Psychrobacter cryohalolentis K5 uid58373

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|93004858|ref|YP_579295.1| DsrE-like protein [Psychrobacter cryohalolentis K5]
    MVNNTDYVGTLFDNSESNPSKITLAFTMAGVALKKGHSASVILMVDAVHLALPNALDNVDIGDPFEPAGELLEAFIEKGG
    QVLV
    CGACMKHGGVEESAIDKRFTVISGDDVVELLMNAKGSLQLN

    >gi|93004863|ref|YP_579300.1| hypothetical protein Pcryo_0032 [Psychrobacter cryohalolentis K5]
    MLLATTACAQPNTADMTNKTVSQKVNHSAQAGQNTKAIGTVSKSVDSRLRQLLTQAGIKTQITSIAPSKLPNMYQVNLAE
    QLPLHITEDGKYVIQGELQKNPSKRVVTKTPARSTSAQIGKPVSASIKSDILANMGALKNMSNKTPFFYTAVPGVIWGAT
    LEGVPFLLSDDAQYITDGEISVIENGQFTGLDNRFEKLKNQSVLTTLDTKQLITYPATSAEKAVIYVATDVN
    CPYCRRLH
    KQMPMLNAKGVTIKTIGYPIYEASPEQMRGIWCQGNEESRRKALDQAMLHGKMTPAPASCKTDDVAGNREKAAGLAVMAT
    PAIYREDGVLFQASFESPEFLEFLGVK

    >gi|93004873|ref|YP_579310.1| disulphide bond formation protein DsbB [Psychrobacter cryohalolentis K5]
    MLQLTTYRNLQVFLVIMTAIGMSFALFFLQRYMGFSPCPLCIFQRIGLMIMGGFALIAALFHPKSMVIRLLLWLGSLAGI
    GWAAIVAGRHVWLQHLPADQVPS
    CGPGLDYWLDTLPMQQVLKEVFAGSGECASIDWTFLGLSIPEQSLILFSILILTHLL
    ILWRIVRPATPKPLAR

    >gi|93004875|ref|YP_579312.1| iron-sulfur cluster insertion protein ErpA [Psychrobacter cryohalolentis K5]
    MNQPANQFNPSSSQPVDPTVLNLTDSAAQKVRRLREEEGDSNLMLRVYVTGGGCSGFSYGFNFANELNEDDANFDNNDVT
    LVVDSLSYQYLQGSTVDYTEGLEGARFIVTNPNATTTCGCGSSFSI

    >gi|93004944|ref|YP_579381.1| dihydrolipoamide dehydrogenase [Psychrobacter cryohalolentis K5]
    MKDSYDLVVIGGGPGGYEAAIRAGQLGMSVACIEKRVYKGEPALGGTCLNVGCIPSKALLDSSHRYEATKHDLNEHGITT
    GDVAIDIEQMIARKEGIVKQLTGGVAALLKGNGVDWLQGWGTLEDGKGTDKKVKFTALADEAETTITAKNVILAAGSVPI
    DIPVARTDGDRIVDSTGALDFTAVPKRLGVIGAGVIGLELGSVWRRLGAEVVVYEALPSFLAAADKDIAKEAGKMLKKQG
    LDIRVDTKVTNAEVQGDQVIVTSETKGESSEESFDKLIVCVGRRAYSEKLLGEDSGIQLTERGLIDVNDQCKTNLDGVYA
    IGDLVRGPMLAHKAMEEGMMAVERIHGEKAQVNYDTIINVIYTHPEIAWVGLTEQEAEVAGYEVKTGSFNLAANGRALAQ
    SEAQGSIKVVADAKTDRLLGMHAISAGAGDIVHQGMIAMEFVSSIEDLQLMTFAHPTISEAVHEAALSADGRAIHAIQRK
    KRK

    >gi|93004960|ref|YP_579397.1| DSBA oxidoreductase [Psychrobacter cryohalolentis K5]
    MKRIIALTGLACAIGFANMGAQAANYVAGKDYRVLDNPEKISGDAIIVREFFWYGCPHCNVLNPHMEKWAKNKDKDVAFF
    KTPAALNPVWEASARGFYAAQLLGFEDKTHDALFDAVHKDGKQLFDQSSLSKWYASKGVNEKKFNSLYNSFAVGTKIGRS
    QAGAKRYQLSGVPAVVVQGKYVVTGESATVPKVVDFLVDKVRAEKK

    >gi|93005022|ref|YP_579459.1| protein of unknown function DUF395, YeeE/YedE [Psychrobacter cryohalolentis K5]
    MGIQIDWQAFTPISLVGGLMLGVATVILLLGIGRIAGISGIFSSLLKPKRVEMWQVLFIAGLILSPLLYSLFRPLPDIEI
    STSIPLLIGAGLLVGFGTRLGSG
    CTSGHGICGNARLSPRSMAATVTFMLFGIVTVYIGRHLLGLI

