Psychromonas ingrahamii 37 uid58521

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|119943911|ref|YP_941591.1| soluble pyridine nucleotide transhydrogenase [Psychromonas ingrahamii 37]
    MSTVKDTTVKPKHDHYDAIVIGSGPGGEGAAMKLAKGGLRVAIVEKYKDIGGGCTHWGTIPSKALRHSVSQLIELKKNPL
    FLTNYPQNKTFTFRDVLTHTQSVIAKQVTMRSGFYNRNNCSLYFGGANFVDKNTVLITKDDGTTETITAKDIIIATGSRP
    YRPADIDFTAANIYDSDTILALDHHPQHIVIYGAGVVGCEYASIFNGLGVKTDLINTRDSLLSFLDTEMSDALSYHFRNS
    GMILRHDEEYEKVESTEEGVVIHLKSGKKMKADCLLYANGRTGNTDKLALENIDLKPDPRGQLTVNEHYQTGVDNIYGLG
    DIIGYPSLASAAYDQGRIAAHFILTQEGKKKLIKDIPTGIYTIPEISSVGKTEQMLTQQKVPYEVGRALFKDLARSQILG
    SEVGSLKILFHRETKEILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVKTTFNYPTMAEAYRVAALNGLNRLF

    >gi|119943982|ref|YP_941662.1| rhodanese domain-containing protein [Psychromonas ingrahamii 37]
    MLIDGRELVESLRSQVQEISAAQLHDILHKIPHDGTQAVLIDIREVAEIAAGTIANAVLIPRGVLEMQISSEESLKRRFP
    TLEMLAEQPVYLL
    CRSGARSVLSAISLQQMGFKHVYSVAGGFLAWQAAGYECTNKI

    >gi|119944003|ref|YP_941683.1| methionine-R-sulfoxide reductase [Psychromonas ingrahamii 37]
    MTDYKKPDEQKLREQLNNVQYQVTQQDATEPPFDNDYWDNHAAGIYVDIVSGEPLFSSLDKFDAHCGWPSFTQPLQPKKV
    LEKVDTQLFATRTEVRSAIADSHLGHVFDDGPAPGGLRY
    CINSASLRFIKLEDMAEQGYQEFLYLFDK

    >gi|119944069|ref|YP_941749.1| selenophosphate synthase [Psychromonas ingrahamii 37]
    MSADYEHTNVRLTQYSHGAGCGCKISPKVLDSILVSALPAFQDPNLLVGNENKDDAAVYDLGNGSCIISTTDFFMPIVDD
    PFDFGRIAATNAISDIYAMGGKPIMAIAILGWPINKLAPGIAAQVIDGGRSVCHEAGIVLAGGHSIDAPEPIFGLAVTGI
    VPTDKVKKNSQAKEGDLLFLSKPIGIGILTTAEKKGLLQAAHKNLARDTMCELNKIGAEFAHIEGVNAMTDVTGFGLLGH
    LSEICEGSGLSASLDFAAIPTLDAIEYYVEQGCVPGGSMRNFDSYGHKVTPLSELQKTILCDPQTSGGLLISVSPSSADI
    LLTTAKNSGVKLFQIGKIESKNAQQPVISVL

    >gi|119944122|ref|YP_941802.1| thiosulfate:cyanide sulfurtransferase (rhodanese) [Psychromonas ingrahamii 37]
    MSGYQLINAYDAKQRSLKENIQLVDIRDANSFEIAHAEGSFHLTNDTIADFIEEVEVNTTVFVICYHGNSSKGVAQYLCT
    QGYLDVYSVNGGFEGWQLVE

    >gi|119944143|ref|YP_941823.1| adenylyl transferase [Psychromonas ingrahamii 37]
    MLTDPEVLRYSRHLLLEDVGESGQSALKFSKVLIIGMGGLGSPAALYLAAAGVGTLVISDFDHLEVSNLQRQIAYQNSDL
    GAPKVTLMKQRLEALNPEVRVRVINTQMSQSQLSMELILADLVLDCTDNMASRQMINNACVQAKTPLIVGAAIRFEGQLM
    FFDHSKADSACYHCLFPNSEEPALN
    CSNAGVLGPVVGTIGTLQALEALKYLLGLPSGINNKLKLFDAKTLEWQTFVINKD
    PKCPVCGQIQ

    >gi|119944281|ref|YP_941961.1| glutathione-disulfide reductase [Psychromonas ingrahamii 37]
    MNNNKFDFDYICIGGGSGGIASANRASKYGQKVAIIEAKALGGTCVNVGCVPKKAMWYAGQIADALRYAPDYGFDAPLKN
    FSWAKLIESREAYIARIHQSYERVLGNNNITVIDGFAKFIDNHTVEVNGKTYTAPHITVATGGAPTVPAIEGAEHGITSD
    GFFALNEQPKRVAVVGAGYIAVEIAGVFNALGSETHLLCRRHTFLRDFDHMLSSTLVEVMQEEGPTLHTHSTPKSVHKNE
    DGSLTLHLENEKSLTVDCLVWAIGRNPANTDIGLENTDIELNKHKFINVDKYQNTTAQGIYAVGDNTGEIQLTPVAIKAG
    RFLSERLFNGQLDAHLDAKLVPTVVFSHPPIGTIGLTELEAEEKYGKSKLKVYTSQFTSMYTAMTTMRQPTRMKLVCAGE
    NQKVVGLHCIGLASDEILQGFAVAMKMGATKADFDSCVAIHPTSAEEFVTMT

    >gi|119944330|ref|YP_942010.1| thiol:disulfide interchange protein DsbA [Psychromonas ingrahamii 37]
    MNLIKQLFLTLILLCASQAFAKPELGKDYSILNPAMPTHSGKKIEVLEFFSYDCIHCYNFNPLMQAWTKRMPDDVSLTYV
    PVVYRADMEIPARAFYAVEYLGLHNKLHDTLFDIWHSSNPPYDKASLINALTPYGVDVTKFQNAYNAYSISQALERARGL
    AYTLDIHMQKNDYHIRSTPTLIIGGKYVISGESAHTIKLLYALIEKVRKEKKH

