralstonia eutropha H16]
    MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDISVMNPYGQVPILVERDLILYESNIINEYIDERFPHPQLM
    PADPVQRARARLFLFNFEKELFTHVYTLENEKGKAAEKNHERARAAIRDRLTQLAPIFVKNKYMLGEEFSMLDVAIAPLL
    WRLDHYGIELSKNAAPLLKYAERIFSRPAYIEALTPSEKVMRR

    >gi|113869402|ref|YP_727891.1| Thiol:disulfide interchange protein [Ralstonia eutropha H16]
    MTIGLALPERARGQVWARHIAAALLAALAWVCLAGGAHAATEDDFLPPEQAFRFAASQLDDKTVEVRFEVAPGYYMYRER
    FAFAAQPADVKLGMPAYPPGKVKFDETFGKEMETYRDSVVIRVPVEAAPADGKWSLTVTSQGCADKGLCYPPMESVYKVG
    GSGLADLFGKRGRSDAPAAVPAPAPAAPAVLRADDSDRIAGALASRNLALIAALFFGLGLLLTFTPCVLPMVPILSSIVV
    GEHVTRGRALVVSLAYVLGMAVVYTAVGVAAGLLGEGLSAALQTPWVLGLFAALMVALALSMFGLYELQLPQRWQTRLTE
    SSHRRQGGQVAGAAAMGAISALIVGPCVTAPLAGALAYIAQSRDAVIGGAALFAMALGMGVPLVLVGVGAGNLLPRAGRW
    MEVTKRFFGFLLLGVALWMLGPVLPAWASMLALAALLLVAAVFLGAFDGLGPDPRNLARVGKGVGVLFAIAAAIVLIGVA
    SGGRDPLQPLSHLSVARGGAEAAAGAQAVRFERVRSVAELDARVAQAAAAGKPVLLDFYADW
    CVSCKEMERMTFVDPRVR
    ARLSEIVLLQADVTANNADDKALLKRFGLFGPPGIILFGPDGRERPVRVIGYQSANRFLESLERAFGTRTST

    >gi|113869501|ref|YP_727990.1| Thiol-disulfide isomerase and thioredoxins [Ralstonia eutropha H16]
    MRAPAVLLRWLLAFSLTGAAAGAAALEVGDTVRLPDVRTLDGRTLSAGALAGKPLVVEYWASWCPFCAMQNPRLQKLYER
    TRGTPLQVLTISIDKDPREAADYMKKRGYTFPATMDSPELQAVFGKRKGLPELYVIDARGRVAQKEVGEMLEDDVAALER
    YARP

    >gi|113869522|ref|YP_728011.1| arsenate reductase (glutaredoxin) [Ralstonia eutropha H16]
    MITIYHNPRCSKSRETLALVQAASERLGEPVEIVEYLKEPPSLATLRQLHTMLGVPVREMLRDNEAPYADLGLADPGLTE
    AELLAAVADNPILLQRPVVVRNRRAAIGRPPENVAPLLA

    >gi|113869604|ref|YP_728093.1| putative copper uptake P-type ATPase [Ralstonia eutropha H16]
    MPNSSAVLASQPVRPADEMPEWRLPVDGMTCASCVRRVENALARVPGVRDVAVNLATEAATLRADSGAVLPAAARAVADA
    GYTVPQDTIGLNIADMT
    CASCVSRVEKALRAVPGVMEAQVNLATERASVTLLRGAADTAALVAAVARAGYGATPVADAAS
    QAPQAAQGTAFWDGPWPVAISAALSLPLVAPMVLEWLGVHWMLPAWVQWLLATPVQFVFGWRFYKAGWKAVRAGAGNMDL
    LVALGTTAAYGLSLWLMWRTPADAMPHLYFESAAVVITLVRLGKWLETRAKRQTADAIRALAALRPDTARVRRGGVEQSV
    PLAAVRVGDEVVVRPGERIPVDAEVIEGNSHADESMLTGESVPVPKKPGDRITGGAINFEGLLVARTEAVGAETVLARII
    RMVEHAQAAKAPIQRMVDQVSAVFVPVVLGIALLTVLGWGLFAGDWETALLNAVAVLVIACPCALGLATPTAIMAGTGAG
    ARAGILIKDAEALEVAHRVSVVAFDKTGTLTVGKPEVVALHAADPADADGSALLARLAALQAGSEHPLARAVLAAAQARG
    IAAPQATEVQALPGRGIAGVVDGQALQLGSERLREALGAAAGTLATLAEQLRADGRTVSWLVETTLPRVAGLVAFGDAIK
    PGAPAAIARLRAAGVRTVMLTGDNAGAAARVAQALGLDDVQAEVLPEDKAARVQALGRDGAVVAMVGDGINDAPALAAAD
    VGIAMSTGTDVAMHAAGITLMRGDPALVADALAVSHRTVRKIRQNLFWAFFYNVVGIPLAAAGLLNPVVAGAAMAFSSVS
    VVSNALLLRRWRPQAGAATAQGGER

