Pseudoalteromonas atlantica T6c uid58283

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|109896394|ref|YP_659649.1| thiosulfate sulfurtransferase [Pseudoalteromonas atlantica T6c]
    MEQFAHISVQETQQKLAAKEARLVDIRDEQSFVAGHIEGAVHLTNGTLVNFTQETDFDTPVIVCCYHGVSSQQAAQFLLH
    QGFEEVYSMDGGFEAWRQSLPFVSGE

    >gi|109896415|ref|YP_659670.1| thiol:disulfide interchange protein precursor [Pseudoalteromonas atlantica T6c]
    MKLIASFSIFMLMSIWSFASLGQSNSFDSLFSNEPEFLKVDQAFVFDYVQNGDQLVVTWDIADDYYLYQQQFKAVSKNAS
    LGEPIFPTGKMKEDEFFDEPQEVYYHKVSVTYPILQSQDDSAVKIRYQGCAEAGLCYPPTTQVVYLNAVNASDDLSNTDE
    ASVESSGSVSQQFELADLLTGDQSLIWVLLIFLALGVGLAFTPCVFPMYPILSGIVIGQGKSISTSRAFVLSFVYVQGMA
    LTYSLLGLVVASAGVQFQAALQHPIILGALIVVFALLALVMFGAWEFQLPSSWQEKLNGVSNQQKSGSYLGVLLMGAISG
    LVASPCTTAPLTGILLYIAQTSDLLLGFSALYALSLGMGIPLILFGITGGKLLPKAGAWMNIIKVTFGFMMLAVALMFVE
    RLVSHMATDILWSLLGLVTFSYFYVMNQASSVTFGKGVRALVIFIGLFASAMYGYQTIFGQTSSVAGHTEQSHPRFEVVK
    NLDDFEQKLAAANAQGKTVMVDLYADW
    CVACKEFEKYTFPDTQVVDALSNTVWMQIDLTDNTATNIAFQEHFSILGLPTI
    LFFDLQGKEISGSRVTGFMQASAFAAHAKNIL

    >gi|109896432|ref|YP_659687.1| OsmC-like protein [Pseudoalteromonas atlantica T6c]
    MNVLQNVAYTAKATATGGRAGSAKSDDGRLDVTLSTPKGLGGDDGQGTNPEQLFAAGYAACFIGALKAVAGQAKIALPSD
    VYINSEVSIGGIENGFGIAAKLAVSLGDMDKRQAQALVEKAHHV
    CPYSNATRGNIEVEISVI

    >gi|109896489|ref|YP_659744.1| redoxin [Pseudoalteromonas atlantica T6c]
    MSNLFLFTFALLWVLVIALGVVVYALARQVGVLYERVAPAGALAMNQQLKAGDKAPEISVKTITNQKLFIGKPTKKSTLL
    FFLSPD
    CPVCKEYLPVIISLSHAERSHLDVVFVSDGDEPDHQAFIKEKKLENFPYVLSEEVGKKYGVSRLPYATLIDKSG
    IISSMGLVNSREHIESLLNAQDLNVASIQEFLEKQGNNERTLYKQA

    >gi|109896527|ref|YP_659782.1| glutathione S-transferase-like [Pseudoalteromonas atlantica T6c]
    MKIYADAQSGNCYKVKLMCALLNIEHEWIHVDILAGDTNAHAFLAKNPNGKIPLLALDDGRHLWESNAIINYLANGSDLL
    PSDVFALAKVQQWQFFEQYSHEPYIAVARFIAKYLGLPESKKAEYEAKQAGGHKALAVMESQLTHTPFLTGQSVTAADVS
    LYGYTHVAHEGGFDLSRYPNVQAWLSRIEALPNYIAMDASKGKA