    >gi|119944504|ref|YP_942184.1| electron transport complex, RnfABCDGE type, E subunit [Psychromonas ingrahamii 37]
    MSEQSQEIPADKDKTDSADSVYRKLMRQGLWANNPGIVQLLGLCPLLAVTNTITNALGLGLATLFVVVASNSLISLIRHL
    VPQAIRIPIFVMIIASLVSCIQLLMNAFTYELYLSLGIFIPLIVTN
    CMIIGRAEAFASKNSIKHSAFDGLMMGVGFGLVL
    IILGASREILAQGTLFDGIETMLGDWAKILTITIYQADTSFLLAALPPGAFIIMGLIIAIKNAIDHRIKE

    >gi|119944509|ref|YP_942189.1| electron transport complex, RnfABCDGE type, A subunit [Psychromonas ingrahamii 37]
    MSDYFLLFIGTVLVNNFVLVKFLGLCPFMGVSNKIETAVGMSFATTFVLTLTAAVSYIVNKYILLPLDLVYLQTIGFILV
    IAVVVQFTEMVMHKTSPTLYRLLGIFLPLITTN
    CAILGLALLNINEDHDFVESIIYGFSAGVGFSLVLVVFSSMRERLAA
    SDIPLPFKGGSIAMITAGLMSLAFMGFTGLIK

    >gi|119944520|ref|YP_942200.1| NADH:ubiquinone oxidoreductase, subunit D [Psychromonas ingrahamii 37]
    MAKSNEIKAVLTSPIISNNPITLQILGICSALAVTSKLENAVVMTVAVLFVTAFSNFFISTIRNYIPNSVRIIVQMAIIA
    SLVIVVDQFLRAYAFSISKQLSVYVGLIITN
    CIVMGRAEAFAMKNKPIASFMDGVGNGLGYGVILILVGAFRELFGSGSL
    YGFVILPLTSNGGWYQSNGLLLLAPSAFFIVGGIIWAVRTMRPDQVEPKE

    >gi|119944521|ref|YP_942201.1| Na(+)-translocating NADH-quinone reductase subunit E [Psychromonas ingrahamii 37]
    MEHYISIFVRSIFMENMALAFFLGMCTFLAVSKKVKTSMGLGVAVIVVLGISVPVNQIIYFNLLAPGALAWAGFPAADLS
    FLGFITFIGVIAALVQILEMVLDKYFPALYQALGIYLPLITVN
    CAILGGVLFMVQREYNLMESLVYGVGSGVGWMLAIVL
    LAGIREKMKYSDVPAGLRGLGITFTTAGLMAIAFMSFSGIQL

    >gi|119944611|ref|YP_942291.1| alkylhydroperoxidase [Psychromonas ingrahamii 37]
    MSNFKIHTIESAPAESKEILEGAKEKMGVVPGLFGVLSESPNTLKAYTQLHQLFASSSFDAEELTVVWQTINVEHDCHYC
    VPAHTGIAHSMKVDPALTEALRNSEAMPTEKLQALQDFTLSMVRNRGNVSEQQTQAFFAAGYGQQQILEVILGLSQKVIS
    NYVNHSAKTPVDPMFEQFAWTKK

    >gi|119944615|ref|YP_942295.1| 3-mercaptopyruvate sulfurtransferase [Psychromonas ingrahamii 37]
    MPSLKIPGPLVSIDWLEKHLSHPDLVILDGSWHMPSVKRDGKLECLKQRIPGALFFDFNREICHQNNPLPHMMPSESDFQ
    ESVQNLGINQRSTIVVYDTVGIFSSPRVWWMFKTMGFENVAVLDSGFPAWLEKSLPIESGHIPQPVVKGDFIANYQKALI
    CTAEDVLQASGSSQQSIIDARPSARFLGQQAEPRAGIRVGHMPNAQNLPSTSVLENNKMKDAYQLALIFEALSGKDKRVI
    FS
    CGSGVTACILALAASLAGYENIGVYDGSWAEWGSRVDLPVIAEENSH

    >gi|119944628|ref|YP_942308.1| iron-sulfur cluster assembly accessory protein [Psychromonas ingrahamii 37]
    MTSEVQVEVAMPIYFSDSAANKVKGLIAEEENPNMKLRVYVTGGGCSGFSYGFTFAETANEDDTKIENAGVTLLVDPMSL
    QYLVGGTVDYTNGLEGSRFFVNNPNATATCGCGSSFSM

    >gi|119944632|ref|YP_942312.1| rhodanese domain-containing protein [Psychromonas ingrahamii 37]
    MIIKNMLKLATLLLFSSFCNAQVSHIEPQQLIKQIQNEKLLVILDVRTENEYTQGHIQGAINIPYDQLRKEQDKIIAYKD
    QQVILY
    CHSGRRADMAARTLQALGFTKLIDLTGHMVLWEQLQYPLVN

    >gi|119944690|ref|YP_942370.1| bacterioferritin comigratory protein (Bcp) [Psychromonas ingrahamii 37]
    MKRLVAGDKAPLFNLHDEQGKMIALADLTGKKVLVYFYPKAMTPGCINQACGLRDVKTQLDDFNTLVFGISPDPVKSLAN
    FVTKKELNFPLLSDQDHAVAEEFGVWGEKKFMGKVYDGIHRISFLINEQGIIEHVFDKFKTTDHQQVVLDYLKNKESI

