Pseudoalteromonas haloplanktis TAC125 uid58431

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|77359039|ref|YP_338614.1| glutathione peroxidase [Pseudoalteromonas haloplanktis TAC125]
    MHKFHQLSATSLQGNTINFSEFAGKVVLIVNTASKCGFTYQYESLQALHNKYASQGLVILGFPCNQFNQQEPGDAQQIEQ
    GCLINYGVNFLMAAKVEVNGEHAHPVFRYLKSTQPGFLTRKIKWNFTKFLIAADGSPIKRYAPFTKPEKLELTIQKALQQ
    SNK

    >gi|77359090|ref|YP_338665.1| thioredoxin [Pseudoalteromonas haloplanktis TAC125]
    MSEKIIQITDDSFEADVLQSDKPVLVDFWAEWCGPCKMIAPILSEVAEEFDGRVTIAKLNIDQNAGTPPKFGIRGIPTLL
    LFKDGQVAATKVGALSKTQLIEFLENNL

    >gi|77359219|ref|YP_338794.1| disulfide bond formation protein [Pseudoalteromonas haloplanktis TAC125]
    MLKKLKLSLLLLCLPFAALAANFEVGNQYTVIDIEKSTTPQVTEYFSFYCPHCFKFEPVAHAIEENLPAGAVFIKNHVNF
    LGGVSPQTQSNLSLAYLVAKKHGQADTITDKIFKSIHVQRAPLTEIKDLKKLLDINGISSDTFDQDIASMPIIAAEQAMQ
    DKQNKYSKLGALTGVPTFIVNDKYKINLNTIKSQEELDELVSFLLAL

    >gi|77359220|ref|YP_338795.1| disulfide bond formation protein [Pseudoalteromonas haloplanktis TAC125]
    MIKLVKAGLLAVLLPFAATSFAATFEEGVHYEVVSERATKKPEVKEFFSFYCPACNNMEPLVAEIKPMLDKGVKFKKSHV
    DFVGVRDTEHQQMISQALATAEVLPQKDKIIAAIFSHIHTKRANFNELADVKDVFVAQGVDGDKFDKLFKSFSVRTLSSK
    MKRDQDYFKEKGALRGVPTFIVNGKYKLLLGRESGISEPADITKLINYLASK

    >gi|77359230|ref|YP_338805.1| thiol:disulfide interchange protein precursor [Pseudoalteromonas haloplanktis TAC125]
    MRFFFLLLVALLAAPAKANNILGDLLAPPQQTFLQVDQAFVFDFDQQDNTLFIGWDIAPEYYLYKNKIEIIAKGANIEVG
    DLGNGEVIEDEFFGKTEVFFNALSIVSKLSNVTEGAVVKVRYQGCAEAGLCYPPEVISIPLNKIAGEQLQNADDATHSAT
    SANAFTALSQANAPTSNAPKKDLTFTEQLASQGLITNLLIFFVVGVGLAFTPCVFPMFPILSSLIAGQKNLSTKKAFALS
    FVYIQGMAVTYAALGLVVAALGGQVQGYLQHPYVLISFSLLFVLLAMSMFGWYEIKLPSGMMNKLTQVSNNQKGGNYVGV
    FLMGVLSGLIASPCTTAPLSAALLFVAQSGDYLVGGLTLYVLSLGMGLPLLLLGTSGGKLLPKAGGWMEQVKTLFGFIML
    VVPLILLERLLDADVILLMAGVLALATALYLHHWQSSQTQGKLKTALWFAATLLVVSGFNLTKNYFWPVHMQTMQVSAQS
    NEFKQVANLTELKAAVAHANEQGRLVMVDLYADW
    CIACKEFEHYTFPDAKVQNEFSHFELIQVDLTDSDNKTIELMEEYT
    VFGLPSILFFNTQGEELSAQRVTGFLNAEDFAQHLSTVRASVK

    >gi|77359326|ref|YP_338901.1| glutathione reductase [Pseudoalteromonas haloplanktis TAC125]
    MAQHFDYIAIGGGSGGIASANRAAMRGAKVALIEAKHMGGTCVNVGCVPKKVMWHGAQVAEAINLYAPDYGFNVEVKGFD
    WGKLVESREAYIGRIHKGYDNGLANNGVTVIKGFAKFVDNKTVEVDGEHYTADHILIAVGGRPSIPNIEGAEHGIDSNGF
    FELKEQPKRVAVIGAGYIAVELAGVLHSLGTDTHLFVRKHAPLRNFDPYIIDTLVEVMAKEGPTLHTESVPHKLVKEDDG
    SVTLHLDNGKSHNVDQVIWAIGREPTTNAINIAAAGVEVNSKGFVKVDEYQNTTAKNVYAVGDIIENGIELTPVAVKAGR
    TLSERLFNKELPDDLKMDYSLVPTVVFSHPPIGTIGLTEQEAISQYGAENVKVYQSAFAAMYTAVTQHRQPCKMKLVCAG
    PDEKVVGLHGIGFAVDEMIQGFAVAMKMGATKADFDAVVAIHPTGSEEFVTMR

    >gi|77359333|ref|YP_338908.1| rhodanese sulfur transferase [Pseudoalteromonas haloplanktis TAC125]
    MDQYIEFITNHPILSAAWVGIVFLIVSGWIKSKLSAVRQINPQQLTLLINREDGQVIDMRAQKEFNTGHIAGAQHLSPEN
    AKKSDFSNLEKYKSKPIILV
    CTTGMTASGTATAMHKAGFEQVSVLSGGMGAWQSASLPTTTGR

    >gi|77359334|ref|YP_338909.1| glutaredoxin [Pseudoalteromonas haloplanktis TAC125]
    MSNVVLYTKAYCPFCQRARALLDSKGVQYTNFDIGVQPELRDEMIAKAGGASTVPQIFINDEHIGGCDDMMAIEAQGQLD
    KKLNATLNA