    >gi|109896605|ref|YP_659860.1| redoxin [Pseudoalteromonas atlantica T6c]
    MSLQAQIAEYEKQKNATAPKDVLNVMALATSDLMATDISSDALQVGDYAPDFSLPNVHGKLVTLAEMLAHGPVVLNFYRG
    GW
    CPYCNYELRAFEEVLERIEDLGAQLVAVSPETPDNSLTTKDKNELSYAVLSDVGNNVTNDYGLVFSLDERLRPIYSHS
    GVDLPAFNGDDTFNLPMPATYVINQSGQIVYAFVSEDYTKRSEPSEVLKILTTLDN

    >gi|109896682|ref|YP_659937.1| redoxin [Pseudoalteromonas atlantica T6c]
    MMTNVKATIGCLLLLLAVLSSTVLAFERTTIAEDAQDVTPLLVGHFAPNTKLQTADGAPVSLKAITMQKPTVLIFYRGGW
    CPYCNRQLAGLKDIEKSLDDLGYQILAISPETPAQLQAQKLQSKFTVQLLSDSKLETIRGFGIGYYVPEDKTAQYKEKKG
    IELNASAEAGRGVLPAPAVFILDEQGVIKFSYVNPDYKQRLSPEFLYQAAKYSL

    >gi|109896686|ref|YP_659941.1| redoxin [Pseudoalteromonas atlantica T6c]
    MINVGDTLPEVTFSLRENGEASNPTTVDLFADKKVVLFAVPGAFTPTCSNTHLPGYIALADKLAAKGVDSIICLSVNDAF
    VMEAWGKSQNAENVTMLADGGAAFSQAIGLAKDTGTFGGLRSGRYSMLVENGVVKALNIEAPGKFEVSDAQTMLAALNG

    >gi|109896724|ref|YP_659979.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Pseudoalteromonas atlantica T6c]
    MNSKRAILVIVIAALIASFFVFDLNQYLTLESLKNNQQDLAQYIEANWLVAFVGYLAIYAAATALSVPGAAILTLGAGAL
    FGFGWGLLLASFASSIGATLAFLASRFLLRDWVKSTFSKKLESIDKGIEKDGAFYLLSLRLVPIFPFFIINLVMGVTGIK
    TWTYYWVSQLGMLIGTAVYVNAGTQLVEINQLSDIISTDLILSFVLLGIFPILAKFILSALQQRRVYKGWKKPKKFDRNL
    VVIGAGSAGLVTAYIAAAIKSKVTLVERHKMGGD
    CLNTGCVPSKSILHASKLAHIHHTSQNAGVTYDAPKIDFKAVMNKV
    HSVIKSIEPHDSVERYESLGVNVAIGNATIVSPWQVDIQTENGVESLTTRNIVIATGARAFVPDIPGLKDIDYLTADNLW
    EITEQPKRMIVLGGGPIGCELSQAFGRLGTHVTQIERGDQVLSKEDPDAAKHLQIQLEKDGIDLRLNTSAMAVETTSEGN
    VLVVEFEGKEERIPFDKILVAVGRQANLTGFGLEKLGIETDRTVITNDFLQTKYPNILAAGDVAGPYQFTHTASHQAWYA
    AVNALFRPFKIFKVDYSVIPWATFAEPEIATVGLNEMSAKQQGIEVEVTRYDIGGLDRALADDHARGFVKVLTKPGKDKI
    LGATIVGANAGELLAEFVLAMKHGLGLNKILGTIHIYPTMAEANKNVAGNWKKDHAPQKVLDFLERFHTWRRK

    >gi|109896749|ref|YP_660004.1| thioredoxin [Pseudoalteromonas atlantica T6c]
    MHIVCPHCYAINNVPESKDHTQANCGKCQQKLHTHQPCQLTQHQFYRYIERNHLPVLVDFWASWCGPCKSFAPVFAKLAN
    QTDSVLFAQLNTEQAQQISSEAGIRSIPTLILFHQGKEIDRISGALGEAQLKQWIVQAVQKC