    >gi|119944695|ref|YP_942375.1| heavy metal translocating P-type ATPase [Psychromonas ingrahamii 37]
    MTLQKNCFHCGEENPPSTDFNVQINTVSQRMCCPGCQAVAQTIVDSGLTSYYEHRSEPAEKGLLLVPDVLLQLEDYDIGK
    IQEDFVDNVVDNNENLSTTTLSVEGIT
    CPACAWLIEKQLRSLPGLVFINVNTTLNRAVIKWDQQQLKLSQILTGIQKIGY
    KAYPFQVNKQEAFYTQLTKSYLQRLGLAGLATMQVMMFAIALYADFFSGMEEQFIHYFRWVSFILATPVLLYSAQPFYLN
    AWRNIRNQTLGMDIPISIALLGAYTASGYATIVGQGEVYFESVSMFTFLLLLGRLLELRARRKASESSSNLLRLLPSMAT
    LIEDPDNLQIQSVIPAKTLTVGQYIIVKPGQTIPVDGLILKGASNIEESMLTGEHLPVSKAQNAPVFAGSVNITSQLIIR
    VEKVGNNTLIADIIHLQDNAQLNKPKIEIIADTAARYFVAALLIVASLTYISWSFIAPDQAFWITLSVLVATCPCALSLA
    TPTALTCATAQLNKQGILIKQHHVLETVNKINHIVFDKTGTLTKGNFKLLNTQYYSHYSKQECIDLAAQLEKNSEHPISL
    AFKKQQKNSIVLNDVVNRPGQGLQAKYLNKTLKLGHAVFCGVENNINSKELVIYLTLDKQLLASFELGDELRPSAPEILS
    YCHHHNINSTMLTGDISLKSEEVCEVLSISQLQKGVTPQQKLQYIQQLQKTDKVMMIGDGINDAPVMAGAHVSVALASGT
    DIAKNSADVILLGEDLNKLAALHKMANRTTLIIKENLVWAFGYNIIIVPLAVMGYVPPYIAVLGMSCSSLIVVCNSLRLL
    KS

    >gi|119944786|ref|YP_942466.1| peptide methionine sulfoxide reductase [Psychromonas ingrahamii 37]
    MKSKLILFILSSCLLYSANALADKAVLAGGCFWCMEADFEKLEGVNDVVSGFTGGKLKNPTYNGNHQGHYEAVEITYDAD
    KISYQALLDHYWVNIDPFDERGQFCDKGPSYLSAIFVANEQQRKTAEQSKALIAEQFLDQTIVTPILPAAVFYPIKGNES
    YHQNYAENNPIRYKAYRWNCGRDKRLKEIWGEKVTH

    >gi|119944801|ref|YP_942481.1| glutathione S-transferase domain-containing protein [Psychromonas ingrahamii 37]
    MTNTLYSFRRCPYAIRARLALAVSSQSVFLREIILKNKPAEMLALSSKGTVPVLQLSDGTVVDESLDIMVWALARRDPNN
    WLQGSFTEMLSLIDENDFEFKGWLDKYKYADRFPEHSTLYYREHAEDFLMQLENRLSYTPYLFGQKISLADMAILPFIRQ
    FSGVDKDWFEQSAYPFLKVWLANFINSQLFTSVMKKYPIWLESEQQSIFPEIQ

    >gi|119944831|ref|YP_942511.1| arsenate reductase [Psychromonas ingrahamii 37]
    MTGIIIYHNPICSKSRTTLALLKEHSDNDNIKVIKYLETPPTVEQLQDIINRLDFDSARQLMRCNEDLYKTLKLKDQNNE
    QLLLQAMVENPKLIERPIVLANGKAIIGRPPESVLTIL

    >gi|119945070|ref|YP_942750.1| iron-sulfur cluster assembly protein IscA [Psychromonas ingrahamii 37]
    MTEPAAKHVAAFLSNRGKGIGLRLGVKTSGCSGMSYVIEFVDVLNDDDQVFIDKGVKVVVDKKSLLYIDGTELDFVKEGL
    NEGFEFNNPNIDGECGCGESFNV

    >gi|119945084|ref|YP_942764.1| copper-translocating P-type ATPase [Psychromonas ingrahamii 37]
    MTNSSLLKLPVYGMNCAGCASRLQSALNEIKGIEAEVNFALEAAHINFDPEIDHKNTLNTIMALLEQKGYQTDTETILLT
    AEGWS
    CANCANTTSKMLNAQTLVINAQANFATEKVQVQTIRGALKKADIDTFSSLIPYTLHISSKKNLKAENALKVAKQN
    TADKKALLILSFSILLSLPFLLNMVTMFVNNHISLLPGWLEFMLATPVQFIIGARFYKGAWLSLKNYSTNMDVLVVLGTS
    SAYFYSLVVFLGGLNQPLYFESSAMVITLVTLGKYLEHRAKQNTTTAINALAALRPDTAKVKKGKVFIDVNIDEVQLGDL
    IQVAIGEKVAVDGLVIEGQSYLDESLLTGESKPVLKQNNDPVIAGSINGDGVLLIKTTAVGESTSLSKIISLVENAQMSK
    APIMKLVDKISAIFVPVVLLIATITFLTWYLLVGDFQQALISAVAVLVIACPCALGLATPTAVVVGTGVAAQKGILIKDI
    DTLQKAYKLQTIIFDKTGTLTQGKGEISTVYSVNQDNSTLLSLLSALQTGSKHPIANAIKNYCEKNAISPLDASEVQAIS
    GQGIQGIVSGKLLVAGNISLMNDFSVKLPEGLVDKQKAATGSIVYVASDNVFLGYISIEDALRPESAEAIQQLQGRGLET
    IMLSGDKQSVVEHISRQLQMNSSFSELKPEQKLEKLTFLQNSKQVAMVGDGVNDAPALAQADVSIAMGTGSDVAKESASI
    TLMRNDPRLVALAIDISKATWRKIQQNLFWAFIFNTVAIPAAALGYLNPAIAGGAMALSSITVLSNSILLKRFKSH

    >gi|119945117|ref|YP_942797.1| thioredoxin family protein [Psychromonas ingrahamii 37]
    MVNKGMEKDKPKTKVVRWMKEILTFTLIVTVLSLAIDAWRSREMPSTNMPSLSMSTLEGDWVDIKKMSQDKPILLYFWAT
    W
    CSVCNFVSPSVNWLSESHQVISVALSSGDDRRLGQFMAYKEYDFPVINDPKGNIGQTWNITVIPSIFIVKNGEISSITT
    GFTTPMGMWLRLYFS