    >gi|77359359|ref|YP_338934.1| dihydrolipoamide dehydrogenase [Pseudoalteromonas haloplanktis TAC125]
    MSNELKTQVVVLGGGPGGYSAAFRAADLGLEVTLVESRDTLGGVCLNVGCIPSKALLHVAKVIDDAAAMADHGVTFGAPQ
    IDLDKIRSWKDSVIGQLTGGLTSMSKMRKVKVVYGYGKFTGSNTIAVEGTDGTTTITFDNAIIAAGSKPVSLPFIPEDDR
    VIDSTGALELKDIPEKLLVLGGGIIGLEMGTVYRALGSAIDVVEFADQLVPAADKDIVKIYQKYVSDKFNVMLSTKVTGI
    DAKDDGLYVTFEGKNAPAEPVRYDKVLVAVGRTPNGKLLDADKAGVNVDDRGFINVDKQLKTNVEHIFAVGDIVGQPMLA
    HKAVHEAHVAAEVISGQKHYFDPKCIPSIAYTDPEMAWVGVTEKEAKEQGLSIETAVFPWAASGRAIASARTEGSTKLIF
    DKESGRVIGGAMVGINAGEMLGEIGLAVEMGADGEDLALTIHAHPTLNESIGLAAEIYEGSITDLPNKKAVKKKK

    >gi|77359424|ref|YP_338999.1| 3-mercaptopyruvate sulfurtransferase [Pseudoalteromonas haloplanktis TAC125]
    MKNIITNEQLYTQLNDPTLILFDAGMLRPGITGNYVAKAVLPNAQRFDIKNELADRSNPLPNTLCSETQFTQAMQKAGVN
    HDSLVVIYEDAGLFSAARAWWMFKAMGFNNVKVLSGGLAKWLELGLPVESNYTQASLKGDFIAQYRPDYFIDKKQVLSAT
    KDANTVILDARAYERFTGKSSEPRAGMRSGHIINSYSLPLTSLLENGEAKSLDFIQAKFSELVGNATHLQFS
    CGSGVTAC
    ALALFADECGYSNLSVYDGSWSEWGADNSLPIAVGG

    >gi|77359449|ref|YP_339024.1| adenylyltransferase [Pseudoalteromonas haloplanktis TAC125]
    MNELSDKEMLRYSRHILLKEVGLAGQLKLKSASVAVVGAGGLGSPALLYLAAAGIGKLILIDDDAVELSNLQRQVLYKVN
    HLGQKKVVAAGKVLASLNNQITIITHAEKLTQDNSAALLNNADIVLDCSDNFTTRYSVNRFCVQHKTPLISGAALATKGQ
    LISLDLRNANSPCYGCIFPQSDIAPLIN
    CDNAGVISPLLGIIGSMQAQLTLNMLLSHSSDCVFMSINALTLQQQQFKVVK
    DIDCKECR

    >gi|77359473|ref|YP_339048.1| disulfide bond isomerase, periplasmic; chaperone; activated by DsbD; homodimeric [Pseudoalteromonas haloplanktis TAC125]
    MLCTSLSAVANDVAVAPNANDPIVIKFAALGVTVKQINPSPVAGLKELITNQGVLYASPDGQFLMQGTLIDLNNRSNLTE
    KALNGVRQAGLKEYEDSMIVYKAPNEKHSITVFTDIS
    CGYCRKLHRELDDLLEAGITVKYLAFPRGGLQGSGYNDLMNVW
    CAKDQQEALTEAKSGSNTTAVKGCSAPVAEHYQLGQSFGVTGTPAIILEDGTMIPGYQPAAALSAALNASKAP

    >gi|77359587|ref|YP_339162.1| glutaredoxin [Pseudoalteromonas haloplanktis TAC125]
    MKLVRWLLGSIILFFNFVFTPRSKKRAPEVQQQLDQQTAQFKLYQFKACPFCVKVRRAIKREGLKIETRDAKSNEQYRQE
    LLEQGGKVKVPCLRIEQNGQVTWLYESNDIIAYINKVAA

    >gi|77359708|ref|YP_339283.1| dihydrolipoamide dehydrogenase [Pseudoalteromonas haloplanktis TAC125]
    MKELQTDVVVIGAGTAGLSAYRNAKQFTNNVLMIESGPYGTTCARVGCMPSKLLIAAAEAAHSITMAPAFGVHSSAPRIN
    GKEVMARVKSERDRFAGFVVEAVDELPSDDKIRGYAKFLDANRIQIDDHTIITAKRFVIATGSRPSYPGVFNNFGDKLII
    NDDVFDWDDLPESVAVFGPGVIGLEIGQALHRLGVKVKLFGVGGAIGPLTDPVVKDYANTVFAEEFFVDTDSNVSNMMQV
    DNKAQLTYTDKQGAKHTEQFDYVLAATGRVPNTDKLGLENTGIELDERGVPIANAKTMQCGDSNIFIAGDASNMLPLLHE
    ASDQGLIAGQNAGRFPDVQPGLRRAKIAAVFSDPQIAMVGESYKEITTRLGSCDCFEIGEVSFENQGRSRVMLKNKGHMR
    VYAEQGTGLFLGAEFISPQAEHLAHLLAWAVQNKMTVPQMLEMPYYHPVIEEGLRTALRDLNAKLKFGPDIINHCMECGP
    GA

    >gi|77359709|ref|YP_339284.1| peroxiredoxin/glutaredoxin protein [Pseudoalteromonas haloplanktis TAC125]
    MLNNIEGKTIPSVTFATRQNDEWKSVTTDDIFKGKTVVVFSLPGAFTPTCSSTHLPRYNELAGVLKQNGVDEIVCLSVND
    TFVMNAWAEHQEAQNITLLPDGNGEFTDGMGMLVDKNDLGFGKRSWRYSMLVKDGVIDKMFIEPDLPGDPFEVSDADTML
    DYINPKQAKPEPVTVFTKPG
    CPFCSKAKALLTEKGFAFEEIVMGSGASLTSLKAVSGRETVPQVFIGGKHIGGSDDLEKY
    FA

    >gi|77359777|ref|YP_339352.1| thiol:disulfide interchange protein dsbE (cytochrome c biogenesis protein ccmG) [Pseudoalteromonas haloplanktis TAC125]
    MNRKLLAIAPLLVFAFICVFLFQGLFANPREIQTGRLGQSMPEFSLPDLMQDNKQWSNEQLKGEVYLLNVWGTWCPTCLA
    ELGYLTKLREQGVKIIGLYYVQGYDADFDGPFDMQALRSDVTNMLTRAGDPYQFNILDLHRTLSLDLGVSGAPETFLVDK
    SGTILLHHTGDINPRVWRAKFAPIMQELK

