Psychrobacter arcticus 273 4 uid58021

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|71064602|ref|YP_263329.1| hypothetical protein Psyc_0021 [Psychrobacter arcticus 273-4]
    MVNNTDYVGTLFDNSESNLSKITLAFTMAGVALKKGHSASVILMVDAVYLALPNALDNVNIGAPFEPAGELLEAFIEKGG
    QVLV
    CGACMKHNGVEESAIDKRFTVISGDDVVELLMNAKGSFQLN

    >gi|71064606|ref|YP_263333.1| hypothetical protein Psyc_0025 [Psychrobacter arcticus 273-4]
    MKLPVLKLASLSGVMLVATTACAQPNTADMTNKAVSQKVSQSAQTSQNTQAIGTVSKSVDSRLRQLLTQAGIKTQITSIV
    PSKLPNMYQVNLAEQLPLHITEDGKYVIQGELQKNPSKRVVTKTPARSTSAQIGKPVSASIKSDILANMGALKNMSAKTP
    FFYTAVPGVIWGATLEGVPFLLSDDAQYITDGEISVIEKGQFTGLDSSFEKLKNQSVLTTLDTKQLITYPATSAEKAVIY
    VATDVN
    CPYCRRLHKQMSMLNAKGVTVKMIGYPIYEESPEQMRGIWCQGNEDSRRKALDKAMLQGKMTPAPATCKTNDVA
    GNREKAAGLAVMATPAIYREDGVLFQASFESPEFLEFLGVK

    >gi|71064615|ref|YP_263342.1| disulfide bond formation protein [Psychrobacter arcticus 273-4]
    MLQLTTYRNLQVFLVIMTAIGMSFALFFLQRYMGFSPCPLCIFQRIGLMIMGGFALIAALFHPKSMVIRLLLWLGSLAGI
    GWAAIVAGRHVWLQHLPADQVPS
    CGPGLDYWLDTLPMQQVLKEVFAGSGECASIEWTFLGLSIPEQSLILFSILILTHLL
    ILWRIVRPSTPKPLAR

    >gi|71064617|ref|YP_263344.1| iron-sulfur cluster insertion protein ErpA [Psychrobacter arcticus 273-4]
    MNQPANQFNPSSSQPVDPTVLNLTDSAAQKVRRLREEEGDSNLMLRVYVTGGGCSGFSYGFNFANELNEDDANFDNNDVT
    LVVDSLSYQYLQGSTVDYTEGLEGARFIVTNPNATTTCGCGSSFSI

    >gi|71064685|ref|YP_263412.1| dihydrolipoamide dehydrogenase [Psychrobacter arcticus 273-4]
    MKDSYDLVVIGGGPGGYEAAIRAGQLGMSVACIEKRVYKGEPALGGTCLNVGCIPSKALLDSSHRYEATKHDLAEHGIST
    GDVAIDIEQMIARKEGIVKQLTGGIAALLKGNGVDWLQGWGTLVDGKGNDKKVKFTALADDSETTITAKNVILAAGSVPI
    DIPVAKTDGDRIVDSTGALDFTAVPKRLGVIGAGVIGLELGSVWRRLGAEVVVYEALPSFLAAADKDIAKEAGKMLKKQG
    LDIRVDTKVTNAEVKGDQVIVTSEAKGESSEESFDKLIVCVGRRAYSEKLLGEDSGIQLTERGLIDVNDQCKTNLDGVYA
    IGDLVRGPMLAHKAMEEGMMAVERIHGDKAQVNYDTIINVIYTHPEIAWVGLTEQEAEAAGYEVKTGSFNLAANGRALAQ
    SEAQGSIKVVADAKTDRLLGMHAISAGAGDIVHQGMIAMEFVSSIEDLQLMTFAHPTISEAVHEAALSADGRAIHAIQRK
    KRK

    >gi|71064701|ref|YP_263428.1| hypothetical protein Psyc_0120 [Psychrobacter arcticus 273-4]
    MKRIIALTGLACAIGFANIGAQAANYVAGKDYRVLDNPEKISGDAIIVREFFWYGCPHCNVLNPHMEKWAKTKDKDVAFF
    KTPAALNPVWEASARGFYAAQLLGFEDKTHDALFDAVHKDGKQLFDQSSLSKWYASKGVNEKKFNSLYNSFAVGTKIGRS
    QAGAKRYQLSGVPAVVVQGKYVVTGESATVPKVVDFLVDKVRAEKK

    >gi|71064758|ref|YP_263485.1| hypothetical protein Psyc_0178 [Psychrobacter arcticus 273-4]
    MSIQIDWQAFTPISLVGGLILGVATVILLLGVGRIAGISGIFSSLLKPKRVEMWQVLFIAGLIISPLLYSLVRPLPDVEI
    STSLPLLIGAGLLVGFGTRMGSG
    CTSGHGICGNARLSPRSMAATVTFMFFGIVTVYIGRHVLGLL