    >gi|93005090|ref|YP_579527.1| cytochrome c biogenesis protein, transmembrane region [Psychrobacter cryohalolentis K5]
    MSIKTVKSISSFKAVSTRNQSSKNLPSVVNKVPKKSYLLALTIASSSLFVGLTATTMTTQAAGLGDLFSSNQSAGQSKFL
    SVDKAFQVTSNSKAVKAGTQLSINFDITPEHYVYKNQLKLTLPAGVTAAPFTFSQTPVLIDDPTFGKVPVFDQKNMVATT
    TLSTSGKSIDNAAVVIGWQGCAKAGLCYPPEKIKTNVDIVASAPQAVVNTISNVTGVAKSDVNQETTNANSVNNSNSVTI
    SEAPNATSIDSTEAMSPEAEQALAEEDEVIDYALLDDEALDGELGATNTISGADTPLADNAAPTNDTLATADNLADGDPF
    GLAKHPWLALGLLFLAGLGLALTPCVLPMLPIVANIVARQQNPTVKKGVILTTSYAIGVSIAYGILGAVIAVFGESLGII
    GWLQNPIILISFAVIFVLLALYMLEVFTIRLPHFISSKMQGLSQAGDSKLGSAGGSLAAGFLSALVVSPCVSAPLFGALL
    AVSTIGNPLLGFAALFMLGFGLSAPLILIGATQGKIMPKAGEWMNWVKQGFALLLFAVALLLIERVFISSVMLLVWALWF
    MVVATWAWSWRGKGRMLSQAIGLIAGIWAATLVIGAALGNDDSLHPLASLSATPMLVQSANGQAGAQNNATNNSDEHITT
    LAELDVITAANPKVLVDLTADW
    CIECRIMDKNLFTNRPAQMQDWELVRLDITETTADSKAILARYKLFGPPTLLYYQDGQ
    LVQKQVGEIGRAEFEQTLTALNK

    >gi|93005111|ref|YP_579548.1| putative thiol:disulfide interchange protein [Psychrobacter cryohalolentis K5]
    MFLAPFSKTNPNRDTFSRSPLTRVMSAALLVIVAAGCSNNAADATNNTDLVNSSKAKTSTAAVSKDSDAKVVKSLQANLK
    ASGIEETILSAVPTDMTGIYWVTAEGLPSFFTDKTGKHIIQGQIIAVGAEAPVDISAALLASTAQEALKAVDKKDMVIYP
    AKGATKAVVYAFTDAD
    CGYCRKLHEEMDDINTRGIEVRYLAWPRSQESVPKMEAIWCSQDRKAAMNQGKAGADVQAPSCA
    NPVQEQMALGAKLGVRGTPAIFTEAGQQVGGYLPAAQLAEAVGAN

    >gi|93005236|ref|YP_579673.1| putative thioredoxin protein [Psychrobacter cryohalolentis K5]
    MTTDIDKTTERSKKTPKQKALSLIKTVLLYGLVFAIIYTAVNWWRQPVMPADPQLQLMDYQGHSIDLAAMSADKPTLVYF
    WGTW
    CPICSVTSPNINALAAENNYPVVTVAIKSGSDQELHSYLKQNNYSFNTVNDKEGAIFDDWQGQVTPSYVILKNGEM
    SQGLTGIQPLWSLKLRLWLSSVF

    >gi|93005241|ref|YP_579678.1| hypothetical protein Pcryo_0411 [Psychrobacter cryohalolentis K5]
    MSTSQTDNVKASTHATEYDSVTNNIVVAALYKFTRFADFEKYRDPILNTMLDNDVKGTLLIASEGINGTISGTRQGIDNV
    LDYLRSIEEIGSFTFKESYTDAQPFYRTKVKLKKEIVTMGVENIDPLQSVGRYVKPSDWNALISDPDVILIDTRNDYEVK
    IGTFQNAVNPNTETFREFPEYVAKELDPSKHKKVAMF
    CTGGIRCEKSTAFMREQGFEEVYHLEGGILKYLEEVPASDSMW
    EGDCFVFDNRVSVNHNLEKGSYEQCFACRMPITQAEMQSPAYIKGESCPHCIDKATDEQKARFREREHQMQLAQKRGEAH
    IGSDVIDVIEKRKAAKIEARRQADAANKTKAG

    >gi|93005250|ref|YP_579687.1| OsmC-like protein [Psychrobacter cryohalolentis K5]
    METLYSTKASVTGGRAGKASVQDSDLTINMVAPGSGKDGNNPEQLFAMGYAACFDGALGAVKGAEKAKFDSTTEVSVDLK
    KGEGLDFKLAVKIHVIGENTELSADEFQQLVEKANKV
    CPYSKATHGNVDSEVTSEVK

    >gi|93005251|ref|YP_579688.1| beta-lactamase-like [Psychrobacter cryohalolentis K5]
    MLLEKIKTPGLAHLSYLVGSGGQAAVIDPRRDCAIYVEKARAQGLEITHIFETHRNEDLVSGAPILAEMTGASILHGPNP
    EQPIVYAQTVRDGDCFTIGQLEIRVLETPGHTDDHLAYALFDTAYPDKAVAVFTGDALFVGDVGRTDFYPDRAEEVAGLL
    YDSLQKILALGDQAIIHPAHGAGSVCGSGMAKREFSSVGHERLNNPRLQFTDRDAFIRFKVSENHYQPPYFRLMERLNME
    GGTAPPSVIRPRSFSLQQLKSCGADHLIDIREPMAYASGHLPGAMSLPVSMISAFAGWYIHEGESLALIASDEAQLATAM
    EHLVRIALDNVLGGYIGVVSAAAKGEKMQQTPMIDTSEVEARLKNDTEGWTLLDVRDADERDTVAIEGSQHIYVGHLNKC
    WRELDKRHHYTLM
    CASGARATIAAGWLASQGFENIDIYLGSMGAWQAAHK