    >gi|109896784|ref|YP_660039.1| Na(+)-translocating NADH-quinone reductase subunit D [Pseudoalteromonas atlantica T6c]
    MADTKEMKKVLFGPILDNNPIALQILGVCSALAVTTKLETALVMSLALTAVTAFSNLFISMIRSQIPSSVRIIVQMTIIA
    SLVIVVDQILKAYSYEISKQLSVFVGLIITN
    CIVMGRAEAFAMKSPPFISFLDGIGNGLGYSFVLIVIGTIKELFGFGTI
    LGFEILPLIQNGGWYQGNGLLILPFSSFFLIGGLIWFIRTIKPEQVEPKE

    >gi|109896785|ref|YP_660040.1| Na(+)-translocating NADH-quinone reductase subunit E [Pseudoalteromonas atlantica T6c]
    MEQYLSLFIRSIFLENMALFYFLGMCTFLAVSKKVKTAMGLGVAVIVVLTISVPVNQLVYANILAPGALGWAGFPDTDLS
    FLSFLTFIGVIAALVQILEMTLDKFFPALYNALGIFLPLITVN
    CAIFGGVAFAVQRDYTFTESIFYGAGSGAGWALAITL
    LAAVREKLKYADMPEGVRGLGSVFMIAGLMALGFQSFSGVSI

    >gi|109896872|ref|YP_660127.1| iron-sulfur cluster assembly accessory protein [Pseudoalteromonas atlantica T6c]
    MSVQTAVPIEFSDAAARKVKALVEEEENPNLKLRVYVTGGGCSGFQYGFTFDEKVNDGDTTIDKDQVTLVVDPMSLQYLL
    GGEVDYTEGLEGSRFLVNNPNATTTCGCGASFTV

    >gi|109896905|ref|YP_660160.1| redoxin [Pseudoalteromonas atlantica T6c]
    MVNALSLFYRLNMRNFISIFVLYLTCYSSSGYATVAPDFSYMTRSGAVHLSDLKGKVVYVDFWASWCKPCRQSFPWMNDM
    QHKYAEQGLVVVAVNLDTEPQLVTAFLQKIPANFPIVLDPEAEIAQRYDLIGMPSSYLVARDGSIRFSHKGFFNAKASAY
    EQQLVTLLQETE

    >gi|109897069|ref|YP_660324.1| OsmC-like protein [Pseudoalteromonas atlantica T6c]
    MSIVKSGSATYKPLGKKGKGSISTETGALSNHPYGFNTRFEDGKGSNPEELIGAAHASCFTMALSLALADAGYEDGELKT
    TAKISLDKTDNGYKISQSALSLSATVAGISEDEFSEIAQEAKAN
    CPVSKLLDTKITLAIDLST

    >gi|109897073|ref|YP_660328.1| peptide methionine sulfoxide reductase [Pseudoalteromonas atlantica T6c]
    MKSILSALILSVSFISFHVTADETILAGGCFWCMESDFEKLQGVSDVVSGFTGGTVRNPTYNGNHKGHYEAVKITYDAEV
    VSYQQILDHYWVNIDPFDDRGQFCDKGHSYLSAIFVANEQERAIAQSTKQAVEAQFPEQTVVTPILDAKRFYPIKGNEIG
    HQDFYKKSPVRYKLYRWNCGRDQRLEEIWGDKASH

    >gi|109897269|ref|YP_660524.1| rhodanese-like protein [Pseudoalteromonas atlantica T6c]
    MMQNRVLDYSQYIQQVRQTIKEVTCEEYAKDPSVYPVLIDVREDEECQLGVLPGAHIIPRGLLEAKLSGVAIGHGEIEPL
    DWLAQRNILLY
    CRTGGRSALAAQSLTRMGFTHIYSLAGGTQRWCELGYAIAQE