    >gi|71064831|ref|YP_263558.1| thiol:disulfide interchange protein [Psychrobacter arcticus 273-4]
    MFLAPFSKTMLNRDTFSRSHLSRVMSAALLVIVAAGCSNNAADATSNTDLVNSSKAKTSTAALSKDSDAKVVKSLQANLK
    ASGIEETILSAVPTDMDDIYWVTAEGLPAFFTDKAGKHIIQGQIIAVGAKAPVDISGTLVARTAQDALKAVDKKDMVIYP
    AKGATKAVVYAFTDAD
    CPYCAKLHEEMEDINARGIEVRYLAWPRSEGSIPKMEAIWCSEDRKAAMDQAKMGANIQAPSCN
    SPVQAQIDLGIALGVRGTPAIFTESGQQVGGYLPAAQLAEAVGAN

    >gi|71064941|ref|YP_263668.1| thioredoxin protein [Psychrobacter arcticus 273-4]
    MTPDIENKNIKVKKTSKQKVLSIIKTVLLYGLVFTLIYTAVNWWRQPVMPTNPQLQLMDYQGQSVDLTAMSKDKPTLVYF
    WGTW
    CPICSVTSPTINTLAASGDYPIVTVAIKSGSDQDLGGYLQEHNYNFTTINDQQGIIFDDWQGQVTPSYVILKDGKM
    TQGLTGIQPEWSLKLRLWLSSIFWLNT

    >gi|71064946|ref|YP_263673.1| hypothetical protein Psyc_0370 [Psychrobacter arcticus 273-4]
    MSTSETNNIKAPNHVTEYDSVTNNIVVAALYKFTRFADFEEYREPILNIMLDNEVKGTLLIASEGINGTISGTRQGIDNV
    LEYLRSIDAIGSFTFKESYTDAQPFYRTKVKLKKEIVTMGVENIDPLQSVGRYVKPSDWNALISDPDVILIDTRNDYEVK
    IGTFQNAVNPNTETFREFPEYVAKELDPAKHKKVAMF
    CTGGIRCEKSTAFMREQGFEEVYHLEGGILKYLEEVPASDSMW
    EGDCFVFDNRVSVNHNLEKGSYEQCFACRMPITQAEMQSPAYIKGESCPHCIDKATDEQKARFREREHQMQLAQKRGEAH
    IGSDVIDVIEKRKAAKIEARRQADEANKAKAD

    >gi|71064955|ref|YP_263682.1| organic hydroperoxide resistance protein [Psychrobacter arcticus 273-4]
    MEPLYSTKASVTGGRAGSASLQDSDLTINMVAPGSGKDGNNPEQLFAMGIAACFDGALGAVKGAEKAKFDSTTEVSVDLL
    KGEDLDFKLAIKIHVIGKNTELSADEFQQLVEKANKV
    CPYSKAIHGNVDSEVTSEVK

    >gi|71064963|ref|YP_263690.1| putative thioredoxin reductase [Psychrobacter arcticus 273-4]
    MATDNTAPRHEKLIILGSGPAGYSAAVYAARANLKPVMVTGMEVGGQLTTTTEVDNWPGDAHDLTGPALMERMKAHAERF
    GTELVYDHINAVNLNVRPFELTGNNGSYTCDALIISTGASAQYLGLESETKFRGLGVSA
    CATCDGFFYKDKKVAVIGGGN
    TAVEEALYLSNIASEVTLVHRRDSLRSEKILQDKLFEKAKNGNVKIEWNHSVKEVVGDDMGVNGVVIESMLDGSTKQLDV
    FGMFVAIGHKPNTDLFKGQLEMKDGYLIVNSGLNGNATQTSIEGVFAAGDVADHVYRQAITSAGTGCMAALDAEKYLDAI
    GEAVAKDHTYASTLTADKEA

    >gi|71065146|ref|YP_263873.1| hypothetical protein Psyc_0578 [Psychrobacter arcticus 273-4]
    MTITIYGIKSCSTMKKAFAKLDELGVNYDFHDYKKQGVDKESVQRWVKDVGIDKVLNKRGTTWRKLTDEQKQVADSDVDK
    AIDLLIENTSMIKRPIVEGELTNKNKPILLCGYDEAEFDTNFA