    >gi|77359786|ref|YP_339361.1| disulfide bond formation protein B (disulfide oxidoreductase) [Pseudoalteromonas haloplanktis TAC125]
    MNWLAQLPTQRTPWLLFSGIVFLLEITALFFQYKMGLAPCIMCIYQRTAVLGLLIAGIIGTSNPEHRGVRLLAYSVWAVS
    SVWGFIIAREHIEMQTTTDPFAFS
    CEFEPNFPAFMPLHEWIPSFFAATGDCGNIDWQFAGLSMPAWMEVIFALFAATLFL
    LVTSRLMTKRSL

    >gi|77359788|ref|YP_339363.1| peroxiredoxin 2 (thioredoxin peroxidase 1) (thioredoxin-dependent peroxide reductase 1) (Thiol-specific antioxidant prot
    MGVLVGRQAPDFTAAAVLGNGEIVDSYNLHEKIKGKKAVIFFYPLDFTFVCPSELIAFDKRYEEFQKRGVEVIGVSIDSQ
    FSHNAWRNTAVADGGIGKVKYALVADIKHEICKAYDVEHPEAGVAFRGSFLIDEEGNVRHQVVNDLPLGRNIDEMLRMVD
    ALAFHTEHGEVCPAGWTEGKKGMDASPEGVAKFLSENEGDL

    >gi|77359937|ref|YP_339512.1| glutaredoxin 1 [Pseudoalteromonas haloplanktis TAC125]
    MLTVIFGREGCPFCVRAKDVAEQLSNERDDFKFRYIDIIKEGISKEDLEKSAGKPCPTVPQIFVDQKHIGGFTEFEAYAK
    ENLGLYQ

    >gi|77359957|ref|YP_339532.1| copper transporting ATPase [Pseudoalteromonas haloplanktis TAC125]
    MSNNINSSSQNFIIEGANCGSCVAKIEKALKTVSGAQRVEMNFAQRTVQVEGQADEAALIAAVENIGYKAKPMSNDSEQD
    ALDEKAKADDAHYKKLMRNMILALGVGAPLMLYGLIFDMNVITTTQRIAWFIVGLATLAVMAVAGKQFYNGAWQAFKNHA
    ANMDTLIALGTGTAWLYSMVVVITPNLLPEVARHVYFEASAMIIGLISLGLALEVKARGRTSEAIKRLIGLQPKTARVIR
    DGQDRDIDISDVVKSDQVRVRPGEKISVDGEVLEGSSSVDESMLTGEPMPVTKQIGDTVVAGSINKTGTLLFKATHIGSE
    TTLANIINMVKRAQNSKPSIGRLADVISGIFVPTVMIIAILAGLAWLNFGPEPAIAYAVVAVTTVLIIACPCALGLATPM
    SVMVGIGKAAESGILIRNGEALQVTSKITTMILDKTGTITQGSPTVTDVITFNNSDENTVMQHVASLESSSEHPLAEAII
    SYAKALNLTLSKVTDFDALTGKGVIGTLDGQTLLFGNKALMDKYHVAIDDAYEQAQTLASEAKTPMYFAVNQQLQAIIAV
    ADPIKADSAAAIKRLQNKGIHLVMLTGDNQATAQAVAKKVGIKDFIAEVLPDDKVNEVIKRQAKGEIVGMTGDGINDAPA
    LAQADVGFAIGTGTDIAIESGDITLMRGSLHGLADAIAVSSATILNIKQNLFGAFIYNVAGIPIAAGLLYPFFGLLLNPV
    VAGAAMALSSLTVVSNANRLRFFKPAKS

    >gi|77360030|ref|YP_339605.1| peptide methionine-R-sulfoxide reductase, MsrB protein (PilB protein) [Pseudoalteromonas haloplanktis TAC125]
    MLKWNDVINFANNGNPTPPKKVIKTDAQWQELLSEDTYYVTRKKGTERPHSSGSCTLLEPGKYICICCDNLLFDADEKFD
    SGTGWPSFTKPATIEAVAYISDNTHGMQRIEAVCNVCDAHLGHVFPDGPLPTGLRY
    CVNAASMKKL

    >gi|77360043|ref|YP_339618.1| SoxR-reducing system protein RsxE [Pseudoalteromonas haloplanktis TAC125]
    MWVNNPALVQLLGLCPLLAVTSTITNALGLGLATLLVLVGSNISVSIVRNWVPKDIRIPVFVMIIAGFVTIVQLLMNAYT
    YGLYQSLGIFIPLIVTN
    CAIIGRAEAYASKNPVHLSAFDGLMMGLGFMIVLVVLGAMRELIGQGTLFDAADLLLGPWAQS
    LRIEVFSFDNQFLLAILPPGAFLGLGLLIAAKNVIDAQIKSKQVTPPEPEKGPRARVTSLT

    >gi|77360047|ref|YP_339622.1| electron transport complex protein RnfB [Pseudoalteromonas haloplanktis TAC125]
    MTLFYALIALGSLALVFGLILGFAAIRFRVESNPIVEQIDTILPQTQCGQCGYPGCRPYAEAIANGDEINKCPPGGEATM
    KKLAELMGVDPKPLAGGEQAEPIKTVAYIREDE
    CIGCTKCIQACPVDAIVGATRQMHTVLIDECTGCDLCVEPCPVDCID
    MLPVAETKQNWKWQLNAIPVTQID

    >gi|77360048|ref|YP_339623.1| electron transport complex protein rnfA, inner membrane protein [Pseudoalteromonas haloplanktis TAC125]
    MTEYVLLLIGTVLVNNFVLVQFLGLCPFMGVSSKLDTAIGMSLATTFVLTLASVTSYLVNQYILIPLDITYLRTMSFILV
    IAVVVQFTEMVVRKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNIKEDHSFLQSAVYGFGAAVGFSLVLVLFAALRERLAA
    ADVPTPFKGASIALITAGLMSMAFMGFTGLVKF