    >gi|113869638|ref|YP_728127.1| Thiol-disulfide isomerase and thioredoxins [Ralstonia eutropha H16]
    MTVYFPERDAGAIAGCLAARPQGRLVACLCAQWCGTCRDYLAALTALASRHPEDCFVWIDIETHADALGDIDIENFPTLL
    VQPASGGTPQFYGTLLPHIEVLERMLSRGAAMPASAEDVPQVLDWLLAGGSSAA

    >gi|113869659|ref|YP_728148.1| dihydrolipoamide dehydrogenase (E3 component of pyruvate or 2-oxoglutarate DH-complexes) [Ralstonia eutropha H16]
    MEQVPRVRDGRTRRNDKVRKADLVVIGGGSGGVACARRAAAHGARVILVERDAIGGTCVNRGCVPKKMLSYGAGWSAILS
    GCLSHTGGREDWRDAIVRVNAEVARLNAGYTQRLHESGVEILRGDALVTGKDEVRVGDETIHARRILIATGARPRALEVP
    GGELAASSDDVFTWQTVPGSIAVIGGGYIGVEQASILSRYGVKVDLIVAGDRLLPHFDHDISRSLAEALTARGVRLHLNA
    RVHLLSQANGAVEVCYRPTDRPGQTEAVRAQAALAAIGRISNVQGFGLEAVGVDFGDKGGIRVDRQFRSNVRGIYALGDA
    IDGLHLTPVATAQGRWLADRLYGRRGERADFDFVPTAVFCEPAIGAVGLTEAQAIAAAGRPERIRTVVKRFVSLENRFAG
    NSHQSMFKLVLNARSGRVLGAHLMDDAAPEIVQTLAVALRLGVRESHLQTTVQLHPTVAEELYG

    >gi|116694092|ref|YP_728303.1| thiosulfate sulfurtransferase [Ralstonia eutropha H16]
    MVGELQALLENHGLMLVFLNVLVEQAGLPVPAYPMLFVAGALGMQETGPSIGAVLAAVIFACLIADTGWYFAGRRLGQPM
    LRTICRVSISQDSCIRQTQSLYLRVGPRSLVIAKLLPGAGALSTAMAGMTGTPLPVFLFYDAIGALVWAGSALLIGVVFS
    DFIDAILEAFSAYGHMAVVGLLVAFALFLAWRWWRRFRLLRRTRRVPRMTVDELEARRLAGSLPVVIDVRAHGDTPMERI
    PGSVVLDMQGALDSLDALGVPHAGADIVVYCA
    CPNELSAALLAERLRVAGYPKTWALAGGFDEWKRRHGGTAPTEAANQP
    GPAEAA

    >gi|116694107|ref|YP_728318.1| DNA-binding protein [Ralstonia eutropha H16]
    MTTDLKTRLTEINRQFGALGQAQPAAMSAFQGVMKAATQDGSLPAAVKELIAVALAVQKGCDDCVLFHTSQALRHRATRE
    QLAEVLAINIEMGGGPGAMYASKALAYFDALNA

    >gi|116694110|ref|YP_728321.1| hypothetical protein H16_B0150 [Ralstonia eutropha H16]
    MTIQATWQPSQGNSICHLTNGTAEWQADLDASAGGDTQYPNPHDLLDSALAACTTLTLQLYAKRKGYAITEVHVSVGHED
    ANGTYTMNREVKVSGELTPQILDDLLRVANRCPVHKTLSGQFSIQTSIA