    >gi|93005259|ref|YP_579696.1| thioredoxin reductase [Psychrobacter cryohalolentis K5]
    MATDNTAPRHEKLIILGSGPAGYSAAVYAARANLKPVMVTGMEVGGQLTTTTEVDNWPGDAHDLTGPALMERMKAHAERF
    GTELVYDHVNAVNLNVRPFELTGNNGNYTCDALIISTGASAQYLGLESETKFRGLGVSA
    CATCDGFFYKDQKVAVIGGGN
    TAVEEALYLSNIAAEVTLVHRRDSLRSEKILQDKLFEKAKNGNVKIEWNHSVKEVVGDDMGVNGVVIESMIDGSTKQLDV
    FGMFVAIGHKPNTDLFKGQLEMKDGYLIVNSGLNGNATQTSIEGVFAAGDVADHVYRQAITSAGTGCMAALDAEKYLDAI
    GETVAQDHTYASTLTADKEA

    >gi|93005397|ref|YP_579834.1| hypothetical protein Pcryo_0567 [Psychrobacter cryohalolentis K5]
    MTITIYGIKSCSTMKKAFTKLDELGVSYNFHDYKKQGIDKDSVQRWVNELGIDKVLNKRGTTWRKLEDVQKQAADSDVDQ
    AIDLLIENTSMIKRPIVEGELTDKNKPILLCGFDEAEFDKVFS

    >gi|93005497|ref|YP_579934.1| peroxidase [Psychrobacter cryohalolentis K5]
    MAHLRLGDTAPNFDATTTEGDINFHEWAGDNWVVFFSHPADFTPVCTTELGRAAALNGEFQKRGVKPICISVDGIDDHHA
    WAKDIGETQGTELNFPIIADPNKEVAELYDMMHPNADSTHTVRSVFIIDPSKKIRLTLTYPASCGRNFDEILRVIDALQL
    SDEYNIATPVDWKDGDDVIIPPSVKNEDIAAKYPKGHTEIKPYLRTTPAPNK

    >gi|93005523|ref|YP_579960.1| protein-methionine-S-oxide reductase [Psychrobacter cryohalolentis K5]
    MQDNQLSKEEISQLTEADWKERLSAEEYHVLREKGTERPFTGVYNDINDKGIYRCKGCGANLFESDNKFDAGCGWPSFDQ
    GIDNSAIDEHVDDSLGMRRTEVTCSNCGAHLGHVFPDGPSETTGMRY
    CINSLSIDLDKSEE

    >gi|93005524|ref|YP_579961.1| glutathione peroxidase [Psychrobacter cryohalolentis K5]
    MTTIYDFNAERIDGTTKSFSDYKDQVLLIVNTASKCGFTPQFEGLEALFQQYKDQGLMVIGFPCNQFGNQDPANNDEIGE
    FCQKNYGVSFPMMAKVDVNGGDAHPVFEWLKNQKGGLLTDGIKWNFTKFLIDSKGQVIARYAPTTKPEALKADIEQALAA
    K

    >gi|93005604|ref|YP_580041.1| dihydrolipoamide dehydrogenase [Psychrobacter cryohalolentis K5]
    MNKQPDTASDSSAPFDHNIHQNVTRKVSVAVIGAGTAGQNAFRQAKKFLEDVIIINDGFWTTTCIAVGCMPSKLLIAAAD
    RAHDTNHSAEFGVHATARIDGKQVMERVRAERDHFASYIEKQVDSWPEDSKIAGRAYINKQGLIEVNDELIKADKIIVAT
    GSSTFIPDGWEDKLGDTMLTSDAVFELADLPKSMAVIGAGAIGLELAQAFTRLGVKVTVFNRAKRVAGLQDEDINNKAID
    CLSRELTMHLGSKITDVGQRSDENSDKSINKNSTVAFIDYEDSAGEVQQWQGDYVLVATGRRNNIEALGVENLGVELDEK
    NRPQQLDKKTGKIGDLDVYIVGDANANIPLLHVASDEGFSAGSMVCDNKKDAYIRPPATPFSIVFSSPQIVNVGMSLPEI
    QEDPTLEHVIGKVSFDNQGRSRVMGVNCGLLHIYGCKKTDRILGASMVGPDAEYIGHILAMAITNDLSIKDMLDTPFYHP
    TILEGLRTALHDVQDLMEIPYQSLDIHQNNS

    >gi|93005605|ref|YP_580042.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Psychrobacter cryohalolentis K5]
    MMAKPTTETITLPDFPVTIVRELDGHFIHDDISLKELVANTSKGLILYFYPKDNTPGCTTQATEFTAHLNEFDDLGYDII
    GVSRDSVESHESFISKYNLHIPLISDADEKLCHYFDVIKEKNMYGNITLGLVRSAFVFDKNGTLTHAQRNLKAKDYTERL
    LTTLAP

    >gi|93005706|ref|YP_580143.1| glutathione S-transferase-like [Psychrobacter cryohalolentis K5]
    MMTRPSNNQPPRLNLLISIQLRTLPMTSSYHCLYSFRRCPYAMRARFGILFAELQVELREITLKNKPSQMLAISPKGTVP
    VLQLVDRTVIEESREIMIWALEQQDPQGLLEAEVLQQANALIDKNDNEFKYWLDRYKYADRHIDMTQTEYRQKGEIFLQV
    LEELLTKNPYLLGKTVTIADIGIMPFVRQFAHVDRNVFYSLPYPNLQQWLQDWLQHPFFLQTMTKFQPWQDGDEAVIFC