    >gi|77360065|ref|YP_339640.1| thioredoxin-dependent thiol peroxidase [Pseudoalteromonas haloplanktis TAC125]
    MNKISPLQAGDNAPAFSLQNQNDETITLSELLKQQQVLVYFYPRASTPGCTVQAENLRDQQAELAKFNTRVVGISPDPIK
    RLKNFETKKELNFDLLSDEDHAIADAFGIWGYKKFMGKEYDGIHRLTFLIGQDGKIKHLFDKFKTKDHHQVVLDYLAAE

    >gi|77360076|ref|YP_339651.1| arsenate reductase [Pseudoalteromonas haloplanktis TAC125]
    MSVTIYHNPRCSKSRETLALLQSKAIEPSIVEYLNTPLSSEQLTTLVKQLGFTSARELMRTKEDIYKTLNLKDETSEAAL
    INAMVQNPKLIERPIVVNNDKAAVGRPPENVLSVL

    >gi|77360081|ref|YP_339656.1| metallo-beta-lactamase superfamily protein [Pseudoalteromonas haloplanktis TAC125]
    MSEYLLPDEPVKQVYLDANATTPVLPCIVDVVCHAMQTCFGNPSSPHITGIQAKHLLEQTRQKARAVIGANNGDILFTSG
    ATEGIQTAVVSTLINAKTHNKKNPVLLYGATEHKAVPNTLKHWNQVLEINAQVLAIPVDSNGILDLDFIAQHIDDALMIC
    TMAVNNETGVYQDLAAIEQVIRNRNSSVSWMVDCVQALGKQQLMLSETTIDYAPFSGHKLYAPKGIGLLYIRQGSAYTAF
    IAGGGQESGMRSGTENLPGIAGLNKLFSLLLDKTDDTFKSSAVLAQYRSQLHNAISDTFGAITFNHDFAYSVPTTLNFAV
    NDLTSKEVIDLFDAAGIRVSGGSACSTGASQSFVLDAMGASQWQSENAIRLSFGPAATQQDIDHACERIRALKQVLQANC
    LVVSDSATPTQELCALGLTQFRHQGACSWLYVNSNNQAVIIDPIIELIPRFEKIANTQNLTITAILDTHAHQERNSAITL
    LRSVLAARLVAGEVDQLGWPVNQTVINLNGQRLEKLATPGHSQDSVSYLLKEASGEVRYCFCGDLILPAGLGNTHLLGGS
    AEQMSDSLILLAQQLTPEAVICSGHDYQQCFAMNWAVQQQQTPLLSALLSKQITKDEFAAKKQQHDEQKQTDNNNQLCGY
    VNAQPDTNTQQLSYSQAKEMLSHGNVYLIDTREPYEHGANNISSLLNVATAKTLNIPLSRMANAIVEQQLDKNNQYILV
    C
    RSGNRSKLAAANLIELGYTSVYNLNGGLALGS

    >gi|77360152|ref|YP_339727.1| periplasmic thiol peroxidase [Pseudoalteromonas haloplanktis TAC125]
    MFRSLIFALSAFSSVAFAADYTENTLDAGKVSAQGKPVTLLGKGVAVGDSAPEFKVVDANFTPVTLSAYKGQAVLISVVP
    SLDTGI
    CSLQTKHFNEKVAQQFPNITMLTISSDLPFAQKRFCKAENIDKVIVLSDSVWHDFGQKYGFIIKDMGLLTRAVL
    ILDKNHNVVYKQLVSNLATEPEYASVIEKLKAL

    >gi|77360159|ref|YP_339734.1| hypothetical protein PSHAa1216 [Pseudoalteromonas haloplanktis TAC125]
    METIDKIKQQISENPIILFMKGSPKLPNCGFSSQASQALMSCGEPFAYVDILLNPDIRAELPAYANWPTFPQLWVDGELV
    GGCDIIIEMFQRGELQPLITETAAKYKEADAE

    >gi|77360186|ref|YP_339761.1| methionine sulfoxide reductase A [Pseudoalteromonas haloplanktis TAC125]
    MSTVQTSENLHLESIYFAGGCLWGVQEFIKYLPGVVTTEAGRANGTNNNTQGEYDGYAECVKVTFDITAVTLYKLIEYFF
    EIIDPYSVNKQGNDVGLKYRSAIYSKQQCHLTIANDYINQRADADKIVVQVQLLTNYVPSDAEHQDRLTNFPDDYCHIPP
    ELLHKYKSK

    >gi|77360196|ref|YP_339771.1| glutathione peroxidase [Pseudoalteromonas haloplanktis TAC125]
    MDSIYQFNAECCNKALFSFKQLKGKTLLIVNIASECHFSAQLTALEKLYQQYKNSGFTILAFPCNQFGQKEPLDNLAINS
    FYQAQFNTTFEIFAKVMVNGPEAHPLFNYLKLHTRGISQGRVIKWNFTKFLINSQGQLVSRYAPRTKPETLKQAIENQLL
    LTAK

    >gi|77360275|ref|YP_339850.1| thioredoxin-like domain-containing protein [Pseudoalteromonas haloplanktis TAC125]
    MITLYGISNCDTIKKAKKYLTDNNIEFTFHDYRKDGVNESMVSNFADKLDWEQLVNKRGTTYRALSDDEKQSLTREKAIP
    LLVEQPAMIKRPVLVNNNEYHLGFKAAQYDEIFK

    >gi|77360376|ref|YP_339951.1| hypothetical protein PSHAa1433 [Pseudoalteromonas haloplanktis TAC125]
    MTAVHKDNLTSEHFIVCALYKFVALPEFEALRKPLLDVMEANEVRGTLLIASEGINGTVSAKRAGIDNLLKWLEQQPSLN
    NIVTKESYDDECPFYRTKVKLKKEIVTMGVEGIDPLKVVGSYVKPNEWNALISDPEVILIDTRNDYEIEIGTFQNAVDPN
    TKTFREFPQWAKENLDPSKHKKVAMF
    CTGGIRCEKSTAYMKEQGFDEVYHLEGGILKYLEEVPKDETMWEGECFVFDNRV
    AVNHDLQKGSYDQCHACRMPITEDEKLKAEYMEGVSCHHCIDNVSDEQRERFAERQKQIELAQARGEGHIGNEAQAILQQ
    RKEAKNAKKQAQRSK