    >gi|116694112|ref|YP_728323.1| organic hydroperoxide resistance protein [Ralstonia eutropha H16]
    MKLEKVVYTAHATATGGRDGRATTSDGQLDAKLAVPKEMGGAGNGLNPEQLFAAGYSACFLGAMRYVAGQQKITVPADAT
    IEGAVGIGPIPQGFGIQVELKISLPGFEREAAEKLVEQAHQV
    CPYSNATRGNIDVTLTVV

    >gi|116694232|ref|YP_728443.1| hypothetical protein H16_B0277 [Ralstonia eutropha H16]
    MRLDYTKASPGGVKAFGGVYGYVMQSGLEDVLVELVYLRVSQINACAYCLDMHTRDLIKKGATPEKLALVQAWREAGPLF
    THREKAALAWAESVTLVADTHVPEEEFQVAAAAFNEKELADLTMAISLMNAYNRLAISFRRAPESALAAKD

    >gi|116694249|ref|YP_728460.1| selenophosphate synthase [Ralstonia eutropha H16]
    MDQPNNAKIKLTAFSHGGGCGCKIAPGVLSEILRNSVGFAAPAALLVGKETSDDAAVYQLNDSQALIATTDFFMPVVDDP
    YDFGRIAATNAISDVYAMGGTPIMALALVGMPIEKLPPEVIGKILEGGESICAQAGIPVAGGHTIDSLEPIYGLVVLGLV
    HPNRVKKNSGAKAGDKLILGKPLGVGVLSAAVKKDKLDAAGYQELIACTTKLNTPGRLLAEVPAVHALTDVTGFGLLGHL
    LELCRGAGVGARLDMARIPLLPRVERMAAEGLVTGASGRNWVSYGSEVDLSTSVTPSQQALLTDPQTSGGLLVSCAPEAV
    DEVLEIFNREGFADAAVIGEMTQGAARVAVA

    >gi|116694890|ref|YP_729101.1| pyridine nucleotide-disulphide oxidoreductase [Ralstonia eutropha H16]
    MTKSSSSTDKPDLTQGVPLADLADGGMVTGQVGGKPVLLVRRADELFAIGATCTHYGGPLADGLLVGDTIRCPWHHACFS
    LRTGEVLGPPAQDDLKCWRVEQQDGKAFVRDALPAVRPPRLASARLPESVVIIGGGAAGTAAVETLRREGYSGPVTLLSA
    DRSLPYDRPNLSKDYLAGTANADWLPMRPPTFYADHDIDVRSDNRVVKLSPEQKSVTLSDGSNVSYGALLLAVGAVPIRL
    DVPGATLPHVSVLRTLAD
    CDALIARLGTARRCVVVGASFIGMEVAAALRTRGLEVHVVAPEAHPMERVLGATLGDMIKAL
    HESHGVTFHLGATVAEIQPDRVRLSTGAELAADLVVTGIGVRPDVALAQDAGLALDKGVAVDEFLQTSEPDIYAAGDIAR
    WPDPGTGQRIRVEHWVVAERQGVVAARNILGQRQRFAAVPFFWTQHYDVAINYVGHAEQWDRFDVDGDPAAHDCTVTYWG
    KDKRLAVATVGRDLASLRAEVAFEQETTGH

    >gi|116694902|ref|YP_729113.1| Thiol-disulfide isomerase involved in cytochromec biogenesis [Ralstonia eutropha H16]
    MRRFVPAAIFIMLLLLLGLGLAPRPSSPPSPLIGKSAPAFRLPLLDAPQQTVAPADLCGQVWVLNVWASWCGACREEHPK
    LMELARLTRVPIYGLDYKDGRDEAGAWLARHGNPYRASLFDADGRVGIDYGVYGVPETFVIDRRGVIRHKHVGPLTEEVV
    RKELLPMLAALENEPDVALASRGKGG