    >gi|109897289|ref|YP_660544.1| hypothetical protein Patl_0964 [Pseudoalteromonas atlantica T6c]
    MQNQTSAPVVVCALYKFVTLENFEEMRQPLLTFMQDNGIKGTLLLAEEGINGTVSGSREGINALLNYLNEDPRIAPISHK
    ESLDETQPFHRTKVKLKKEIVTMGVEGIDPLRTVGTYVKPKDWNALISDPDVTVIDTRNDYEIEIGTFKNAINPNTESFR
    EFPQYVKDNLEPSKNKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLEGGILKYLEEVPKDDTLWEGDCFVFDNRVAVNHD
    LQKSEYDQCYACRLPITEEDKASPLFEAGASCPKCHGTHSEEQLKRFREREKQVNLARERNEAHVGEDATKAIKLRRQQK
    AAQRRAQRTAAGKSNG

    >gi|109897391|ref|YP_660646.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pseudoalteromonas atlantica T6c]
    MTQSLINTKVLPFNATAFKNGEFVEVSEKDIEGKWAIFMFYPADFTFVCPTELGDLADHYAKLQELGVDVYSISTDTHFT
    HKAWHSSSDTINKIEFAMIGDPTGKITRNFGVMIEEDGLALRGTFVVNPEGEIKIAEIHDLGIGRSASELLRKVQAAQYV
    ANHDGEVCPAAWQPGEETLTPSLDLVGKI

    >gi|109897392|ref|YP_660647.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pseudoalteromonas atlantica T6c]
    MLDAKLKGQLATYLENLTSPVELRIAVDEQHQAKKSAELTDLANEIAALSPLVSVVAQSKSDIRKPSMEVVSITNSTSIT
    FAGVPMGHEFTSLILALLNSGGHPVKISEQQVAEIKSLSGSYQFETYVSLS
    CQTCPGVVQALNVLSVINPNITNTMIDGS
    LFQEEVTQRNIMSVPSVYLNGELFTQGAVTIEKILSKIDPQADAKQAQSLNDKAPYDMLIVGGGPAGAAAAIYAARKGIR
    TGIVAEKFGGQVTDTMAIENFISVKATDGPKLVSGLEQHVKDYDVDIMTNNKAVKLTKDGLLNIELENGALLSSKTVMLA
    TGARWREMNVPGEQQYRGAGVAY
    CPHCDGPLFKGKRVAVIGGGNSGIEAALDLANIVEHVTVLEFDSKLRADEVLQRKAK
    AANNIDIILNAMTTEVQGDGKRVTGLAYQDRASQESHQVELAGIFVQIGLVPNTEWLKGDIALTARGEIEVGQRGETSIE
    GVFAAGDVTTSPYKQIIIAMGDGANAALGAFDYLLRAPADENTPSVESNIGEKAA

    >gi|109897480|ref|YP_660735.1| redoxin [Pseudoalteromonas atlantica T6c]
    MAPNWSLQDADGNQVSSTDFAGKPLIIHFWATWCPYCKKLQPGLERLYVKYQQQGLQMIAISLREDEDAKPQEALNARGM
    TFKTLVNGDQVAMDKFYVRGTPTTFFINAKGQVVVATQLSDPHDPRLEQVVKSILVK

    >gi|109897565|ref|YP_660820.1| iron-sulfur cluster assembly protein IscA [Pseudoalteromonas atlantica T6c]
    MGIKISEAAAQRASSFLQNRGSGLGLRLGVKTTGCSGLAYVLEFVDELNEDDHVFEDNGVKIIIDGKSLVYLDGTELDFA
    KEGLNEGFQFNNPNANGECGCGESFNV

    >gi|109897720|ref|YP_660975.1| glutaredoxin-like protein [Pseudoalteromonas atlantica T6c]
    METVEKIQQQISENPILLYMKGSPKLPNCGFSAQASQALMSCGEEFAYVDILQNPDIRSELPKYADWPTFPQLWIDGELI
    GGCDIIMEMVQQGELQTIVKESAEKRADK