    >gi|77360387|ref|YP_339962.1| secreted protein-methione-sulfoxide reductase with methionine-S-sulfoxide and methionine-R-sulfoxide reductase activity;
    MSYQGLIYLSSVAILFSASSVALSMEKVVQSNVQATMHVETLVLGSGCFWGAEKRYEALNGVIDAESGYADGNGFKATYS
    NITSQSRRFDEDNYAEVVQVTYNSNIISAKELLENYFESHDPTQKNRQGNDVGTQYRSIILTTTTEQAQVAKQVKSQYQQ
    LLTQAEYGTIATIIKPLDTFYAAEEYHQNYLEKNQNGYCPDHSTGVVFNKKPPEQVDNSALLMGKQIVVLDSREYCPYCE
    KFKSAVANDYKGSIAMSFRHADQLQGLTIKSATWATPTILFLENGTEVYGRQGYASPEAFYKALGAFKLGDSEAYKVAFN
    SKTDRAYCKEYKIFKNTPDGTFVDKLSGEPLFDTRDRFNSGTGWLSFTHPIKSSVTEHDDSSWGMTRIELRSKSTGIHLG
    HLFPGEGPRGTDRY
    CINATVLEFIPRD

    >gi|77360524|ref|YP_340099.1| peptide methionine sulfoxide reductase msrA 2 (protein-methionine-S-oxide reductase 2) (peptide Met(O) reductase 2) [Pseudoalteromonas haloplanktis TAC125]
    MRLTNKNEIRFTNSGSSNYTNIFIYTFIKQMRDFMKRILALALTSSVIFYASLAHANKTEKAVLAGGCFWCMESDFEKLA
    GVTDVISGFTGGKLKNPTYNGNHRGHYEAVEITYDPAIVSYKAILEHYWVNIDPFDAKGQFCDKGPSYLSAIFVANEQER
    KLAVQSKQAVSKQFPNKTVVTPILNTSTFYPIKGDESYHQDYYKNNPIRYNTYRWRCGRDNRLEEIWGDKASH

    >gi|77360660|ref|YP_340235.1| thioredoxin reductase, FAD/NAD(P)-binding [Pseudoalteromonas haloplanktis TAC125]
    MTEAKHCKLLILGSGPAGYTAAVYAARANLNPVLITGMQQGGQLTTTTEVENWPGDAHGLTGPALMDRMKEHAERFETEI
    IFDHINKVDVSKRPFTLTGDQGTYTCDALIIATGASAKYLGLESETNFQGRGVSA
    CATCDGFFYKGQKVAVVGGGNTAVE
    EALYLSNIADEVHVIHRRDSFRSEKILADRLAEKAANGNVVMHYNRTLDEVLGDQMGVTGVRIKDANSDATEELDLAGVF
    IAIGHKPNTDMFVGQLEMKDGYIIVESGLNGNATQTSVPGVFAAGDVSDHIYRQAITSAGTGCMAALDAERFLDNL

    >gi|77360771|ref|YP_340346.1| AhpC-TSA [Pseudoalteromonas haloplanktis TAC125]
    MSLKAQIDAYNVQKEAKLPADVLALMNTTNAELIAQHIKDNALQVGQKVTNFSLANHQENTVELATLLKQGPVIISFYRG
    GW
    CPYCNLELKALNDYLPQFKAQNAQLIAISPQLPDETLSTAQKNDLEFDVLSDVSNKIAKQFGLLFTLDERIQALYTEF
    GIDFEHYYGDKSFQLPLPATYVINQQGVITYAFVTEDYTLRAEPFDVLNALKSESK

    >gi|77360787|ref|YP_340362.1| cation transport ATPase, E1-E2 [Pseudoalteromonas haloplanktis TAC125]
    MSINCFHCLESVPNGFSAHVVIDNKSQPMCCIGCQAVAQNIIDQGMTDYYKYRTVQAGKVEQLVPEQLAFIKSYDNEDIQ
    DEFITTNDNFSEVLLSVEGIT
    CAACAWLIEKQLLSLKTVKRVDVNTSTNRAMVQWDKTATPLSEIITSLAKIGYKAYPFQ
    SDLEAQQKQQTAKAYIRRLGVAGLMTMQVMMFAFAMYFGMFSGMDSNFEEYFRWISLVLASPVILYSALPFLSNAINGLK
    AKQLNMDLPVSLAIFGAYGASSYATIMNVGEVYFESVCMFTFLLLLGKYLEFRARLKASEFTANLQKLLPLTARTLDANG
    QEHIIAAKKLKLNDIILIKAGETIPADGILIKGKTSVDESMMTGEHLPVNKFINHSVYAGTVNHDGIIEIKINKIGQSTL
    LNQIIRLQHNALSKRPKLVEITDKVAQWFVAVLLIFASITAFGWYQIAPEQAFWITISVLVATCPCALSLAIPTALTCSV
    ANLTRKGILIKQAHVLETLSKITLFAFDKTGTLTQGRFSLDAVDILSEEYTKNQVLEIAAQLESYSEHPIARAFSQYKVP
    GHKLNDIQLHPGKGISAQYNDTHYAIGKSGWFNSKKTNAQATLYINQQPIARFYFVDKIKDDASTLINALHTHKLTCHML
    TGDASDAGQRIAKKLKLHSVQSGCSPKDKQTAVEQWSTQGEVVAMVGDGVNDSPVFASAHLSIAMETGADISKNSADVVL
    LNSDLASIEHLLIVAKKTRRIIKQNLTLSLLYNGSILPLAAMGLVAPWMAVIGMSTSSIIVICNSLRLLKL

    >gi|77360865|ref|YP_340440.1| hypothetical protein PSHAa1933 [Pseudoalteromonas haloplanktis TAC125]
    MRQKVSFKSGDLKLAGQLELPSGEIKFYALFAHCFTCGKDIAAATRISRALTQQGIAVLRFDFTGLGNSDGDFANSNFSS
    NIQDLVAAANHLREHFGAPQLLIGHSLGGAAVLAAAEHIPEVSAITTIGAPSDAQHVAHNFKAHLDEINAAGEAKVNLAG
    REFTIKKQFIDDIAKYDKSHISKLKRALLVMHSPIDATVNISEAEKIYASAKHPKSFISLDNADHLLTNKNDADYAADII
    ATWANRYVNYDKTKYTAKLNNGSVLVEEKDHVFTQHVSTKEHTWLADEPLKAGGHNLGPDPYEHLLAGLGA
    CTSMTLRMY
    ASHKKLPLEHVKVELEHTRDYNKQDGDAEQGVEAITRKITLTGDLTPEQRARLLEIANKCPVHKTLHNNPLVISELVE