    >gi|71065189|ref|YP_263916.1| DSBA oxidoreductase [Psychrobacter arcticus 273-4]
    MKNSDQPLQIDIVSDVVCPWCIIGYRQLAEALKDTNTAHEIHWHPFELNPNMPAEGQNLREHIIEKYGSSVQESNESRTR
    MAAAGADVGFEFNFTDDTRMHNTFNLHQLLHWADQQGHMHDLKQALFTAHFTNNRNISDNAVLADIAAEIGLDRAEALAV
    VEDQRFAKDVREAEQHSAQQGIQGVPAVIFNGRHLVSGAQGIENFTRILKQLAENPD

    >gi|71065262|ref|YP_263989.1| 1-Cys peroxiredoxin [Psychrobacter arcticus 273-4]
    MAHLRLGDTAPNFDATTTEGDINFHEWAGDNWVVFFSHPADFTPVCTTELGRAAALNGEFQKRGVKPICISVDGIDDHHA
    WAKDIGETQGTELNFPIIADPNKEVAELYDMMHPNADSTHTVRSVFIIDPSKKIRLTLTYPASCGRNFDEIIRVIDALQL
    SDEYNIATPVDWKDGDDVIIPPSVKNEDIAAKYPKGHTEIKPYLRTTPAPNK

    >gi|71065284|ref|YP_264011.1| hypothetical protein Psyc_0718 [Psychrobacter arcticus 273-4]
    MQYNQLSKEEISQLTDADWKERLSSDEYHVMREKGTERPFTGVYNDINDKGIYRCKGCGANLFESDNKFDAGCGWPSFDQ
    GIDNSAIDEHVDDSLGMRRTEVTCSHCSAHLGHVFPDGPSETTGMRY
    CINSVAIDLDKSDE

    >gi|71065328|ref|YP_264055.1| dihydrolipoamide dehydrogenase [Psychrobacter arcticus 273-4]
    MNKQPDTASDPSAPFDHSTHQNVTRKVSVAVIGAGTAGQNAFRQAKKSVEDIIIINDGFWTTTCIAVGCMPSKLLIAAAD
    RAHDANHSGEFGIHATAHIDGKQVMERVRAERGHFSSYIEKYVDSWSEDSKIAGRAYINKQGLIEVNDELIQADKIIVAT
    GSSTFIPDGWADKLGDTMLTSDTVFELVDLPKSMAVIGAGAIGLELAQAFTRLGVKVTVFNRAKRVAGLKDNDINNKAID
    CLSRELTMHLGSKITDIGQKLDGNIDKNIDKKNIAAFIDYEDSAGKVQQWQGDYVLVATGRRNNIDTLGVENLGVELDDK
    NRPKNLDKKTGKIGDLDVYIVGDANAHIPLLHVASDEGFSAGSMVCGNKKDAYIRPPATPFSIVFSSPQIVNVGMSLPDI
    EQDPTLEHVIGKVNFDNQGRSRVMGVNCGLLHIYGCEKTDRILGASMVGPDAEYIGHILAMAITNDLSIKDILDTPFYHP
    TILEALRAALRDVQDLMEIPYQSLDTQQHSS

    >gi|71065329|ref|YP_264056.1| peroxiredoxin [Psychrobacter arcticus 273-4]
    MMAKPTTETITLPDFPVTIVRELDGHFIHDDISLKELVANTSKGLILYFYPKDNTPGCTTQATEFTAHLNEFDDLGYDII
    GVSRDSVESHESFITKYNLQIPLISDADEKLCHHFDVIKEKNMYGNITLGLVRSAFVFDKNGTLTHAQRNLKAKDYTERL
    LTTLAP

    >gi|71065402|ref|YP_264129.1| glutathione S-transferase [Psychrobacter arcticus 273-4]
    MNHTMTSSYHRLYSFRRCPYAMRARLGILFAELQVELREITLKNKPPQMLAISPKGTVPVLQLLDGAVIEESREIMIWAL
    EQQDPQRLLDEKTLQQANALIDKNDNEFKYWLDRYKYADRHLEMTQTEYRQKGEAFLQVLEALLTKNTYLLGKNITIADI
    GIMPFVRQFAHVDSDIFYSLPYPNLQRWLQDWLQDPFFLQAMSKFQPWQEGDEAVIFC

    >gi|71065495|ref|YP_264222.1| putative methylated-DNA-(protein)-cysteine S-methyltransferase [Psychrobacter arcticus 273-4]
    MIVTTAAFGSHQLTLIASVNEHSNPKLVEVNWLLAGDSWHSSKSIPKLKKHYGIDDQSFTFIEKDSLRKSEPAQALLIET
    VAQLAEYFNGDRQTFDLPLDANLGTKFQQRVWQALQDIGYGETISYATLAQNVDSPKGFRAVANANSRNPFSIIVP
    CHRV
    IASDGKLGGYTGGLDKKIHLLALEGVTCKA