    >gi|93005798|ref|YP_580235.1| DSBA oxidoreductase [Psychrobacter cryohalolentis K5]
    MSIIAPLRIDIVSDVVCPWCAIGYGQLAEALKKTNTEYEIHWHPFELNPDTPHEGRNYREHIAKKYGSSREESDASRAKM
    TEAGREVGFAFNFTEESRTYNTFAMHQLLHWADQQGYAHDLKQALFAAHFTHARDISNKEVLADIVAEIGLDRSEALAVL
    ADERFAEDVRRAQQQWRQQSIQSVPSVIFNQKHLVSGAQGVENFKSILQQLADMPQ

    >gi|93005799|ref|YP_580236.1| hypothetical protein Pcryo_0971 [Psychrobacter cryohalolentis K5]
    MTDFTLHDKQSAPAESTALLDVSINAFGMVPNLHAVMAEAPGLLEGYQRLHQLFLDSSFDDEETTVVWQTINVEHECHYC
    VPAHTGIAKSMKVDDAITDALRDETPLPTAKLEALRDFTLSVVRDRGNVNDDTVQTFLDAGFTKRQVLEVVLATAQKVMS
    NYTNHLANTPIDKPFQKFEWHKAD

    >gi|93005805|ref|YP_580242.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Psychrobacter cryohalolentis K5]
    MIKKIVLIFAVLIGVIGFFYFDLNELLTLEGLKGSMDQFEQYKTQSPWLVIGGFFLVYILVTALSLPGAAILTLAAGALF
    GLVQGVLVASFASSIGATLAFLTSRYLLRDTIKQRFPDRLASIDAGVKKEGGFYLFTLRLVPIFPFFLINLLMGLTAIKA
    RTFYWVSQIGMLAGTFVFVNAGTQLAQIEQLSGILSFNLLASFALLGLFPLIAKGILTILKKRRVYKNYNKPKKFDRNMI
    VIGAGAGGLVTSYIAATVKAKVTLIEAGEMGGD
    CLNYGCVPSKALIKSAKVVEQIRHGERYGLNNSQPDFAFKNIMSRIH
    KVIADIAPNDSVERYTDLGVEVLKGYAKLIDPWTVEIALNDGSTQTLTARSIVIATGARPFVPDLPGLDETGYVTSDTLW
    DKFAKLDKAPSKLVVLGGGPIGCELAQAFARLGSAVTQIERGTRLMKKEDVEVSVFAQEALTESGVTILTSQQAIRCETR
    DGKKHIIVAPKGSTDDQQETAIEYDELICAVGRSARLEGYGLDTLGIDTERTISTDEYLETLYPNIYAAGDVVGPYQFTH
    VAAHQAWYAAVNGLFGHLKKFKVDYRVIPWTTFIDPEVARVGLNEQEAIDKGIDFEITRYDFKDLDRAVTESANHGFIKV
    ITPKGKDKILGVTIVAEHAGDLMAEFVLAMKHNLGLNKILGTIHIYPTWAEGNKYAAGEWKRNHAPKKALQLLEKYHTWR
    RG

    >gi|93005826|ref|YP_580263.1| hypothetical protein Pcryo_0998 [Psychrobacter cryohalolentis K5]
    MRYQNTYAQLDTRLYNEQLPNPLDNPRVGHFNIQVAEQLGWTEDTDLMNRWVEILGGQYVPAEFQPLSMAYAGHQFGQWA
    GQLGDGRGLLMAQVLDKNNQLQDLHLKGAGLTPYSRMGDGRAVLRSTIREYLCGHALTQLGIASSNALGFVVSDTKVRRE
    RIEAGAALMRVADSHIRLGHIEWIASFAPDLLAEFTDYMIDTYYPECRDSDTPVLAFLQAVVECTARMIADWQLIGFAHG
    VMNTDNLSITGSTLDFGPFGFMERFNPAWINNHSDHSGRYAYQNQPAIGHWNLNIWLPHFMRLDGVTRETLADCLAPYEA
    TFMQHYQQGLCRKLGLPHQRESLSLAFEWLTLLEDSLLDYTNSFRALLGLIAPDEHHYEQQLLATLTAELNPEAQQVWQA
    WSIRYLAQVKQVSITQAIEDMQASNPIYVLRNSMAQRVIVAAEQGQFKELNRVFELLASPYTLHDSAIDLDTLPPAPHAP
    QMPIS
    CSS

    >gi|93005864|ref|YP_580301.1| soluble pyridine nucleotide transhydrogenase [Psychrobacter cryohalolentis K5]
    MGSKTIGDATNDTGKDIKTEVSNKESGRVPNPEHTEGKNKKEKIEQTHEQVTEDIMHHPDLVNPLDDTRIDVKSGFTKDS
    QRLKSDKHEFEYDAVVLGAGPAGEAAAMKLAKSGKKVVVIDPREQVGGN
    CTHVGTIPSKALRQSVFNLINFRRDQMFTKA
    MDYHQVPLNIVLAKARKVILQQVQTHTRFYERNQIEVIHGWANFIDKNTIRIEIDENTFETITFNKAIITVGSRPYRPDI
    LDFNHPRVFDSDKILQMDYVVKKIIIYGAGVIGCEYASIFTGLGYKVDLINNQNQLLSYLDSEISDAIAHDFRQFGVVIR
    SNEEIDHLETHDDCVILHLKSGKKIKSDAILWSNGRSGNTEGLNLECLGLEANSRGQLKVDDTYCTEVENIYAAGDVIGW
    PSLASAAYDQGRCAAAFMVGDRDAEPVSSVPTGIYTIPEISCIGKTEQELTDAKVPYEVGQAFFKHLARAQIIGERSGVL
    KILFHRETLEILGIHCYGNHASEIIHIGQAVMKCNATLEYFVNTTFNYPTMAEAYRVAALNGLNRVF