    >gi|119945118|ref|YP_942798.1| thiol:disulfide interchange protein DsbA [Psychromonas ingrahamii 37]
    MKSLLLSTSIAASLLFSSVVFAEKISVAQQKKLSEITSLLEQNPEVIEGLYINLIKYVEGQGTISNTLKQHHDYLYNNPM
    HSYFGSEAPELTIINFTDYN
    CPYCKRLESGLVEMINKYPEIRVVNINLPFQQPMIPDLDTNTAWYALNVWENNRPAFSEV
    HRLMMAKPSKHDSESIMKIAEMTGTEAALAPNERKKKMVEKNERIFSQLGLRGTPALIIGNEISPGAIPQAQLDKLIKSQ
    LK

    >gi|119945120|ref|YP_942800.1| copper-translocating P-type ATPase [Psychromonas ingrahamii 37]
    MSLSTSLKLPIEGMTCTGCASRLQAALNEIEGINAEVSFAAKSAEFTIDDSVDYDGTLKSIVILIEQKGYKTASSPEDDA
    LNNSQSVAPSPTNKAPYDAQTKTQELLLEGVT
    CASCVGKIEKALNALPDVQQAQINFALRTASITGDVETETLIKTIEAA
    GYNAKSTDNASDETLLDEKEKADQKYYRQLILQVWIGLGLGIPLMAYGLLGGPMTVNSPIERGVWLVIGLICAAVMYFAG
    KHFYVGAWKSFVNHNANMDTLIALGTGTAWLYSMIVVIYPLALPEMARHVYFEATAMIIGLINLGLALEVKARGRTSEAI
    QRLIGLQPKTARVIRDGKDIDITIEQVLLNDLVRVRPGECIPVDGIVNEGKTTIDESMLTGEPMPVKKSQGDEIVAGSIN
    KSGSIIFKATRVGKDTALAQIIKMVKRAQNSKPPIGRLADIISSYFVPVIMIISITSALVWLNFGPEPSIAFAVVSATTI
    LIIACPCALGLATPMSVMVGVGKAAEAGILIRNGEALQNASKITTMILDKTGTITLGQPKVTDIYRVNSMDENQILQLVA
    SLEIGSEHPLAEAIVESANERGLQTDKVEHFNAIAGQGVEGIVGDKRLFFGNQKLMLEQGISVNKEAQDVSLKMAGEAKT
    PMFFAIDGDLAAVIAVADPIKEDSISAIKRLQKNGIRVVMLTGDNQATAKAVAQKVGITDFFAEVLPDEKSQKVAELQAQ
    GEIVGMTGDGINDAPALALANVGFAIGTGTDVAIESADITLMRGSLHGLADAISVSKATLRNIKQNLVGAFIYNAAGVPL
    AAGILFPFFGLLLNPVIAGAAMAFSSLTVVSNANRLRFFKPQDH

    >gi|119945150|ref|YP_942830.1| methylated-DNA--protein-cysteine methyltransferase [Psychromonas ingrahamii 37]
    MNHYCYYNSPTGTLTLQANAQGLLGVWFETQHTQPENLGLLNKQQPILIQARVQLEEYFRGEREYFTLPVAATGTVFQQQ
    VWSALATIPFGKTWCYQELANAIGNPNAVRAVGLANSKNPISIIIP
    CHRVIGKNGKLTGYAGGVERKQALLEHEGVILS

    >gi|119945183|ref|YP_942863.1| peptide methionine sulfoxide reductase [Psychromonas ingrahamii 37]
    MAISTATFAGGCFWCMEAAFNALKGVKSAVSGYTGGKTDSPTYADICTGTSGHAEVVQITFDDSVISYAELLTIFFSLHD
    ATQLNRQGHDIGTQYRSAIFYHDLAQKQSALEFINTLEQQAVLTDSIKTTIEKLETFYPAEDYHQGYFLKNPGQGYCSMV
    IQPKFNKFKATYQAALKEERGS

    >gi|119945288|ref|YP_942968.1| hypothetical protein Ping_1567 [Psychromonas ingrahamii 37]
    MKFTNTYAQLGDAFFKRVLPLPVAQPKLLIWNDKLAESLGLGAALLSDSDLKAHIFSGNQLPEGAESIALAYSGHQFGQL
    NPQLGDGRAHLLGELMDSSNHRVDIQLKGSGPTPFSRQGDGRCALGPALREFIMSEAMYYLGVPTSRCLSVVATGETVYR
    ERGRPGAVVTRVAASHIRVGTFQYFAIRKDTESLRALLAYTVERHFPEISSDGEDLELDFLDAVMEKQITLIVEWMRVGF
    IHGVMNTDNSAISGETIDFGPCAMMGAYDPGTVYSSIDTQGRYAFGNQPNIALWNITRLAECLLPLINSEQDAAIASLEP
    LLKTFTDRFQNSYFKMLGSKLGMTDFALSDQDFILELMEVMQAKKLDYTQTFSMLTQSLDDDVAAEKSQKNLGDWYIAWR
    GRLEQSADTIECSRLLMKEKNPLVIPRNHHVEAVLKACEDSGTAVAADDFLSVLRSPYFEIPTTVNYQDFPVDGDKGYHT
    F
    CGT

    >gi|119945372|ref|YP_943052.1| disulphide bond formation protein DsbB [Psychromonas ingrahamii 37]
    MLLFFVILGIFVLTILKAISKQRWSWLLLAASALSLELSALYFQHVMQLEPCVMCVYERLAMLGILLAGLIGASSPNNVF
    IRLSAFLLWGISAVWGILLAIKHTDYQLHPSPFFT
    CDFFPNFPAWAPLHEWLPWLFNPTGDCSDIVWQFLGYSMPQWLIV
    SFSLYTLLFIIFAISAVLKTKKQLF

    >gi|119945445|ref|YP_943125.1| glutathione S-transferase domain-containing protein [Psychromonas ingrahamii 37]
    MQYPILYSLHRCPYAMRARTAIILAQQTVLLRDIVMTNKPVEMLSASVKATVPVLIFDDQSVIDESLDIMTWALGKNDPD
    NLLYSDQPEALSEMLYLISRNDNEFVNNLKKYKVTARYHDIDEKFYRQKCELFIAELEQRLTEHAYIMGEKPSLADIAIL
    PFIRQFSRTNRQWYLQAPYPNLRRWLKTHIQSSLFSKIMTKYPQWLDHPEDMLFPAK