    >gi|77360924|ref|YP_340499.1| hypothetical protein PSHAa2000 [Pseudoalteromonas haloplanktis TAC125]
    MVTEFTPVSAAIGGALIGIACTLLLVLYGKIAGISGIVKSVFAKANSGSRWQLYFILGLLLAGVAVRVFAPSLLEAELQL
    SPWLIIVAGLLVGVGTTLANG
    CTSGHGVCGMSRFSTRSWVATCTFMLVAIITANLVG

    >gi|77361125|ref|YP_340700.1| osmotically inducible protein C [Pseudoalteromonas haloplanktis TAC125]
    MITIKKSANSKWSGDIKTGKGSISTQSGALNNQPYGFNTRFEDKPGSNPEELVAAAHSACFSMALSLALGEAGFTADNID
    TKAVVSLDEVDDGFAVTHIALEVNAKIADIANEQFQALCEQTKKG
    CPISKLMNAEISLTANLL

    >gi|77361160|ref|YP_340735.1| Na(+)-translocating NADH-quinone reductase subunit E [Pseudoalteromonas haloplanktis TAC125]
    MEHYISLFVKAVFIENLALSFFLGMCTFLAVSKKVTTSIGLGVAVIVVLGISVPVNNLVYHAVLAPGSLTWLGYPDADLS
    FLRFLTFIGVIAALVQILEMALDKFFPALYNALGIFLPLITVN
    CAIFGAVSFMVERNYNFGESVVYGIGAGVGWALAITL
    LAGIREKMKYSDVPDGLRGLGITFITVGLMALGFMSFSGISL

    >gi|77361161|ref|YP_340736.1| Na(+)-translocating NADH-quinone reductase subunit D [Pseudoalteromonas haloplanktis TAC125]
    MADTKEMKAVLFGPVLANNPIALQVLGICSALAVTSSLKNALIMSIALTLVTAFSSFFISTIRNQIPSSVRIIVQMTIIA
    SLVIVVDQVLQAFSYATAKELSVFIGLIITN
    CIVMGRAEAYAMKSPPLMSFLDGIGNGLGYSVVLLTVGFIRELFGKGSL
    FGVDIIPLVQNGGWYQPMGLLILPPSAFFIIGLFIWVLRTYKKDQVEAKA

    >gi|77361174|ref|YP_340749.1| HesB/YadR/YfhF protein [Pseudoalteromonas haloplanktis TAC125]
    MSEELPIKFTDAAADRVKQLIDEEENPELKLRVYVTGGGCSGFQYGFTFDEKANPGDLEIVKNGVMLVVDPMSLQYLVDG
    EVDYTEGLEGARFFVTNPHATTTCGCGSSFTI

    >gi|77361197|ref|YP_340772.1| protein-methionine-S-oxide reductase (peptide Met(O) reductase) [Pseudoalteromonas haloplanktis TAC125]
    MSSTTQVATFGGGCFWCIDAAFRRVNGVLNVSSGYTGGNTDTPTYKSVCSGTSGHAEVVQIEFDDTIISFEVLLAMFFTL
    HDATQLNRQGNDIGTQYRSVVYYHNQTQLTLTNAVIAQLQNQVSEPIVTEVSPATTFYPAEHYHQDYYNENPEQGYCSIL
    IAPKLHKFETEFSEFLSE

    >gi|77361203|ref|YP_340778.1| thiamine biosynthesis protein ThiI [Pseudoalteromonas haloplanktis TAC125]
    MLKFIVKLHPEIAIKSRSVRKRFTKVLENNIKIVLRRIDEKVQVRNNWDNISVVTLLEGEQTRATFIDSLARIPGIVQFI
    EVTETSFETLDDIYKKTIELVGHTIEGKTFCVRAKRIGKHDFTSTELERYVGGGLNQHVAGASVKLSHPEVTIRLEIKDE
    KAYIVSHTHLGMAGFPLPTQEDVLSLMSGGFDSGVASYQMIRKGARTHFLFFNLGGAAHEIGVKQASYYLWNKYSSTHKV
    KFITVDFEPVVAEILENIENSQMGVVLKRMMMRAGSKVAEKLNIQALVTGESIGQVSSQTLANLSVIDRVTETLILRPLI
    QHDKQEIINIARQIGTAEMAETMPEYCGVISKKPTVKAKIEVIKAEEEKFDFDILNTVIENARVMDVRDIDVEAKQELKE
    AESVADLPAGAVVIDIRSPEEEEAAPLEIDSIEVVHLPFFRLATKFGDLPKDQDYYLY
    CDRGVMSQLQALILHEQGFTTV
    KVYRP

    >gi|77361237|ref|YP_340812.1| thiosulfate sulfurtransferase [Pseudoalteromonas haloplanktis TAC125]
    MAFKHISIAQTLELLDKEDVVIADIRDPNSYQAGHIPGSEALSNANIAHFMMEKEFDQPIIIVCYHGMSSQGAASYLVEQ
    GFEDVYSMDGGFTAWEAAYSEKVER

    >gi|77361259|ref|YP_340834.1| thioredoxin-like protein [Pseudoalteromonas haloplanktis TAC125]
    MVLLNFYSAQSPECINQAAILDKLAAEYNDYIVVANLDCDAEQALASQLAQQVGLQTLPTLVLLKDSAPVDVLSGAQAEA
    KIREALAKHLPAQQDLLLEQAKQALLKSDLNAAFNYAKQAYEIDNSNARIKLVLADICIQIHKVDEAQALINTIDVQEQD
    AYFNNIKAKCEAALEAKDSPEIKEKQQQVEKYPNDLELKEELSILLNEAGRKEEALDVLFTVLQKDLNFNEAKPSFLAII
    ASLPDGDALAAKYRRKLYSILY