    >gi|116695038|ref|YP_840614.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Ralstonia eutropha H16]
    MTRPTQQPEVSTIERDPRWARVLARDPGADGAFVYAVKTTGVYCLPSSPSRLPHPANVEFFDNAAAAEAAGYRPSRRAAA
    PALAAQHAAIVADACRRIEAADTLPTLPELANAAGVSPYHFHRLFKAATGLTPRAYAAAHRARKLREQLGTSDSVTEAIY
    DAGFGSNSRFYETSDAVLGMTPSRYRAGGADTDIRFAIGQCSLGAILVAQSERGVCAILLGDDPQTLLQDLQDQFPRANL
    IGGDAQFEQLVAQVVGFIEAPSIGLALPLDVRGTAFQQRVWQALQEIPAGSTASYAEIAARIGAPRAVRAVAQACATNHL
    AVAIP
    CHRVVRSDGNLSGYRWGVARKRELLEREAQA

    >gi|116695042|ref|YP_840618.1| peroxiredoxin [Ralstonia eutropha H16]
    MLQSREGQRVPNVAFRMREDNEWKTVTTGELFNGKTVVVFSLPGAFTPTCSSTHLPRYNELAPVFAKHGVDDILCVSVND
    TFVMNEWAKDQESENITMIPDGNGEFTEGMGMLVDKADLGFGKRSWRYSMLVKDGVVQKMFIEPQEPGDPFKVSDADTML
    AHIAPDARKPDQVVVFSKVG
    CSFCAKAKQLLDDNGFDYIDVPLDNKVRGKVLGAVSGEMTAPQVFINGKLIGGAEALQQY
    LGK

    >gi|116695043|ref|YP_840619.1| dihydrolipoamide dehydrogenase [Ralstonia eutropha H16]
    MTTIQTDVAVIGAGTAGLAAYRAAIAAGKRAVIIEGGPYGTTCARVGCMPSKLLIAAAEAAHELRHTAPFGVHVDGEVRI
    DGREVMARVRSERDRFVGFVVRGVENIPEADRVRGYARFIDNTTLEVDGHTTVRASRVVIATGSTPMLPAPFQVFGDRLI
    VNDDVFAWEDLPASVVAFGPGVIGLELGQALSRLGVRVRVFGVSGSLGPLTDPVIRAYAAKTFNGEFYLDPDARVTDMAR
    DGDQVVVTYLDREGRSVTERFDYALVATGRVPNVRGLGLENAGLALDARGVPLFDARTLQCGNAPVFIAGDANNILPLLH
    EAADEGKAAGENAASYPQVKPLARRAPIAVVFTDPQIAMVGQRYADLAEGTFVTGEVSFEDQGRSRVMLKNRGLMHVYAD
    KATGRFLGAEWTGPRAENIAHLLAWSYQQGLTIGQMLGMPFYHPVVEEGLRTALRDAEAKLEA

    >gi|116695210|ref|YP_840786.1| thioredoxin [Ralstonia eutropha H16]
    MPMTQQYAATEPTRTEVDALPGATVLEFGAPWCGYCQRAQPALAEAFAVHPALRHLKIEDGSGRRLGRSFHIKLWPTLVF
    LRDGQEVARLVRPTESEPIREAMRRIA

    >gi|116695348|ref|YP_840924.1| hypothetical protein H16_B1405 [Ralstonia eutropha H16]
    MTQRTNYFQQSPELSKKLMEFGALFQKTTIEVPIRELVEIRASQLNGCAFCVDMHIKMAKIHGERELRLHHVAIWRESTL
    FSPRERAALAWTEVLTRLPADGVPDDIYEGVRTQYSEKELSDLTFLVGAINTWNRLNVAFRMVPGSSDKAFGLDKANLE

    >gi|116695430|ref|YP_841006.1| hypothetical protein H16_B1488 [Ralstonia eutropha H16]
    MHRLLRTLLATTAIVAAQHAAAAPADYGKAPEFTGIDKWLNSEPLTVAGLRGKVVLVDFWTYSCINCINTLPHVRQWYDK
    YRDKGLVVVGVHTPEFPFEKSTANVQAALKRFDIRYPVAQDNAYATWNAWRNQYWPALYLVDANGTVVYKHFGEGNYAQT
    EAAIQKALGKNK