    >gi|93005916|ref|YP_580353.1| peptide methionine sulfoxide reductase [Psychrobacter cryohalolentis K5]
    MPHKKNHHDANNHNTNSHENKNANDLATVSPHAVSHWLKNISAFGVTTVLSAGILVACGQMSSAENNVSSSTSKQNSGVK
    SSRDMLPSDMLKTMQALPQLTKGLGKNGAAVIDPNKPTLVKFWASW
    CPLCLGTLAETEEWRTDSKFSGLNVVTVASPGHL
    NEKADGEFSTWYAGVQADYPKLPVLIDASGELINTLGVQVYPSWAILDKNGNLVHLVKGNMSAEQAYALAENASNDFAEL
    KAGSAKPANVQTLDNNSKIETIKQNDGVYYNDKGKAINTRSIYLAGG
    CFWGVEAYMERVDGVVDAVSGYANGDTVNPSYE
    QVIRGSGHAEAVKVTYDADKTDLDTILKYYFRVVDPTSLNKQGNDRGVQYRSGVYYRDKADKAVVDAAIKRVQSQYKQKV
    VVENKILDNFYLAEMYHQDYLAKNPNGYCHVDLSLADDKPEDTARTKLAPVTTVAETLDPKRYAGFDKGALKNTLTKAQY
    DITQDAGTERAFSHEYDNLFAPGVYVDVVSGEPLFLSTDKYASGCGWPSFTKPIDKQVITQHDDTAFNMVRTEIRSRVAD
    SHLGHVFPDGPKDRGGLRY
    CINGGALQFIPVSVMPQSGYAPLVKLVKPAKP

    >gi|93005978|ref|YP_580415.1| glutaredoxin-like protein [Psychrobacter cryohalolentis K5]
    MSEQTPNTAANDIEQLIRNQIKDNKVILYMKGSPQFPQCGFSAKAIEVLTQIGRPFAFVNILENPEIRATLPQIANWPTF
    PQLWIDGELMGGSDIILQMYQSGELKPLVEANSPAA

    >gi|93005986|ref|YP_580423.1| UBA/THIF-type NAD/FAD binding fold [Psychrobacter cryohalolentis K5]
    MSNVETEILLDDELLRYARQILLDGWDIDAQLRLKSSRVVMIGAGGLGCPASETLVRAGLGHIHLIDDDDIEASNLQRQT
    LFLPEDIGKPKAITAAQMLMRINPLITARGTIARLSEDNAYELLDMACGTPDLLLDCTDNFATRDIINRISVRYQIPLLS
    ASAIAMQGQLALFEPDLNTGCYHCVFGSVVLDAEADERT
    CANSGVLASTTAIMGNLQANAALQYLGLTKNPLTNKLLIWD
    GSRMQQRLMGYRKESECPVCNSLS

    >gi|93006175|ref|YP_580612.1| heavy metal translocating P-type ATPase [Psychrobacter cryohalolentis K5]
    MKYHIEGMDCASCIGKIETALKRMPGVSDVELNFATETLELSLAPDAPTQASDIEKTIKSLGFGISANTGQQTVSAIDID
    SDNQMAPQDKRWWQTQKGKQVVGLGILMGSAYALSLLFPAYGIWVFAIAVIVGVFPFARKALALAKTGSFFSIETLMSVA
    VLGALIIGEAEEAAAVVFLFSIGELFESIAADRARAGIRALSSLVPKSAILLDAQGGQRNVPATSLQVNDLVLVRPGDRV
    SADGSIVQGASSLDDSPVTGESVPVAKTMGDNVFAGSINIDGVLQVRVEKTAADNTISRIIDLVEQAQASKAPTARFIEK
    FSRYYTPAVMAIAALIIIVPPLTMGGDWSTWLYRGLALLLIACPCALVLSTPAAIASGLAVGARRGLLIKGGSALETIGQ
    VKTVAFDKTGTLTEGKPRVTDVVDITQEYSSVQGQDSQDQGSQGKDKVLALFASVETGSSHPLAEAIVSHAKAAKVVIPV
    ASKASATAGKAVHATIAGRALAIGSPVYAADEASISAEQQAQIEALQNEGKTVSVLFDEQSREVLGLVALRDELRDDAHE
    GVAQLKAMGVRSVMLTGDNRLTAQALASNLDVEWEAELLPEDKLRLLNEMKNNSKIAMVGDGINDAPALATADVGIAMGG
    GTDVAIETADIALLKSRVTDMAHLIALSRATMRNIHQNVIFALGLKGVFLITTVFGITGLWIAVLADAGATVLVTLNALR
    LLRFKGAPPLVTPPKVVK

    >gi|93006177|ref|YP_580614.1| periplasmic protein thiol [Psychrobacter cryohalolentis K5]
    MTMSNNTPEQKDSQNSKQRNPKTMKKKQTKLWFLIPLILFFGLVVILYMRLGKPTDIVTNTALERPVPTFELPLLADTTR
    TITNDNLPDKPFLLNVWGSW
    CPTCVIEHPFLMQLEERGVDIVGVNYKDEIGNALSYLNRGGDPFSMSIQDSLGQFALDLG
    ITGAPETFVVDGDGIIRQHIVGEINEANWQQRVKPCLTVLNKANKNNDSPDLIQVEEMCK