    >gi|77361402|ref|YP_340977.1| glutathione peroxidase precursor [Pseudoalteromonas haloplanktis TAC125]
    MIKIILLALMALLLPTLAQAQSTAEHPIKKQNNCQDFTNVTLRKLRSKEFVNLCQFENQPLLIVNTASNCGFTPQFAGLE
    AVYNKYKDQGLVVLGFPSDDFFQEENNEQDTAKVCFVNYGVTFTMFATSAVRGSDANPIFKHLNSQTSSPNWNFYKYLVS
    ADRKTITRFNSKVAPESEKLTAAIEATLAIN

    >gi|77361442|ref|YP_341017.1| stringent starvation protein A [Pseudoalteromonas haloplanktis TAC125]
    MAVAANKRPVMTLFSGANCMYSHQVRIVLAEKGVSVDIHLAEKDNLPEALHEINPYGTVPTLIDRELGLYQANIIMEYLD
    ERFPHPPLMPVYPVMRGRSRLMMHRIDTDWYSLADKITNNAPDAAQARKELTEALLAVAAIFSEAPYFMSEEFSLVDCYL
    APLLWRLPEFGIELNGAGSKELKEYMIRLFERESFQASLTETEREIRL

    >gi|77361565|ref|YP_341140.1| peroxiredoxin AhpC/Tsa [Pseudoalteromonas haloplanktis TAC125]
    MIVQGQTIPSVTLSQLTDDGMQTLTNSELFADKKVVLFAVPGAFTPTCSNAHLPEFITLADKIKAKGVDAIYCVSVNDAF
    VMKAWGASQNAQKIAMLADGDASFTKALGLDMNTAGFGGVRSKRYAMIVENSVVTGLFVEQEKEFVVSRAAAVLEKL

    >gi|77361584|ref|YP_341159.1| Fe-S cluster assembly/activation protein [Pseudoalteromonas haloplanktis TAC125]
    MAVTLTDAAANRVQSFLANRGKGLGLRVGIKTTGCSGLAYVLEFVDELNDDDETFVAKGVTLIVDAKSLVYIDGTQLDYT
    KEGLNEGFKFTNPNQADECGCGESFTV

    >gi|77361740|ref|YP_341315.1| hypothetical protein PSHAa2836 [Pseudoalteromonas haloplanktis TAC125]
    MLTSIPDLLKTIIPNQRRIGAQQAKQELEGNKGLLIDVREPAEHANKAAVGAINIPRGLLEMKLMEIEKDATRPIYLHCA
    SAARATLGAEALTRVGYENVTVITCNAEEICSVF

    >gi|162139921|ref|YP_341375.2| soluble pyridine nucleotide transhydrogenase [Pseudoalteromonas haloplanktis TAC125]
    MTYQYDAVIIGTGPGGEGTAMNLSKNNKKVAVIERHEAVGGGCVHWGTIPSKALRHSVSRYIEYKTNPLFNTGDRLARLT
    FPDILRHASSVISKQSNLRSSFYDRNRIQMFQGDARFIDKHTVEVTRQDGSTERLTAKTIVIATGSRPYRPPEVDFTHSR
    IYDSDTILGLTHDPHRVLIYGAGVIGCEYASIFKGLGAKVDLVNTRDRLLAFMDTEISDALSYHFWNSGIVIRHNEEFDH
    IETRDDCVIMHLKSGKRVKADCILFANGRTGNTDKLNLEAIGLKPDSRGQLKVNETYQTEIDNVYAVGDVIGYPSLASAA
    FDQGRIAADAISCGNCDEKLIIDIPAGIYTIPEMSSVGKTEQQLTAAKVPYEVGRAQFKHLARAQIAGTEVGTLKILFHT
    ETKEVLGVHCFGERASEIVHIGQAIMEQKNGGNNIEYFVNTTFNYPTMAEAYRVAALNGLNRLFK

    >gi|77361954|ref|YP_341528.1| glutaredoxin 3 (Grx3) [Pseudoalteromonas haloplanktis TAC125]
    MTKIEIYSKSYCPYCKRAKATLTRLGLDFEEFEITDSEKLTKEMQQRSGRKTVPQIFINSQHIGGGDDFHHALNSGSLAD
    LIGDHV

    >gi|77362081|ref|YP_341655.1| putative thiol:disulfide interchange protein [Pseudoalteromonas haloplanktis TAC125]
    MLSISLGPFVIAISQLIILLGLGVFWLLTYLQTRKQPQQKAILDIVFKAFVVGFIVARLMFVLTMWDAYQENWWQLINIS
    DGGFMPSYGWVAGALVLALYARGKKAVLKTYFIAAIVALFTIMVPTFAASIYKAGVELPQSAVYNLRGKEVDLQSFKGKP
    VVINFWASW
    CPPCRKEMPVLQAAQKNNPNIAFVFVNQGEDLFTVQKFINAEQLDLRNVFFDQNSNVSRESGAAGLPTTLF
    YSSDGKLVTSHMGELSHASLRYYMQAINQQSAQ

    >gi|77362082|ref|YP_341656.1| disulfide isomerase/thiol-disulfide oxidase [Pseudoalteromonas haloplanktis TAC125]
    MKLIYLLPLLAFTSPILAQQKALPAPLKLVTEQGGEIVSEFAAPANMKGYVADFKGQVITLYITADEQYLFTGPMLDANG
    NNVGEQAANDYATGPKAQKDWQTLESSHWIVDGSASAKRVVYTFTDPN
    CPYCRQFWQNARPWVDAGEVQIRHILVGILKA
    DSLGKAAAIMSASNPEEVLKKFENDNLARTLQPLKNPPEHINAQLMKNHQIMMGVGARATPATFYHDANGAVKMQMGLPP
    ASLMTEILGPRPSKLTK

    >gi|77362097|ref|YP_341671.1| putative organic hydroperoxide resistance protein [Pseudoalteromonas haloplanktis TAC125]
    MNVLQNVAYTAKATATGGREGTAKSDDGRLNVDLSTPKGLGGDDGKGTNPEQLFAAGYAACFIGALKFVAGSEKITLPSD
    THINSEVSIGAIDGGFGIAVKLAVSLGDMDKAQAQELVDKAHLV
    CPYSNATRGNIEVELSVI