    >gi|71065513|ref|YP_264240.1| putative arsenate reductase [Psychrobacter arcticus 273-4]
    MTSLIFHNPKCGTSRNTLAIMQASGENPEVVEYLKTPPSRDYLVDLLAKIALSPRELLRSKESVNDELGLDNPALSDDEI
    IDAMIAHPILINRPIVITDKGAALCRPSERVFALLANPVSSFTKEDGEIIYNAKDK

    >gi|71065603|ref|YP_264330.1| bifunctional methionine sulfoxide reductase A/B protein [Psychrobacter arcticus 273-4]
    MTHRLLVNDKLPAKVVGMAIVASSAFYVGCASTENTSTVKDIAIDNPYALTDPNLAVATVAGGCFWCVEAGYEKIPGVVE
    VVSGYTGGKSENPTYSTVSAGGTGHTEAAQVYYDPTKITYNGIVQALWRIADPTDDKGQFVDRGTQYRPAIFYSSEQEKQ
    IAEAAKQSLQASGVYKKPVVIEIMPVSEFYPAEEYHQDYYKKNPLRYKAYTFNSGRYQFIESVYGKKYELDFSQFKPTAT
    SAKSVMSNISSAAVKPATVKASTGFDPDTFIKPTQAALKKSLSDIQYNVTQKDSTERAFDNEYWDNKEPGLYVDVVSGEP
    LYSSRDQYNSGTGWPSFTRPLNTSLVVEKADRGIFGTRTEIRSRYADSHIGHVFDDGPAPTGKRY
    CMNSAAMRFIPLAQM
    EAAGYGKWINDVKSGS

    >gi|71065714|ref|YP_264441.1| methyltransferase [Psychrobacter arcticus 273-4]
    MHEVVQDYYGKQLQSTEDLKTSACCDVSNMPSWLKPLLANIHDEVLSRYYGCGLVCPALLEGCRILDLGCGSGRDVYALA
    QLVGSTGHVVGVDMTDEQLAIAKQHQDYHVDKFGYDNVTFLKGYIEKLDELNLDPNSFDIIVSNCVINLSPDKAAVMASV
    QRLLKPGGEFYFSDVYADRRIPQQLINDPVLYGE
    CLSGALYWKDFERLARHADFLDPRLVEDRPLEITDPLLAAKIGDIQ
    FFSATYRLFKIATLEDACEDHGQAVIYRGTIDQLPHHFNLDKHHAIETGRVFPV
    CGNTFRMLKESRFAKHFDFIGDDSRH
    YGIFAGCGDILPFGNQANIVSDSNVGQSVNSGSCC

    >gi|71065718|ref|YP_264445.1| hypothetical protein Psyc_1160 [Psychrobacter arcticus 273-4]
    MKSTIELLEDTDFPAIKRRELKILQVNMGYLCNMSCVHCHVAASPYRTEMMSRELVELIPQILQAQNIDTLDLTGGAPEM
    HEDFKYLVKAARALGVKVIDRCNLTILMVEGYEDMAQFLADNEVEVVASLPCYSLENVDKQRGKGAFDDSILGLHKLNAL
    GYGKSGSNLTLNLVYNPQGATLPPNQQQLEADYKRELKVHFDIEFNQLFALINMPIQRFGAVLLAKKQFHPYMDLLKVNY
    VATNLTEVMCRSTISVNWLGELFDCDFNQQLEIPVPNKSRRHLRDLLTQNPAGDDIAIADHCYGCTAGQGSS
    CGGTLEES
    AI

    >gi|71065790|ref|YP_264517.1| molybdopterin biosynthesis protein [Psychrobacter arcticus 273-4]
    MVINMNELVETEMLLDDELLRYARQILLDGWDIDAQLRLKSSRIVIIGAGGLGCPASETLVRAGLGYVHLIDDDEIEASN
    LQRQTLFLPDDIGKPKALTAAQMLMRINPLITARGTVSRLSEDNAYELLDMATGKPDLLLDCTDNFATRDIINRISVRYQ
    IPLLSASAIAMQGQLALFEPQLSTGCYHCVFGSVVLDAAADERT
    CANSGVLASTTAIMGNLQANAALQYLGLTKNPLKNK
    LLIWDGRQMQQRLMGYRKDTECPVCNSLS

    >gi|71065799|ref|YP_264526.1| glutaredoxin-related protein [Psychrobacter arcticus 273-4]
    MSEQTPNTAANDIEQLIRNQIKDNKVILYMKGSPQFPQCGFSAKAIEVLTQIGRPFAFVNILENPEIRATLPQIANWPTF
    PQLWIDGELMGGSDIILQMYQSGELKPLVEANSPAA