    >gi|119945525|ref|YP_943205.1| thiol-disulfide isomerase and thioredoxins [Psychromonas ingrahamii 37]
    MKKFKVLGSGCTKCINTAKLIEKIAKDNEIEVFVEKVTDLETIMNYGVMSTPGVVMDEKVVHSGGVPTTESIKKWFDL

    >gi|119945555|ref|YP_943235.1| thioredoxin domain-containing protein [Psychromonas ingrahamii 37]
    MHTNNHDITVSTFPSIIIEGSKVNPVLVVFWSPQSEPCNTLLPLLDKLHAEDEQAFTLARINCDQEQQIVNHFGVQSVPS
    VFMFIDGQGVDGFAGEQSEEFIRTFINKHTPDQSQVLLQAGQTLFAQGKLVEAKEKIIEATRMAPDNNDIKLALAQIYLA
    MDQHEDARPILKIIPMAHQNMIYHSLISQLELAQQSAQTPEITALEKQLETAQDKMAIEYQLAIQYNHANRNGEALALLY
    KLLVNNLDYDNGSPKKAMIDILATIDDAALVSEYRRKLYSLLH

    >gi|119945733|ref|YP_943413.1| hypothetical protein Ping_2062 [Psychromonas ingrahamii 37]
    MPFNHLKFDNRLRNNLPADSETDNYCRSVENAAYSLVSPVKATAPKLVAVSNLLAEQLGFTTEALNSPEFPQAMTGNLLL
    DGMQPYALCYGGHQFGQWAGQLGDGRAINLGELVTTNLGHQTLQLKGAGPTPYSRRADGMAVLRSSIREFLCSEAMFHLG
    ISTTRALSLCLTGDQVVRDMMYDGNAALEPTAIVCRVSSSFLRFGSFQLPASRGDEQLLIQLVQHCIKSDYPHLAPASGV
    FDQQVYLAWFKEICERTCDTVVNWMRVGFVHGVMNTDNMSIMGETIDYGPYGWIDDFDLNWTPNTTDEGQKRYRFGGQGE
    ISQWNLFQLANAIFPLIGEAEPLQKILNEYGTDYQRKWCDMMAEKLGFKHYRGETDLALFKSLEKLLGAVETDMTLFYRL
    LANIPNDLDTQTATQWMAKLGPCYYSLLDLNDQYIKDLTKWLASYLERVNLDGLSQELRATAMNKVNPKYVIRNYLAQHA
    IELAEKGDFSEIATLQKILQNPYDDQPEHNSYAQKRPDWARDKAG
    CSMLSCSS

    >gi|119945735|ref|YP_943415.1| glutaredoxin [Psychromonas ingrahamii 37]
    MTFMKRVVLYSMSHCPHCDAAKKYLSQQNIQFRLVNVKTAAGQKEFSKSGYRGVPILKVGDQFINGFSIKEFNKLYQL

    >gi|119945869|ref|YP_943549.1| thioredoxin reductase [Psychromonas ingrahamii 37]
    MSETKHQKLLILGSGPAGYTAAVYAARANLNPVLITGMEQGGQLTTTTDVENWPGGSADMTGPGLMDSMKDHAERFDTKI
    IFDHINEVELTKSPFTLKGDSDTYSCDALIIATGASATYLGLDSEDAFKGRGVSA
    CATCDGFFYKNQKVAVVGGGNTAVE
    EALYLSNIASEVHLIHRRTGFRSEKILLDRLNAKIANGNIILHTDRTLDEVLGDEMGVTGLRLKDTLSDKTENLEVMGVF
    IAIGHKPNTGMFAGQLEMNHGYLKVQSGNDGNATQTSIKGVFAAGDVCDHIYRQAITSSGTGCMAALDAERYLDNL

    >gi|119945953|ref|YP_943633.1| thioredoxin family protein [Psychromonas ingrahamii 37]
    MQYSLPYWGELLKIRNKQRETMSRFVQFVTVLMILLTSSITVARQPEWLSELNLSEYQNKVVYLDFWASWCGPCRQSFPW
    LNAMHSKYRDKGLVIIAVNLDKDSNKADQFIKAFPADFLLYSDPKGISAQKYKITAMPSSYLFSGKGELAEKHLGFEKSE
    VARYEKNIVKLLDQLAGDNGNRP

    >gi|119945974|ref|YP_943654.1| OsmC family protein [Psychromonas ingrahamii 37]
    MTTLYTTSATANAGRNGQVTTDDKKLDLALSYPKEMGGTGDATNPEQLFAAGYSACFSNALLHVAHETKIAIKSAPTTAT
    VGIGPNENNGFALTVALSIELELEQTAAIELVQKAHQI
    CPYSNAVRGNIDVKLIVNGVTL

    >gi|119946092|ref|YP_943772.1| arsenate reductase [Psychromonas ingrahamii 37]
    MNTTLYGIPNCDSVKKARKWLEQNNLPYTFHDYRKDGLDKTLLDSFLENIEWTDLINKRSTSFRQLTAEQKENLSAETVI
    ALFIAFPTLIKRPLLRHNNHYQLGFNIDTYQTLFSL

    >gi|119946099|ref|YP_943779.1| glutaredoxin-like protein [Psychromonas ingrahamii 37]
    METLDKIKSQISENTVLLYMKGSPKLPSCGFSSQASQALMQCGHPFAYVDILQNPDIRAELPKYANWPTFPQLWIAGELV
    GGCDIIMEMSQQGELKPIVEQAVAATATAESE

    >gi|119946270|ref|YP_943950.1| thioredoxin 2 [Psychromonas ingrahamii 37]
    MNSIVSRCPFCQAMNRLPIEKIEVSPTCGSCKQPLLEGKPIEGSSNNLAELINSEKPVVIDFWAPWCSPCINFAPVFEQV
    AMEEKDKLRFVKVDTEAQQEIAAQYKIRSIPTLMMFRKGRLIDSLNGALPKSQFKEWVAETLNK