    >gi|77362103|ref|YP_341677.1| hypothetical protein PSHAb0186 [Pseudoalteromonas haloplanktis TAC125]
    MTEFTLYTAENAPEESKSLMADSVAAFGMVPNLHAVMAEAPTLLKGYQVLHELFQNTSFNAEELTVVWQSINVEHNCHYC
    VPAHSAIAASMKVDQGIVDSLVNKTPLADPKLEALRETTLAMARDRGVISDEQIEKFFAAGYGKQQLLEIIVGLSQKVMS
    NYTNHLADTPVDEPFKKFIK

    >gi|77362146|ref|YP_341720.1| mercuric reductase (Hg(II) reductase) [Pseudoalteromonas haloplanktis TAC125]
    MIKKILLLLIAAVAIGLFFHFDLHQLLTLEGLKGSMDQFSQYKAQSPLLIIGGFFLLYVVVTALSLPGAAILTLAAGALF
    GLVEGLLVASFASTIGATLAFLVSRYLLRDTIKKRFPERLAAIDAGVEKEGGFYLFTLRLVPVFPFFLINLLMGVTAIKS
    WTFYWVSQVGMLAGTFVFVNAGTQLAQIESLSGILSLDLILSFALLGVFPFIAKGILNVFKKRRVYKNYTKPKSFDRNMI
    VIGAGAGGLVTSYIAAAVKAKVTLIEAGEMGGD
    CLNYGCVPSKAIIKSAKIAEQIRHGEHYGLENMTPQFSFKKVMARVH
    KVIADIAPHDSIERYTNLGVDVVKGYGKLIDPWTVEIKLNDGGTQTLTARTIVIATGARPFVPPLPGIEETGYVTSDTLW
    DKFAALDEAPKKLVVLGGGPIGSELAQSFARLGSSVTQIEMAERIMIKEDVEVSTFAHEALSESGVNILTSHQALRCEAR
    DGKKFIIVKRLNEGNNEEIAIEYDELLCAVGRSARLKGYGLEALGIETNRTIVTNEYLETLYPNIFAAGDIVGPYQFTHV
    AAHQGWYAAVNGLFGNLKKFKVDYRVIPWTTFIDPEVARVGLNEQDAIDKGIDFEITRFEFEELDRAITDSATKGFIKVI
    TPKGKDKILGVTVVSEHAGDLIAEFVLAMKHGLGLNKILGTIHSYPTWAEGNKYAAGEWKRAHAPEKVLNMLEKYHTWRR
    G

    >gi|77362178|ref|YP_341752.1| alkyl hydroperoxide reductase subunit C [Pseudoalteromonas haloplanktis TAC125]
    MSTSLINTKLQPFNATAYHNGDFVELSEKDVLGKWSIFFFYPADFTFVCPTELGDMADYYAQLQEMGVEVYSVSTDTHFT
    HKAWHDTSDTIGKITYPMIGDPTGRITRSFGVMIEEEGLALRGTFVMNPEGEIKIIETHDLGIGRSAKELVRKVQAAQYI
    ATHDGEVCPASWQPGEDTLAPSLDLVGKI

    >gi|77362179|ref|YP_341753.1| Alkyl hydroperoxide reductase subunit F (Alkyl hydroperoxide reductase F52A protein) [Pseudoalteromonas haloplanktis TAC125]
    MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSTEVASLANDLASLSDKFTVINNPDTSARRPSMVVHSPIKNTHITFAG
    VPMGHEFTSLVLALLHTGGHASKAKAEDIEQIKSLDQALNFEVYISLS
    CQTCPQVVQALNTMAATNNKIKATMIDGALFQ
    GEVEERNILAVPAVYLNGEPFSQGALSLTDILNKVDSKGAQRQAESLSKKEKFDVLVIGGGPAGASAAIYSARKGLNTGI
    VADRFGGQVADTLAIENFISIKATEGPKLVAQLEEHVKEYDVDVMHNQRAAKLSRNNNGYEITLENGAVLSAKSLVLATG
    ARWREMNVTGEQQYRGHGVAY
    CPHCDGPLFKGKPVAVIGGGNSGIEAAIDLANIVEHVTVLEFADTLRADEVLIRKASSM
    ANITIIKSAQTTEVLGDGKKVTGLTYTDRVSGDSKQLTLAGIFVQIGLIPNTEWLKDSELELSKFGEILIDAKGATSLPG
    VYGAGDATNTPFKQIIIAMGSGATASLGAFDYLIRHSDETEQA

    >gi|77362206|ref|YP_341780.1| putative methylated-DNA-[protein]-cysteine S-methyltransferase; O6-methylguanine-DNA methyltransferase [Pseudoalteromonas haloplanktis TAC125]
    MIIQTLLPSPIDDIIIQGSEKGVSYVGFYPPKNYSITALSEVTNDAILCAAAQLNEYFAKQRTTFTVPLDTQGTVFQQSV
    WQALLNVPYGELKTYGDIAKVLNNPKAVRAVGAANGKNPISIIVP
    CHRIIGANAKLTGYAGGLARKQWLLQHETG

    >gi|77362221|ref|YP_341795.1| putative enzyme of unknown function [Pseudoalteromonas haloplanktis TAC125]
    MKTLKIDIVSDVMCPWCIIGYKNLEKALSELHGEINAEISWKPFELNPNMPPEGQDLNEHLTQKYGLTPEQSKDNRQRLI
    DAGKDADFTFNFDDKRMIINSFDCHRLLAWAATLNKQTELKLALFKAHFSDLVNLNEQSALLDIVASVGLDTDRAQEILA
    GGEFFQEVRSQQSDIQQMGITTVPTFIINEQYALTGGQPSAAFVQAFKQITEEEAQQNAE

    >gi|77362292|ref|YP_341866.1| putative osmC-like protein [Pseudoalteromonas haloplanktis TAC125]
    MEISVAMLDGQKLSAKFGDHEVISDQSLAAGGNAEHPEPFDYFLVSMVLCAGFYARKFCQQRDISTQGMSLKQNNENVDE
    DGKKLFSIEITLPDGFPDKYKKALVAAVNTCTVKKVIQAVPEFSVVVK