    >gi|71065812|ref|YP_264539.1| TolB periplamsic protein [Psychrobacter arcticus 273-4]
    MTTLRVQLVNEARDPIVRDSLRLNDPQKILVAGGAIVSFLMLVYLLDTQHISQSLLLGIGLLLGYTLFHARFGFTSAFRR
    LMSVGNGQAMRSHMLMLAIAVTLFAPILAFGTTIFGGPVAGYVAPVGVSLFVGAFVFGIGMQLGGG
    CASGTLYAVGGGRS
    VMFITFIFFIVGATIGAYHLPFWTEELPSFEPFSLATSTGLGYSGAWMVSLALFGLIAWITLVVEKRTKAPKMAPVSSEK
    GWKRIFRGSWPLFAAAIVLGVLNALTLVTRGQPWGITSAFSLWGSKIANAFGVDVASWGYWQGANAAALNASIFADSTTV
    LNIGIIIGAFIASAAGGLFKFTTITKGNFAASVIGGLMMGYGARLAFG
    CNIGAYFGGIASFSLHGYIWGILAMAGTFLAL
    YLRPLFGLSVPKSSDSVC

    >gi|71065890|ref|YP_264617.1| soluble pyridine nucleotide transhydrogenase [Psychrobacter arcticus 273-4]
    MGSKTIGDATNDTGKDTETEVSNKESGRVLNPEHTEGKNKKERVEQTHEQVNDDIMHHPDLVNPLDDTRIDVKSGFTKDS
    QRLKSDKHEFEYDAVVLGAGPAGEAAAMKLAKSGKKVVVIDPREQVGGN
    CTHVGTIPSKALRQSVFNLINFRRDQMFTKA
    MDYHQVPLNIVLAKARKVILQQVQTHTRFYERNQIEVIHGWANFIDKNTIRIEIDENTFETITFNKAIITVGSRPYRPDI
    LDFDHPRVFDSDKILQMDYVVKKIIIYGAGVIGCEYASIFTGLGYKVDLINNQNQLLSYLDSEISDAIAHDFRQFGVVIR
    SNEEIDHLETHDDCVILHLKSGKKIKSDAILWSNGRSGNTEGLNLECLGLKANSRGQLKVDDTYCTEVENIYAAGDVIGW
    PSLASAAYDQGRCAAAFMVGDRDAEPVSSVPTGIYTIPEISCIGKTEQELTDAKVPYEVGQAFFKHLARAQIIGERSGVL
    KILFHRETLEILGIHCYGNHASEIIHIGQAVMKCNATLEYFVNTTFNYPTMAEAYRVAALNGLNRVF

    >gi|71065921|ref|YP_264648.1| hypothetical protein Psyc_1366 [Psychrobacter arcticus 273-4]
    MRYQNTYAQLDTRLYHEQLPNPLDNPRAGHFNNQVADQLGWTKAADLMARWVEILGGQYVPAEFQPLSMAYAGHQFGQWA
    GQLGDGRGLLMTQVLDKNNQLQDLHLKGAGLTPYSRMGDGRAVLRSTIREYLCGHALTQLGIASSNALGFVVSDTKVRRE
    RLEAGAALMRVADSHIRLGHVEWIASFAPDLLAEFTDYMIDTYYPECRDSEKPVLAFLQAVVERTARMIADWQLIGFAHG
    VMNTDNLSITGSTLDFGPFGFMERFNPAWINNHSDHSGRYAYQNQPAIGHWNLNVWLPHFMRLTQAGVTRETLADCLAPY
    EATFMQHYQQGLCRKLGLPHQRESLSLAFEWLTLLEDNLLDYTNSFRALLGLIAPNEHLYEQQLLATMTAELNPEAQQVW
    QVWSTRYLAQIQQVSITQAIEEMQASNPIYILRNSMAQRVIVAAEQGQFEELNRVFDLLAKPYTLQDSAIELDTLPPAPH
    APQMPIS
    CSS

    >gi|71065947|ref|YP_264674.1| pyridine nucleotide-disulphide oxidoreductase [Psychrobacter arcticus 273-4]
    MIKKIVLIFAVLIGVIGFFYFDLNELLTLEGLKGSMDQFEQYKTQSPWLVIGGFFVVYILVTALSLPGAVILTLAAGALF
    GLVQGILVASFASSIGATLAFLTSRYLLRDTIKQRFPDRLASIDSGVKKEGGFYLFTLRLVPIFPFFLINLLMGLTAIKV
    RTFYWVSQIGMLAGTFVFVNAGTQLAKIEQLSGILSFNLLASFALLGLFPLIAKGILTILKKRRIYKNHTKPKKFDRNMI
    VIGAGAGGLVTSYIAATVKAKVTLIEAGEMGGD
    CLNYGCVPSKALVKSAKVVEQIRHGKRYGLNNTQPDFAFKNIMSRIH
    EVIADIAPNDSVERYTSLGVEVLKGYAKLIDPWTVEIALNDGGTQTLTARSIVIATGARPFVPDLPGLEETGYVTSDTLW
    DKFAKFDKVPSKLVVLGGGPIGCELAQSFARLGSAVTQIERGARLMKKEDVDVSVFAQEALTESGVNILTSQQAIRCETR
    NGKKYIIVAPKGGNDDQQETAIEYDELICAVGRSARLEGYGLDTLGIDTERTISTDEYLETLYPNIYAAGDIVGPYQFTH
    VAAHQAWYAAVNGLFGHLKKFKVDYRVIPWSTFIDPEVARVGLNEQEAINKGIDFEITRYDFKDLDRAVTESANHGFIKV
    ITPKGKDKILGVTIVAEHAGDLMAEFVLAMKHNLGLNKILGTIHIYPTWAEGNKYAAGEWKRNHAPKKALQLLEKYHTWR
    RG