    >gi|116695583|ref|YP_841159.1| putative heavy metal efflux P-type ATPase [Ralstonia eutropha H16]
    MARTSPEDALPQDHAAHAHDGAAHRHGGHDHDHHHDHDHDHHGHGHAEARQAPAASACCGGGCSSTVALTPAAPVDIPAG
    AQTAAWRIDAMD
    CPTEETLIRNKLGGMAGVAALEFNLIQRVLTVHHTLPSAEPVARAIESLGMQPVPLSTEAAQQVLPQT
    TASKPWWPLALAGVAALGAEAAEWLGLGLPWLPAVLALAAVALGGLTTYRKGWIALRNGNLNINALMSIAVTGALLLRQW
    PEAAMVMVLFALAERIEAASLDRARNAIRGLMAMAPEQATVQRADGSWETVPAAGVAVGALVRLRPGERVALDGKVVRGQ
    SALDQAPITGESVPVDKTEGDALFAGSINQSGELEYTVTAPASDSTLARIIHAVEAAQGSRAPTQRFVDQFARIYTPTVF
    ALALAVAVVPPLVMGGAWVDWIYKALVLLVIACPCALVISTPVTIVSGLAAAARRGILVKGGVYLEQGRHLAWVALDKTG
    TITHGKPAQTNHALLAEDAPQARAIAASLAARSDHPVSRAVATAAAADGIGTLPVDDFEALAGRGTRGKVQGVAYCLGNH
    RLVHEMGACSPALEARLEALEREGKTVVLLARVDGHGAATALALFAVADTVRDTSRQAIAELHELGVRTLMLSGDNPHTA
    QAIAAQVGIDEARGNQLPQDKADGIAALAGAAHARGGRIGMVGDGINDAPALARADIGFAMGAAGTDTAIETADVALMDD
    DLRKIPAFVRLSRRTSGILTQNIALALGIKAVFLVLTVLGMGTMWMAVFADMGASLLVVFNGLRVGAERRG

    >gi|116695701|ref|YP_841277.1| mercuric reductase [Ralstonia eutropha H16]
    MAQGFDAIIIGTGQAGPALAARLAGAGMKTAVIERARFGGTCVNTGCIPTKTLIASAYAAQLARRAAEYGVTIGGPVAVD
    MKQVKARKDEISGRSSNGVEQWMRGLENVTVYQGHARFESAHSVRVNGELLEADRIFVNVGGRALVPPMPGLDQVPYLTN
    SSMMEVDFLPEHLIIVGGSYIGLEFGQMYRRFGARVTVVEKGSRLIQREDEDVSQAVLEILEREGIEIRLNANCLSARRE
    GDHIAVGLDCSDGARDVHGSHLLLAVGRVPNTEDLGLDQAGVETDARGYIQVDEQLRTNVPGIWALGDCNGRGAFTHTSY
    NDYEIVAANLLDNDPRKVTDRIAAYAMFIDPPLGRAGMTEAEARQSGRRLLVGSRPMSRVGRAVEKGESQGFMKVVVDAD
    TRMILGAAILGVTGDEVIHSLLDIMYAKAPYTTISRAMHIHPTVSELVPTLLQELRLQA

    >gi|116695737|ref|YP_841313.1| organic hydroperoxide resistance protein [Ralstonia eutropha H16]
    MTRIEKVLYTGKVHISAGGRDGEAHSDDGRLNLQLSSPGTKGPGTNPEQLLATGWSACFIGAIGLAAGKMNVKLPAELSV
    DAEVDLGMAGEAYLLQARLNVHIPGIDREVAQALVDTAHRT
    CPYSKALHGNIHVETNLV

    >gi|116695739|ref|YP_841315.1| redox protein regulator of disulfide-bond formation [Ralstonia eutropha H16]
    MSPRHFGREFRLNTGQSPARAVEQLRVETARILAARKIKIALPENVAIDAEVDLGMAGDAYCLQARLNVHVPGVERETAE
    ALAHEAHQT
    CPYSKATRGNIDVTINVV