    >gi|93006253|ref|YP_580690.1| peptide methionine sulfoxide reductase [Psychrobacter cryohalolentis K5]
    MTHRLLVNYKLPAKVVGMAIVASSVFYVGCASTEKPPTIKDVSIDNPYAPTDPNLAVATVAGGCFWCVEAGYEKIPGVVE
    VVSGYTGGESKNPTYKQVSAGGTGHTEAAQVYYDPTKITYNGIVQALWRIADPTDDKGQFVDRGTQYRPAIFYNSEQEKQ
    IAEAAKQSLQASGVYKKPVVIEIVPVSEFYPAEEYHQDYYKKNPLRYKAYTFNSGRYQFIESVYGKKYELDFNQFKPTVT
    SAKSAMSNTSSAAVKPSTVKTSAGFDPDTFVKPTKADLKKSLSDIQYKVSQEDSTERAFDNEYWDNKEPGLYVDVVSGEP
    LYSSRDQYKSGTGWPSFTRPLNASFVVEKADRGIFGTRTEIRSRYADSHVGHVFDDGPAPTGKRY
    CMNSAAMRFIPLAQM
    EAAGYGRWINDVKSAS

    >gi|93006291|ref|YP_580728.1| arsenate reductase [Psychrobacter cryohalolentis K5]
    MTSLIFHNPKCGTSRNTLAIMQASGDNPEVIEYLKTPPSREYLVELLAKMALSPRELLRSKESINDELGLDNPALSDDEI
    IDAMIDHPILINRPIVVTDKGAALCRPSERVFELLENPVSSFTKEDGEVIYHGK

    >gi|93006306|ref|YP_580743.1| methylated-DNA--protein-cysteine methyltransferase [Psychrobacter cryohalolentis K5]
    MIVTTAAFGSNQLTLIASVNEHSSPKLVEVNWLLAGDSWHSSKSIPKLKKHYGIDDQSFTFIDKDSLSKNEPTQALLIEA
    IAQLTEYFNGERQAFDLPLDASLGTKFQQRVWQALQDIAYGETISYATLAQNVDSPKGFRAVANANSKNPFSIIVP
    CHRV
    IASDGKLGGYTGGLDKKTHLLALEGVTCKA

    >gi|93006482|ref|YP_580919.1| iron-sulfur cluster assembly protein IscA [Psychrobacter cryohalolentis K5]
    MIEMTERAAQHVREFLDNRGKGEGIRVGIRTAGCSGLAYVLEFVDTPDENDTRYESLGVSIFIDPKSLVYLDGLLMDYEK
    EGLNEGFKFSNPNQKGECGCGESFTV

    >gi|93006560|ref|YP_580997.1| rhodanese-like protein [Psychrobacter cryohalolentis K5]
    MDRALEFVGNHPFLFGILAVLAVLFFAIENKRSGKKISPNTLGMMVNSQNAQLIDIRAKKKFVTGYIQGSRNIPFTELKD
    RIEEIRAIEQPVIII
    CDMGVQAGAAIQMIGKENVYRLEGGVGGWQAAGMPLVGIKDTKPKTKVKAKPSLHK

    >gi|93006561|ref|YP_580998.1| glutaredoxin GrxC [Psychrobacter cryohalolentis K5]
    MTVSVKVYTTPICPYCSNAKQLLKSKGVDYEEIGMHDMSSDDRRALMQKTNNYRTVPQIFVGETFVGGFDELNQMNQQGK
    LDELLAG

    >gi|93006566|ref|YP_581003.1| periplasmic protein thiol [Psychrobacter cryohalolentis K5]
    MTQSEESPQKGTDKKGNQTMKKSQIRIWFLIPLIIFAAFIVMLYFRLGQPTEIVTNTALERPVPAFELPLLSDTSRIMTN
    DNLPDQPFLMNIWGSW
    CPTCIIEHPFLMQLEERGVNLVGVNYKDDIGDALGYLNRGGDPFSMSIQDLSGQFALDLGLTGA
    PETFVVDGEGIIRQHIVGEINESNWQSRITPCLMVLNEADKNNVSPDLDQVKEACK

    >gi|93006601|ref|YP_581038.1| heavy metal translocating P-type ATPase [Psychrobacter cryohalolentis K5]
    MNPNNSDKKNGHSGLESNNTNQAHTTFKEYNQVPADYNGAVYTCPMHPEVRDVEKSDCPICGMFLKPEDEVTDEDSHSHC
    HGKDTDRTKVKSVKGGKYDKVPADYSGTVYICPMHSEVRDVKNSGCPICGMTLEPEMATIGEEDTSELDDMTRRFWICTV
    LTIPLFLYAMSDMVGLSLDNLGQGDISGQIAQWIQLALATPVVLWGGAPFFVRGWQSIKSRNLNMFTLIAVGVGAAFGFS
    LVATFLPDVFPDSFRDATGQVGVYYEAAAVIVTLVLLGQVLELKARSQTSGAIRALLELAPPTARRVDENDVETEVSLDE
    VISGDRLRVKPGEKLPVDGTVLDGSSSIDESMVTGEPIPVLKAQGDTVTGGTVNGTGTLLIKAVNVGDDTVLSKIVKMVA
    EAQRSRAPIQKLVDKVAGWFVPIVLICSVITFIVWAIFGPTPAMAFALVNAIAVLIIACPCALGLATPMSIMVGTGKGAQ
    NGVLIKNAEALESMEKVDTIVVDKTGTLTAGKPELTAIEALGGLDEDEMLILVAAVETASEHPLAEAIVNAAKAKSLDMV
    KASDFSSTTGEGAQALVNGKQVAVGNSKFMQRLNSFDSTLLERADKRRKDGETVMFVAVDGQAAGLISVADPIKPSTSEA
    ISLLHKAGLRVVMLTGDNEITARAVASKLKIDEVHADVSPEDKNRIIKELQSSGKVVAMAGDGINDAPALAQADVGIAMG
    TGTDVAMESAGITLVKGDLMGIVRAHKLSHSTMRNIRQNLFFAFIYNALGVPIAAGVLYPFFGILLSPMIAAAAMSLSSV
    SVIGNALRLRRLKL