    >gi|119946349|ref|YP_944029.1| thiol:disulfide interchange protein DsbA [Psychromonas ingrahamii 37]
    MPELPTVRIDIVSDIMCPWCIIGYKKLEHAMSKMREAAEFEIIWQPFELNPDMPFEGEHLGEHLRDKYGSTKEQSIKSRQ
    QIIETGKALGFEFRFNDNSRIFNSFLAHQLLHWAKSYNKQTALKLALFDLYFTQQQNPSELLLLLDVAEKVGLDRNAAKE
    ILETQRYAQAVRDDQFFWAENDVRAVPAFIFNKQYLLSGAQEPQTLQDVIETIIKEQTQ

    >gi|119946393|ref|YP_944073.1| mercuric reductase, membrane-associated [Psychromonas ingrahamii 37]
    MDRKKIIIAILACIALWFVFEFNHLLTLENAKIYQAQLNGYINDNFLLASVLYFILYTVSTALSVPGAIIFTLLGAALFG
    FWWSLLFVSFASSIGATLAFLFSRYMLQDWVQRRFGGKLKAINRGIEKDGSLYLLTLRLIPIFPFFMINLLMGLTTLSAK
    KYYLFSQLGMLPATAVFLNAGTQLADINSLAGLLSPSVLLSLAALGLMPLISKFIINSIKQNKVYRGWQKPKSFDQNMVV
    IGAGSGGLVTAYIAAAVKAKVTLIEKHKMGGD
    CLNTGCVPSKALIRTAHNIKEILNAQQFGVDAQINSIDFKKVMTRVQN
    VIKKIEPHDSSERYSDLGVTCLQGEAKIISPWQVELNGNVITTQNIVIATGAKPFIPPIPGLDKVSYVTSDTIWSLPELP
    KKLLVLGGGPIGCELAQCFNLLGSEVTIVERLPQLLIREDQDAADLVSKQLMKEGVEILVNHNVTGFSRDENTQSVALEF
    QQQTVLKEFDVVLVAIGRKANVGGFGLEELGIELTETKTIAVNDYLQTKYANIYAVGDVAGPFQLTHAAAHQAWYAAVNG
    LFGRFKKFKTDYSVMPAAVYTYPEVARVGLNEKEAKQADINYEITQYELNDLDRAITDDHDQGFVKVLTATGSDKILGAT
    IVGSHAGDLLTEFTLAMRYKLGLNKILGTIHPYPTMSEANKATAGMWKKDHAPQTLLLWVEKYFNWTRKKDLS

    >gi|119946405|ref|YP_944085.1| dihydrolipoamide dehydrogenase E3 component of 3 enzyme complexes [Psychromonas ingrahamii 37]
    MSSADIEYDVIIIGGGPGGYVSAIKAAQNNLKVALVEKDKMGGICLNWGCIPTKALLKSGEFINKLHKANDFGVVVDKFS
    FDLKSIVNRSRDISKNLNKGVDALMKKNGITVFNDTAKIISNHKVALSNQTLNTKNIVIATGSKSKIIPGLEPDGNVVWN
    YRNAMTPKKVPENLLIIGAGAIGVEFACFYNSLGSNVTIVENQENILSTEDDDVSALAKKHFIKLGISILNSTKVNFIEK
    SKDSITFELTSENFKETKVFDNVIMAIGVSGSFDNIGLETLGIKTNHGFIETNEFMQTNVPNIYAIGDVAGAPCLAHKAS
    HEGIICIEKILNKNNIKTLNNNSIPSCIYSYPQIASLGLTEKAVIASGETYTVGRFPFNANGKAIASGETDGFIKTLFSA
    NTGELLGVHMIGAEVTEMIQGYAIGKELETTQVELEHVIFPHPTMSEAMHEAVLDASDKAIHI

    >gi|119946480|ref|YP_944160.1| antioxidant, AhpC/Tsa family protein [Psychromonas ingrahamii 37]
    MIEQGQKLAPAVLSELTPDGMINHPITELFAGKKVLLFAVPGAFTPTCSESHLPGYVVLADKFKAKGVDLIACVAVNDAF
    VMKAWGEAHNASELMMLGDGDASFTKSLGLEMDTANFGGVRSQRYAMIIDDGVVTQLNVEAPKEFEVSKAEVMLEAL

    >gi|119946546|ref|YP_944226.1| dihydrolipoamide dehydrogenase [Psychromonas ingrahamii 37]
    MSKEIKAQVVILGSGPAGYSAAFRAADLGLETVIIEKYSTLGGVCLNVGCIPSKALLHVSKVIEEAKALSEHGVLFGEPS
    TDIDKIRIWKDKVVTQLTGGLQGMAKMRKVTVVNGFGKFTGANTIEVQGDDENTTITFDNAIIAAGSRPIKLPFVPHDDP
    RVWDSTDALELRSVPKRLLVLGGGIIGLEMGTVYKSLGSEVDVVEFADQLVPAADIDIVQVYTKKVKSKFNIMLSTKVTG
    VEAKEDALYVSFEGKNAPSEAKPYDAVLVAVGRVPNGLSLDAEKAGITVTERGFIEVDKQLRTNVPHIHAIGDVVGQPML
    AHKGTHEGHVAAEVIAGKKHYFDPKTIPSVAYTEPEMGWVGLTEKEAKEQGINYEKSVFPWAASGRAIASDCTAGMTKLI
    FDKDTHRVIGGAVVGTNGGELLGEIGLAIEMGCDAEDMALTIHAHPTLNESVGLAAEIYEGSITDLPNAKAVKK

    >gi|119946639|ref|YP_944319.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Psychromonas ingrahamii 37]
    MANSKKILTLSVPLAIFLIACYFLFQGLYTDPRKLESTLIGQTVPEFTLQDLYDPDKQHDASIFKGQKLLLNVWATWCPT
    CYAEHQFLTKLAGEGLYIIGMDYKDNRIKAIKWLTDLKDPYAISLFDKDGMLGLDLGVYGAPETFFIDSKGIIQYRHVGD
    LNDRNWQDKLSAIFDNME