    >gi|71065949|ref|YP_264676.1| hypothetical protein Psyc_1394 [Psychrobacter arcticus 273-4]
    MTEFTLYDKTTAPEASQASLDNSIKAFGSIPNLHATMSEAPGLLEGYQRLHQLFLDSSFDAEETTVVWQTINVEHECHYC
    VPAHTGIAKSMNVDDSITDALRNETSLPTAKLEALRTFTLAVVRNRGNVDDESVQDFLDAGFSKRQILEVVLGTAQKIMS
    NYTNHLAKTPIDKPFEKFAWQKTD

    >gi|71066034|ref|YP_264761.1| HesB/YadR/YfhF family protein [Psychrobacter arcticus 273-4]
    MIEMTERAAQHVREFLDNRGKGEGIRVGIRTAGCSGLAYVLEFVDIPDENDTRYESLGVSIFIDPKSLVYLDGLLMDYEK
    EGLNEGFKFSNPNQKGECGCGESFTV

    >gi|71066109|ref|YP_264836.1| rhodanese-like sulfurtransferase protein [Psychrobacter arcticus 273-4]
    MDRALEFVGNHPFLFGILAVLAVLFFAIENKRSGKKISPNTLGMMVNSQNAQLIDIRAKKKFVTGYIQGSRNIPFTELKD
    RIEEIRAIEQPVIII
    CDMGVQAGAAIQMIGKENVYRLEGGIGGWQGAGMPLVGIKDAKPKSKMKAKPSLHK

    >gi|71066110|ref|YP_264837.1| glutaredoxin [Psychrobacter arcticus 273-4]
    MTVSVKVYTTPICPYCSNAKQLLKSKGVDYEEIGMHDMSSDDRRALMQKTNNYRTVPQIFVGETFVGGFDELNQMNQQGK
    LDELLAG

    >gi|71066115|ref|YP_264842.1| periplasmic protein thiol:disulfide oxidoreductase DsbE [Psychrobacter arcticus 273-4]
    MTQSNKSPQKSPEKKGKQTMKKSQIRIWFLIPLIIFAAFIVMLYFRLGQPTDIVTNTALERPVPAFELPLLSDTSRIMTN
    DNLPDQPFLMNIWGSW
    CPTCIIEHPFLMQLEERGVNLVGVNYKDDIGDALGYLNRGGDPFSMSIQDLSGQFALDLGLTGA
    PETFVVDGEGVIRQHIVGEINESNWQSRIRPCLMVLNEADKSNVSPDPDQVKEACK

    >gi|71066142|ref|YP_264869.1| copper/silver efflux P-type ATPase [Psychrobacter arcticus 273-4]
    MNPNNSDKKNGHSGQESMNTNQTRTTFKEYNQVPSDYNGTVYTCPMHPEVRDVEKSDCPICGMFLKPEGEVADEDSHSHC
    HGKDTDRTKVKSVKGGKYDKVPVGYSGTVYTCPMHPEVRDVENSGCPICGMALESETATIGEEDTSELDDMTRRFWICTV
    LTIPLFLYAMSDMVGINLDNLGQGSISGQIAQWIQLALATPVVLWGAAPFFVRGWQSIKSRNLNMFTLIAVGVGAAFGFS
    LVATFLPDIFPDSFRDATGQVGVYYEAAAVIVTLVLLGQVLELKARSQTSGAIRALLELAPPTARRVDENDVETEVSLDE
    VISGDRLRVKPGEKLPVDGTVLDGSSSIDESMVTGEPIPVLKAQGDTVTGGTVNGTGTLLIEAVDVGEDTVLSKIVKMVA
    EAQRSRAPIQRLADKVAGWFVPIVMLCSVVTFIVWAMFGPVPAMAYALVNAIAVLIIACPCALGLATPMSIMVGTGKGAQ
    HGVLIKNAEALESMEKVDTIVVDKTGTLTAGKPELTAIEALGSIDEDELFVLVAAVESASEHPLAEAIVKAAKEKSLDIA
    KASDFSSTTGEGAQALVNGKQVAVGNSKFMQRLDSFDSSLSERADKRRKDGETVMFVAVDGRAAGLISVADPIKPSTSEA
    ISLLHKAGLRVVMLTGDNEITARAVASKLNIDEVHADVSPEDKNRIIKELQSSGQIVAMAGDGINDAPALAQANVGIAMG
    TGTDVAMESAGITLLKGDLMGIVRAHKLSRSTMRNIKQNLFFAFIYNALGIPLAAGVLYPVFGLLLSPMIAAAAMSFSSV
    SVIGNALRLRRLKL