    >gi|93006643|ref|YP_581080.1| OsmC-like protein [Psychrobacter cryohalolentis K5]
    MKIFYKTRATATGGRSGHTGLDDGSLGFDLVSFQEKDKEGVNPEQLFAMGYAACFDSALNMTAQQMKLPVTASKTSAQVG
    IGMKADNSYNLDIELAVEVSGIDESQAQTLIETAHQV
    CPYSNATRGNVDVRLHVTIV

    >gi|93006695|ref|YP_581132.1| heavy metal translocating P-type ATPase [Psychrobacter cryohalolentis K5]
    MNDSTHTDTHNSYDVETDIQSNTPLTPQRAHLQLAIEGMTCQACASRIEKVLNKKPSVYEVSVNFAGETANVDYDPTQTT
    AEQVTEWVNKTGFVANLQAADSLFAQKGEDASTQYPWRLIGLWVCLVPFLIGMAGMLFGQGMAWMPPVWMQFILATIVQF
    GFALPFYKSAWASIRGGLANMDVLVVIGTVTIWAYSTYLWLTHGDGSLNSLLQSGHTGGHGASGSPAVYFEAGVMVIAFV
    RTGKYLEERTKKHSLNSIDLLLSLTPDEVEQQQPNGEFKNIALKEVQVGDILRAKQGSRVATDGTVIDGAGWCVESHLTG
    ESVPLKKEVGDGLLAGALVENGSLLYRVNAKGSDTKLGDMVQALSDAQGSKANLARLADRVTAVFVPVVVVIALVAFGVT
    WWLTGMLDTALMHAVSVLVIACPCALGLATPAAIMAGMGVAARHGVWFKDAQSLEAAGNIDIVVLDKTGTLTIGKPTIVD
    EVMVDKSIAVDDVLQIAASIEVHASHPLATALVNAATARGLSLFDVSDISVIKGAGIQANIEGLGVVKVGTAEFANLVLP
    KLMPKVWQIASTVAISINDEALGAFALADDLKSDTPQAITALQDAGINVILMSGDKQSVVDHVAGQLGIEKAYGKMSPRD
    KASQIALLQTAGHKVAMAGDGVNDAPAMATADASFAMFEGTDVAQHSASARLMGESLMHIDAAQKIANATLRNIKQNLFF
    AFIYNCLGIPLAAFGFLNPMIAAAAMALSSISVLMNALRLTRFKTKVELNNTVSDSHTKADRLTKA

    >gi|93006696|ref|YP_581133.1| heavy metal transport/detoxification protein [Psychrobacter cryohalolentis K5]
    MGNQTRIIKIDGMTCGGCVASVHNATADIDGLDDISIELADNQATVTFDDSKTSAETIAAAIDDAGFDATVTNA

    >gi|93006717|ref|YP_581154.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Psychrobacter cryohalolentis K5]
    MITHIPDMTFKTRVRDDSIGGDNPFTWYDLTTDELFANKKVVVFSLPGAFTPTCSTSHLPRYEALYNEFKALGIDEIVCI
    SVNDAFVMYQWGLKQNRENVFLLPDGNGEFTRKMGMLVDKSNVGFGMRSWRYSMVVDNKEVKKVFKEADFGDNCPIDPFE
    VSDADTMLAYLKSNA

    >gi|93006761|ref|YP_581198.1| DSBA oxidoreductase [Psychrobacter cryohalolentis K5]
    MENSKQLTSEQPLRIDIVSDVVCPWCVVGYRQLAAALEQTNTDHEIHWHPFELNPNMPSEGQNMREHIMEKYGSSKAESD
    ASRTRIAEAGSEVGFEFNFTDDLRMHNTFNLHQLLHWAEQQGRMHELKQALFIAHFTDNRNLSDIRVLADIAAEIGLDGK
    EALTVLEDQRFANAVREIEQHWQRQGIQSVPAIIFNEQHLVSGAQGVDNYVNILEQLANMQE

    >gi|93006790|ref|YP_581227.1| glutathione reductase [Psychrobacter cryohalolentis K5]
    MTKHYDYIAIGGGSGGIASINRAASYGKKCAIIEANQLGGTCVNLGCVPKKVMWYGAQVAGAIHKYAPDYGFDVELKGFD
    FQKLVQSRQQYIQNIHRAYDNNLAKNGVEVIKGFAKFVDNHTVEVNGELITADHILIATGGHPIKPNIKGAEHGIDSDGF
    FALNHLPKRVAIVGAGYIAVEIAGVMNSLGAEVHLYVRQHSPLRSFDHTIVETLLIEMEQDGIQLHTNTTLTEVVKNDDS
    SLTLCTTDGALDTVDCLIWAIGRAPSTDNINLQVTGVETTEFGKIIVDKFQNTNVKGIYAVGDIIENSVDLTPVAIAAGR
    RLSERLFNNKPDEHLNYELIPTVIFTHPPIGTIGLSEIDAVNQFGKDNIKCYTSTFTDMYSAVTKHRQKSTMKLICLGEE
    EKVIGLHGIGFGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|93006890|ref|YP_581327.1| thioredoxin [Psychrobacter cryohalolentis K5]
    MSEKNAHVVCPHCQATNRVPDSKLSAAPNCGKCAKPLLTATPHELNAQTVSKVIQKNEVLTIVDFWASWCQPCLMMAPEF
    KIAASQLPQIVFAKIQTDKYEQAAAPYNIRSLPTMVAFKNGKEIARQSGALPSHQIVQWVQSLK