    >gi|119946746|ref|YP_944426.1| methionine sulfoxide reductase A [Psychromonas ingrahamii 37]
    METIYFSGGCLWGVQEFMKYLPGVERTQVGRVNGATHSTKTAYDGYGECVKMEFNPAIVSLETLIDYLFEIIDPYSINKQ
    GNDVGEKYRTGIYSKETNHLLKAKCHIERLENALNDKNKTRKKVVVEVLPLTNYIPSDNEHQDRLTLFPDDYCHIPLRLL
    HKYKKKT

    >gi|119946763|ref|YP_944443.1| thiol:disulfide interchange protein DsbA [Psychromonas ingrahamii 37]
    MKKNFALIITLLLSFAAHAAQFTEGQQYQVLDTQPSSQPVVTEYFSFYCPHCNNFEPFIRQVKERLPDNAKLQKTHVSFM
    GGSMGVSMAKAYATMVVLEVEEKMIPVMFRQIHDLKQTPRNDKELRQLFIDNGVEASKFDAAFNGFVVDSMQRRFDKEFK
    NAGLRGVPAVIVNNKYHITPDESINSQDKYMELVNFLLKK

    >gi|119946797|ref|YP_944477.1| thioredoxin [Psychromonas ingrahamii 37]
    MSENIVTLSDASFEDDVVNAEGPVLVDFWAEWCGPCKMIAPILQEVAAEYAGKVTIGKLNIDENSATPPKFGIRGIPTLL
    LFKDGKVAATKVGALSKTQLVEFLDANI

    >gi|119946815|ref|YP_944495.1| glutaredoxin 3 [Psychromonas ingrahamii 37]
    MATIVIYTTSWCPFCTRAKKLLDHKNVTYTEVDVSSSDARAKMVALTGGSTVPQLLINDKPEGGCDELYALERSGKLDKL
    LSQ

    >gi|119946816|ref|YP_944496.1| rhodanese domain-containing protein [Psychromonas ingrahamii 37]
    MQQYIDFFFNQPVLSIAWIAIAVMLVQSLVKHKISGVKSITAQDAIMMINKQNAIIVDVRSVEEYKKGHILNAKNIPVSQ
    IDKGSFAEIEKHKEAPIILV
    CASGDRSSGAAGKLTKAGFTQVTNLLSGMNGWSGASLPTTKK

    >gi|119946874|ref|YP_944554.1| hydroxymethylbutenyl pyrophosphate reductase [Psychromonas ingrahamii 37]
    MEIILANPRGFCAGVHRAISIVDRALDIFTPPIYVRHEVVHNQYVVDDLRARGAVFVEELDEVPENSIVIFSAHGVAQSV
    RAEAKRRDLKIFDAT
    CPLVTKVHMEVTRASRRGQECILIGHQGHPEVVGTMGQYDNPQGGIYLIESPEDIKKLEVKNPNS
    LCFSSQTTLSVDDTANIIKALREKFPKIDGPRKDDICYATQNRQDAVKALAERSDLVLVVGSTNSSNSNRLQEKASCVGV
    NAYLIDSEKDIKTEWLENVKVVGVTAGASAPEVLVKEVIARLKKLGGTVVTENLGVEENIIFEVPAELRIKQID

    >gi|119946909|ref|YP_944589.1| thiol:disulfide interchange protein DsbC [Psychromonas ingrahamii 37]
    MATIFSKTGVICVFLLSSFAAVSATSESPSSLVVEEITTKMESLKIPVNEINKSAVEGLYEVISNGDIYYISEDATHLLY
    GSIYALDNQMVNITEQKKAQLSRQKVAKNIDKITAFEKDMIVFKAQDEKHVVTVFTDPT
    CSYCQKLHSQMADYNKLGITI
    RYLAFPRAGIDSSTYHTMVSIWCSNDPKNAMNMAKKRREIPSETCENTVKEQYQLGRLLGVNGTPALILENGTLTPGYLP
    PQRLLQLLEEK

    >gi|119947010|ref|YP_944690.1| rhodanese domain-containing protein [Psychromonas ingrahamii 37]
    MSNTVVCALYRFVSLENYQEIQAPLLKMMQANNIKGTLLLAQEGINGTVAGSREDINTLIAWLKSDPRLNKLTTKESFTE
    ENPFYRTKVKLKKEIVTMGVEGIDPKRTAGSYVKPKDWNALISDPDVLLVDTRNDYEISIGTFKNAVDPKTTNFREFPQY
    VKDNLDPAVNKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLEGGVLKYLEEVPQEESMWQGECFVFDNRVSVNHKLEKGQ
    YDQCHGCRLPITEDDKKSDKYQEGVCCHQCHEQLTVEQKQRFAQREKQVGLAKQRGQTHIGNDAVAQLENNRLKKQAVKQ
    AQRVEAKK

    >gi|119947046|ref|YP_944726.1| intracellular sulfur oxidation protein of DsrE family protein [Psychromonas ingrahamii 37]
    MEQQKIKFSIVVSGAPYGTESGSSAYQFCAAAISAGHQIAGVFFYQEGVLNASQLVSPASDEINLPTLWAALAGEYQFPL
    EV
    CVSAALRRGIINQQEAVQLGLTQFNLQAPFVLSGLGQLAELSANCDRLVQF

    >gi|119947073|ref|YP_944753.1| dihydrolipoamide dehydrogenase [Psychromonas ingrahamii 37]
    MKKLKVEVAVIGGGTAGLAAYRSAKEKTDSVILIEGAQFGTTCARVGCMPSKLLIAAAEAAHSASHTEPFGVFIDGKIRV
    DGKKVMQRIRDERDRFVSFVVEAVDSLPAPDKVIGNAKFISTTELQIGDHTIVTADRMVIATGSRPSYPGVWNELGDKLI
    INDDLFNWTDLPKSIAVFGPGVIGLELGQSLHRLGVEVLMFGMGGQVGPFTDPQVMAYAQKTFSDEFYLDADANVKNMVR
    KGENVEITYLDKQGIEQVTEVEYVLAATGRRANVDNLGLENIEIEKDGRGVPIADRFTMQTSVPSIFIAGDASNQLPLLH
    EAADQGKIAGSNAAVYPNIRVGLRRSSIAAVFTEPQLAMVGLTHQQVTEKYTGCDCFETGSVSFESQGRSRVILKNQGLL
    NIYGAHGTGRFLGAEMIGPQAEHLAHLLAWAHQNRMTISQMLDMPFYHPVIEEGVRTALRDLNAKLRLGSEMLNECMECG
    PGC