    >gi|71066192|ref|YP_264919.1| copper(heavy metal)-transporting P-type ATPase [Psychrobacter arcticus 273-4]
    MNDSTRTDTDNSYNVETDIQSNTPLAPERAHLQLAIDGMTCQACASRIEKVLNKKPSIYEVSVNFAGETANVDYDPTQTT
    AEQVTEWVNKTGFVANLQAADSLFAQKDEDTSTQYPWRLIGLWVCLVPFLVGMAGMLVGQGMAWMPPIWIQFILATIVQF
    GFALPFYKSAWASIKGGLANMDVLVVIGTLTIWAYSTYLWLTYGDGTLNSLLQSGHTGGHGVSGSPAVYFEAGVMVIAFV
    RTGKYLEERTKKHSLNSIDLLLSLTPDEVEQQQPNGDFHNVALQEVQVGDILRAKQGSRVATDGTVIDGAGWCVESHLTG
    ESVPLKKEAGDELLAGALVENGSLLYRVNAKGSDTKLGDMVQALSDAQGSKANLARLADRVTAVFVPVVVVIALVTFGVT
    WWLTGMLDTALMHAVSVLVIACPCALGLATPAAIMAGMGVAARHGVWFKDAQSLEAAGNIDTVVLDKTGTLTIGKPTIVD
    EVMVDKSIMVDEVLQIAASVEAHASHPLATALVNAATARGLSLFDVSDISVVKGAGIQATIEGLGLIKVGTAEFANLVLP
    ELMPKVWQIASTVAISINDEALGAFALADDLKSDTPQAITALQDAGINVILMSGDKQSVVDHVAGQLGIEQAYGKMSPRA
    KASQIALLQTAGHKVAMAGDGVNDAPAMATADASFAMFEGTDVAQHSASARLMGESLMHIDAAQKIAQATVRNIKQNLFF
    AFIYNCLGIPLAAFGFLNPMIAAAAMALSSISVLMNALRLTRFKTKVELNNTVSASNTDKNRSVQG

    >gi|71066193|ref|YP_264920.1| putative MerP, periplasmic heavy metal binding/chaperone protein [Psychrobacter arcticus 273-4]
    MANQTRIIKIDGMTCGGCVASVHNATADIDGLDDISIELADNQATVTFDDSKTSVETIAAAIDDAGFDATVANA

    >gi|71066248|ref|YP_264975.1| glutathione reductase [Psychrobacter arcticus 273-4]
    MTKHYDYIAIGGGSGGIASINRAASYGKKCAIIEANQLGGTCVNLGCVPKKVMWYGAQVAEAIHKYAPDYGFDVEFKGFD
    FQKLVNSRQQYIENIHRSYDNNLAKNGVEVIKGFAKFVDTNTVEVNGELITADHILIATGGHPIRPDIKGTEHGIDSDGF
    FALNELPKRVAIVGAGYIAVEIAGVLNSLGAEVHQYVRQHSPLRSFDHSIVETLLIEMEQDGIQLHTNTTLTEVVKNDDG
    SLTLCTESGSLDTVDCLIWAIGRAPSTDNINLQVTGVETTEFGKIKVDKFQNTNVKGIYAVGDIIENSVDLTPVAIAAGR
    RLSERLFNNKPDEHLNYELIPTVVFTHPAIGTIGLSEIDAVNQFGKDNIKCYSSTFTPMYSAVTQHRQKCMMKLVCLGDD
    EKVIGLHGIGFGIDEMIQGFAVAIKMGATKADFDNTIAIHPTGAEEFVTMR

    >gi|71066344|ref|YP_265071.1| thioredoxin [Psychrobacter arcticus 273-4]
    MSEQNSHIVCPHCYATNRVPDARLSAAPNCGKCAKPLLTATPHELNAKTLSNIIQKNEVLTVVDFWASWCQPCLMMAPEF
    KTAASQLPQVVFAKIQTDKYEQAAAPYNIRSLPTMVAFKNGKEIARQSGALPSHQIVQWVQSLK