    >gi|93006898|ref|YP_581335.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Psychrobacter cryohalolentis K5]
    MIDQSLLDAVKSYSVNMTRPISFVLGSGEHSKRAELIDFLSKIAGTTDKINFDAQANDDSLPSPISFKVISHIDGALTDT
    GIVFSGIPGGHEFTSLILAILQAGGHTLKLDEGIQKLIKRFNKPLQFQTYVSLS
    CHSCPEVVQALNQFALLNDDISNEMI
    DGALFQEQVEANNIQGVPAVFLNGKPFANGLIDTAKLIEKLQEQFPDLLAEAEDDAEQLEQQDVTIIGAGPAGVAAAIYT
    ARKGLKVTMVADRIGGQVKDTQDIENLISVPLTTGGELSVNFEKHLREYNITLKEHVSVKEISETADENYRIHLNTGETF
    ETRSIILATGAQWRKLGVAGEEENIGKGVAF
    CAHCDGPFFKGKDIAVVGGGNSGIEAALDLAGIVKHVTVLEFADDLKAD
    QVLINKAKEKANIDIITSAATQEIKATEGKVSSIIYQDRNSSENKELDVAGVFVQIGLIPNTGFVKGFVDLNRFGEIEID
    ERCRTDRKGIFACGDVTTVPFKQINIAMGEGSKAALSAFEYLVMQ

    >gi|93006902|ref|YP_581339.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Psychrobacter cryohalolentis K5]
    MASIINQEIPEFSADAFVNGEFKTITSEDVKGSWAIFLFYPADFTFVCPTELEDMAGHYDELKGLGVEVYSVSTDTHFTH
    KAWHDSSEAIGKVTYPMIGDPTGRITRGFNVMIEEAGLAERGTFLVDPDGLIQVAEIHAGGIGRSAKDMLRKVKAAQYVR
    ENDGEVCPAAWEAGQETLKPSLDLVGKI

    >gi|93007067|ref|YP_581504.1| peptide methionine sulfoxide reductase [Psychrobacter cryohalolentis K5]
    MQTIILGGGCFWCTESVFLSVKGVQSVISGYMGGDAVSANYEAVCGGNTGHVEVIKVEFDESIVPLEVILDVFFATHDPT
    TMDRQGNDVGSQYRSVVFYTDETQKPTIDRTINKLRDMGINVVTEVHPAVEFYQAEDTHQDFFNRNPGQAYCNFAIPPKL
    AKLRKEFSQYMVS

    >gi|93007116|ref|YP_581553.1| thioredoxin [Psychrobacter cryohalolentis K5]
    MVIHIIKQERKIMSDLIVNTTDANFDQDVLQSDVPVLVDFWATWCGPCKAIAPILEDLATEYQGKVKIVKVDVDNNPQAA
    SRFGIRNIPTLFVFKGGEKVDSVMGLQPKAELAKVLDKHL

    >gi|93007251|ref|YP_581688.1| Na(+)-translocating NADH-quinone reductase subunit D [Psychrobacter cryohalolentis K5]
    MADTKSILTSPIFDNNPIALQILGICSALAVTTSVANALVMSVALTLVTAFSSFFISIIRKQIPSSIRIIVQMTIIASLV
    ILVDQILKAVAYDVSKGLSVFVGLIITN
    CIVMGRAEAFAMSNPPIPSFLDGIGNGLGYSAVLLFVASIREILGAGSWFGI
    TILQTATDGGWYVPNGLLLLPPSAFFIIALFIVIIRTWKPDQVEDAEFVMKPQSKGMAQGGGH

    >gi|93007252|ref|YP_581689.1| Na(+)-translocating NADH-quinone reductase subunit E [Psychrobacter cryohalolentis K5]
    MGHYVSLFITSVFIENMALAYFLGMCTFLAVSKKVSTAIGLGVAVVVVMAITVPLNNLLFQFILKDGALAWAGFPDIDLS
    FLGLLSYIGLIAATVQILEMFLDKFVPSLYNALGVFLPLITVN
    CAILGGVLFMVERDYNFGESVVYGVGAGFGWALAITA
    LAGIREKLKYSDIPAPLRGLGITFITVGLMSLGFMSFGGMSI

    >gi|93006083|ref|YP_580520.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Psychrobacter cryohalolentis K5]
    MPSNYGQRIQAGVKFPDINVQMLNGDIKSLGTPDNGHDWKLVVVYRGQHCPICTKYLNQLETVKSSFADAGVDIIAVSGD
    SKEQLESHLEKLDIDFPVAYGLTVEQMNTLGLYISEPRSEKETDHPFAEPGVFVVNADGEIQIVDISNAPFARPELEALA
    NGLAFIRKNDYPIRGTHR