    >gi|119947074|ref|YP_944754.1| glutaredoxin family protein [Psychromonas ingrahamii 37]
    MLDNIEGQKIPNVTFPTRQGDQWVNVSTDELFAGKTVVVFALPGAFTPTCSSMHLPRYNELAGVFKENGVDEIICSSVND
    TFVMNSWIADQEAENITVVPDGNGTFAEGMGMLVDKSDLGFGKRSWRYSMLVKDGVIEKMFIEPNQPGDPFEVSDADTML
    NYINPKAKAPAAVTLFTKPG
    CPFCATAKAALKDNNIAFEEIVLGKDATSVSLRAVSGESTFPQLFVDGKHIGDSEAVIAY
    VKG

    >gi|119947209|ref|YP_944889.1| cytochrome c biogenesis protein, transmembrane region [Psychromonas ingrahamii 37]
    MCSRIRFLFQAIACIFIIWSSTIKKIQFIVRPVLSALLLISCLFSTLALADVKQTSTGWVTDPNHPPVSVLAELTGQIDK
    DKDKQSVNALLQVRLAGEWKTYWRSPGEGGVAPSFDFSNSTNIKEVNWLWPAPKRYPVSGVETIGYKGQVNFPLTIVLQD
    MGQPARLKGILTLASCTNICVLGDYEIDLTFAPNTLVSLPEVVFKFGLALGTIPILITEQQLLQQQDNATISQVRSSWNP
    LKQQLVVQMNNRFGWSKPDLFIDSDSPDLAYVTFSVPEVNISNKTMTATIKASSWSGEVDLANKVLHATVLDTNLAVELV
    TTTSDQIISSKTADGLLPIFLIALLGGLILNILPCVLPVLGMKLSSILSAHGIQRGQIRRQFLASSLGILTSFWLLAVFL
    LLLKLSGQALGWGIQFQSPYFIAVMVIITALFAANMLGLFEIQLPVAMQTWLAGKGSQSYLGHYLQGMFATLLATPCSAP
    FLGTAVAFALGGSIVELFVIFTALGLGMSLPWLLIALFPAIALLLPKPGRWMGTVKLVFALMILATTFWLLSLLGNFIGT
    SNMFLTAALLLVVLFTLTLRKYGKRILLIALISLLLSSALGFLLGSLTTEHWASPIAGELDWSPLDAAAIQQQVASGKTV
    FVDVTADW
    CITCKANKIGVILQEPVYTALQAENIQLMQGDWTVRSDSVTAYLQSYGRYGVPFNIVYGPGAPEGLPLPTIL
    SSKQVLSALQQAQK

    >gi|119947222|ref|YP_944902.1| thiol:disulfide interchange protein DsbA [Psychromonas ingrahamii 37]
    MKKIFALLTALIIFPFSAQAFDFEEGTHYEVVKQTATATPEVKEFFSFYCPHCFKFEPLMTNLKQKLPEQVKIKKVHVNF
    IGKEMGAELTQAYAAAEILKVEDKLSSLIFDQIHTQDKAINGRAGVLELFEKAGVDKQEAQNALASFPVSGLASQMKRDT
    ETFNIRGVPTLIVNGKYKVNTGSIRSNEEFVALVTFLTQKKN

    >gi|119947230|ref|YP_944910.1| glutaredoxin [Psychromonas ingrahamii 37]
    MFIIRWILGRIILLLNFIFTPKKLKRETQEQVKVDAQTQNMQLYQYQACPFCVKVRREIRRQGLNINTVDAKQAEHKEVL
    ENQGGKIKVPCLRIEENNKVVWLYESSAIIEHLNTRFA

    >gi|119947231|ref|YP_944911.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Psychromonas ingrahamii 37]
    MLRQRMSKKVLIVGGVAGGASAAARARRLDENAQIIVFERGPYISFANCGLPYHIGGEIELRSALLLQTPESFKKRFNVD
    IRIKSEVLSIDKKAKTVTVHNIAADTEYTESYDALILSPGAGPLIPPIAGVRNHLTYALRNVPDMDAIIASIEINKPKHA
    TVCGGGFIGLEMAEALRHRKIKVTIVELGPQVMASVDIEIANVLHDELEQHDVELKLGKALQGIAPSAPADKSLILTLND
    GSVVETNLLIMAVGVKPETSLAVQAGLEIGELGGIKVNAFMQSSDPAIYAVGDAIEDPDFVTGDAIFVPLAGPANRQGRL
    AANNIFGAKETYKKTQGTAICKVFELAIASTGLNEKTLLRKAISYEKVYVHASSHAGYYPGAHPVTLKLLFDPATGLILG
    AQAVGKEGVDKRIDVISVAQRAGLTVYDLQDLELCYAPPFGSARDVVNQAGLVASNVMKGDEVIFHSEDLESLSDKQILV
    DVRSELEVDNTGMIHGAINIPVDDIRANLCKLDQNKEILIY
    CQVGVRGHVASRLLTNLGYKVKNLSGGFKTWKLATR

    >gi|119947234|ref|YP_944914.1| hypothetical protein Ping_3632 [Psychromonas ingrahamii 37]
    MENFTPWSALAGGALIGLSAALLMLFSGKIAGISTIIGGLLNPQKHESSWRAAFLTGMIASFLIVAPFGFELPNTTGESI
    VVVSLAGLLVGFGTRLGNG
    CTSGHGIIGLGRFSKRSIFATIAFMASAFMVVFVRNQFGAL

    >gi|119947300|ref|YP_944980.1| thioredoxin domain-containing protein [Psychromonas ingrahamii 37]
    MKSTQMGFNPDYAEDAPTLEQISALVGDAILEFGVPWCGHCQAAQPAVQEVLSEYSQLPHIKVVDGKGKPLGRAFRVKRW
    PTFILLHKGMEVARLVRPLGTDEIRELLAQCK