    >gi|116695798|ref|YP_841374.1| rhodanese-related sulfurtransferase [Ralstonia eutropha H16]
    MTKITATQAASVFPTYSPEDVRKALLNHDEIALIDVREEDPFAQEHPLWAANFPLSKLEIEAWARIPRRDTLIVVYGEYA
    GTDLAPRAAAVLRELGYTRVHLLEGGLRAWIDGGGEVFRDVNVPSKSFGEVVEARRHTPSLAAEEVQALIDTKADVVIVD
    ARRFDEYQTMSIPTATSVPGAELVLRVRELAPDPNTRVIVN
    CAGRTRSIIGTQSLVNAGIPNPVAALRNGTIGWTLAGQQ
    LDHGASRRAPAAVSDANRDSACRGAREIADRAGVRRIALAQIETLQQPGRTVYRFDVRTPEEFADSHLPGFVNAPGGQLV
    QETDHSAPVRGARIVLADDDDVRASMTGSWLAQMGWDVWVVEPATAAERSETGAVSAPVPASAPVSTVTAAELAKWIDAG
    DGSTAVLDFTTSANYVKRHIPGAYFVIRAQLADALPRIPQPRRYVLT
    CGSSLLARFAAADLQRLTDAEVLVLEGGTQAWI
    AAGLPLESGETRLASERTDRYRRPYEGTDNPREAMQGYLDWEFGLIAQLERDGTHGFRVA

    >gi|116695921|ref|YP_841497.1| hydroperoxide resistance protein [Ralstonia eutropha H16]
    MDNKGLQAPPLSLLDKYRGQGFHALYTTTVTVSGGETGHGRASGVARSDDGNLVIDLRLPAALGGPGHGHGTNPEQLFAA
    GYAACFHGALNLLAQRSNVSVDNLAVEVEIAFGRDPVDGGFALAADIRVRMPGVQRQVAEELVRNTERF
    CPYVKMARQGI
    VSVVAVVD

    >gi|116695923|ref|YP_841499.1| hypothetical protein H16_B1987 [Ralstonia eutropha H16]
    MTQRVNAMKQSPELFKKYLEFGTLLQDNAIEPSIRDLVEIRASQLNGCAFCLDMHVKQSRIHGERELRLHHVAIWRESTL
    FQPRERAALAWTEVLTNIPPHGVPDDLYERVRAHLSEKELSDLTFLVMAINGWNRLNVAFRTVPGSADKAYGLDKAKLE

    >gi|116696175|ref|YP_841751.1| peroxiredoxin [Ralstonia eutropha H16]
    MAIRLGEQAPDFTADTTEGKISFHEWIGDNWAILFSHPKDFTPVCTTELGYMARLKPEFDKRNTKIIGLSIDPVGDHQRW
    VKDIEETQNCTINYPMIGDADLKVAKLYDMIHPEASGSGPRTAVDNATIRSVFIIGPDKKVKAMLVYPMSAGRNFDEVLR
    LLDSLQLNAKHTVATPVNWKPGEDVIIPTSVSDEEAKKKYPQGFKTLKPYLRTVEQPK

    >gi|116696258|ref|YP_841834.1| dithiol-disulfide isomerase [Ralstonia eutropha H16]
    MPQPIKIDFVSDIACPWCAIGLSSLQLALQRLGDAVDAEIVVHPFELNPGMRPEGEAIVDYLGRKYGRTPAQIAETQAMI
    RERGAGVGFPFGERTHVYNTFDAHRLLHWAGLEGKQLPLKLALLRAYHADGKDPSNHEVLVEAAQAVGLDAAAARKVLDS
    DDYADAVRAEIQEYQRMGIQSVPSIIFNNRYLVTGGQPVEAFEQAIREVVAEAQQAGNS

    >gi|116696460|ref|YP_842036.1| disulfide oxidoreductase [Ralstonia eutropha H16]
    MNQPVSLFIQVGFDLVCPWCMIGKRHLETALAQLAQQRPDVAVTVEWRSSLLFPTLPPAGIPYRKFSLARLGSAEAVALR
    QAQVCAAAREAGITLELDRIEVLPNTVLAHRLIRYARQAGGEAAASVLIDRLFEEYFLRGEDLGDPRVLHAAAIASGMPM
    PQAAAPATVQDLAWLPPLHGEDVPLPNPGLGVPRFVINGAPPIAGARPPRALLEAMLRALARASPASPPPPGIALTAR

    >gi|116696486|ref|YP_842062.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Ralstonia eutropha H16]
    MTSYRHIDSPLGTILLRVQGAHLTGLFFAGQKYHPAGIADSRDVSPADAAVLDGAASELAEYFAGRRDTFTVPVRFAGSP
    FQQRVWEALLAIPCGETASYGELARTLGLPPTHARAVGGAVGRNPLSVIVP
    CHRVLGSAGALTGYAGGIERKRALLQREG
    VGTTPG