    >gi|71066350|ref|YP_265077.1| alkyl hydroperoxide reductase subunit F [Psychrobacter arcticus 273-4]
    MIDQSLLDAVKSYSANMTRPISFVLGSGEHSKRAELVDFLTKIAGTTDKINFDAQANDDTLPSPISFKVINHIDGALMDT
    GIVFSGIPGGHEFTSLILAILQAGGHTLKLDEGIQKLIKRFNKPLQFQTYVSLS
    CHSCPEVVQALNQFALLNDDISNEMI
    DGALFQEQVEANNIQGVPAVFLNGKPFANGLIDTAKLIEKLQEQFPDLLAEADDDAEQLEQQDVTIIGAGPAGVAAAIYT
    ARKGLKVTMVADRIGGQVKDTQDIENLISVPLTTGSELSANFEKHLREYNITLKEHVSVKEISETADENYSIHLNTGETF
    ETRSIILATGAQWRKLGVAGEEENIGKGVAF
    CAHCDGPFFKGKDIAVVGGGNSGIEAALDLAGIVKHVTVLEFADDLKAD
    QVLINKAKEKSNIDIITSAATQEIKATDGKVSSLVYQDRNSNDNKELDVAGVFVQIGLIPNTEFVKGFIDLNRFGEIEID
    ERCRTDRKGIFACGDVTTVPFKQINIAMGEGSKAALSAFEYLVMQ

    >gi|71066352|ref|YP_265079.1| putative alkyl hydroperoxide reductase, subunit C [Psychrobacter arcticus 273-4]
    MASIINQEIPEFSAQAFVNGEFKTITSEDVKGSWAIFLFYPADFTFVCPTELEDMAAHYEELKGLGVEVYSVSTDTHFTH
    KAWHDSSEAIGKVTYPMIGDPTGRITRGFNVMIEEAGLAERGTFLVDPDGLIQVAEIHAGGIGRSAKDMLRKVKAAQYVR
    ENDGEVCPAAWEAGQETLKPSLDLVGKI

    >gi|71066467|ref|YP_265194.1| carboxymuconolactone decarboxylase family protein [Psychrobacter arcticus 273-4]
    MSKSFDDITKHVSTNMAKLHKHIPETTKAFSQLGAAATADGVLDKKTKELIALALAVGARCDACIGFHTKTLVKLGATEQ
    EVAETLGLCVYMGGGPSMMYAAEAIAAFNEFSKES

    >gi|71066505|ref|YP_265232.1| peptide methionine sulfoxide reductase [Psychrobacter arcticus 273-4]
    MQTIILGGGCFWCTESVFLSVKGVESVISGYMGGNAVSANYEAVCGGDTGHIEVIKVKFNESTVPLEVILDVFFATHDPT
    TMDRQANDVGSQYRSVVFYTDETQKPTVDRTINKLRDMGINIVTEVHPAVEFYQAEDTHQDFFNRNPGQAYCNFAIPPKL
    AKLRKEFSQYMVS

    >gi|71066543|ref|YP_265270.1| thioredoxin [Psychrobacter arcticus 273-4]
    MSDLIINTTDANFDQDVLQSDVPVLVDFWATWCGPCKAIAPILEDLATEYQGKVKIVKVDVDNNPQAASRFGIRNIPTLF
    VFKGGEKVDSVMGLQPKAELAKVLDKHL

    >gi|71066661|ref|YP_265388.1| Na(+)-translocating NADH-quinone reductase subunit D [Psychrobacter arcticus 273-4]
    MADTKSILTSPIFDNNPIALQILGICSALAVTTSVANALVMSVALTLVTAFSSFFISIIRKQIPSSIRIIVQMTIIASLV
    ILVDQILKAVAYDVSKGLSVFVGLIITN
    CIVMGRAEAFAMSNPPIPSFLDGIGNGLGYSTVLLFIASIREILGAGSWFGI
    TILQTATDGGWYVPNGLLLLPPSAFFIIALFIVIIRTWKPDQVEDAEFVMKPQSKGMAQGGGH

    >gi|71066662|ref|YP_265389.1| Na(+)-translocating NADH-quinone reductase subunit E [Psychrobacter arcticus 273-4]
    MGHYVSLFITSVFIENMALAYFLGMCTFLAVSKKVSTAIGLGVAVVVVMAITVPLNNLLFQFILKDGALAWAGFPDIDLS
    FLGLLSYIGLIAATVQILEMFLDKFVPSLYNALGVFLPLITVN
    CAILGGVLFMVERDYNFGESVVYGVGAGFGWALAITA
    LAGIREKLKYSDIPAPLRGLGITFITVGLMSLGFMSFGGMSI