    >gi|109897722|ref|YP_660977.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Pseudoalteromonas atlantica T6c]
    MSVLVSRPAPDFTAAAVLGNGDIVENFTLSEAIKGQKAVLFFYPLDFTFVCPSELIAFDKRYDEFKKRGVEVIGVSIDSQ
    FTHNAWRNTAINDGGIGKVKYAMVADVKHEICQAYDVEHPEAGVAFRGSFLIDEEGVVRHQVVNDLPLGRNIDDMLRMVD
    ALNFHEEHGEVCPAGWQAGEKGMVDSPEGVASYLSENADSL

    >gi|109897779|ref|YP_661034.1| OsmC-like protein [Pseudoalteromonas atlantica T6c]
    MQTLPHQYSVTAKGDSSGALTAYCDNLPDISVAPPSQFGGDGDKWSPEDLFMAAIANCFVLSFRAIARASKFEWQDIKCD
    SQGTLDRVQGKTFFTQVRTTVQLSIPKTENIEKAEKLLNKADEA
    CLISNSISCEMSLECDVVVQ

    >gi|109897959|ref|YP_661214.1| methionine-R-sulfoxide reductase [Pseudoalteromonas atlantica T6c]
    MKLSEQEWREKLSDEEFRVTRQKGTERPFTGELLDNNALGDYVCRCCGEKLFDAQDKFDAGCGWPSFSAQSADGNVEFQQ
    DNSHGMQRIEIVCKNCDAHLGHVFSDGPAPTGQRF
    CVNSVSLAFNKT

    >gi|109898075|ref|YP_661330.1| redoxin [Pseudoalteromonas atlantica T6c]
    MSTLKEQTEAQVAKSRQAKPEFMQAMDELMAKAHEFEQGSEAIEIGQQAPTFTLPNAQGQDVALSYLRTKGPVVATFYRG
    DW
    CPYCNLQLRALQSILGDIHELGAELVAISPQVPDDSLSKSEISELGFHVLSDQDARVAASYGVAWEVPELILQHMRKD
    RGLDLASINNGNGSMLPIPATFVLNADAKVIWRFVDVDYRTRAEPADIIAALKANQIT

    >gi|109898224|ref|YP_661479.1| thioredoxin domain-containing protein [Pseudoalteromonas atlantica T6c]
    MNIKDIGFNSEYAEEAFTFDEINELNGDTILDFGAPWCGHCQAARPAIEEVVSEHAGLRHIKIYDGKGKPLGRKFKVKLW
    PTLILLRSGNEVARLVRPLEADEIRQLVS

    >gi|109898253|ref|YP_661508.1| UBA/THIF-type NAD/FAD binding fold [Pseudoalteromonas atlantica T6c]
    MSLFSAGEWQQYQRHIQLDAVGVDGQFRLKNAKVLVVGAGGLGCPVAMYLGAAGVGNITIIDGDSISQTNLHRQVLFAYT
    DVGKPKAHVAAIRIRENNPFITVAALDELLSESNIDILVAQADIVLDCTDNFATRLQINDTCRAHDKPWVYASVLGLEGQ
    VALFTPSCACFRCIFPDIPADVAD
    CNSAGVLGSVVGAVGLLQANTCLGYLLDLQDESQGKLHFFSGISNQVRSIALQQNK
    LCTCASPSQVLRCQPLKTADPIESKELGQEPGLHITDDIQSQIRSQIELSPEQFVKQLGRLEGAPESCLNSARKSKVIDI
    GLIDVRSADEHRGFNIGGQCLPLSDDFADRVGTKLSHKTQPILLY
    CQSGKRSYKAALRLRAKGYGRVYSLKGGLGELLSH
    SQFVKWF

    >gi|109898385|ref|YP_661640.1| heavy metal translocating P-type ATPase [Pseudoalteromonas atlantica T6c]
    MTDSVSCYHCGLPAVDGDKYNVSVLGQERQMCCPGCQAVAQAIVENGLDDYYRFRTEPGVKASDNIQDTLEQLSIFDEQS
    IQQDFVVHQGDISEIQLSLSGIS
    CAACGWLIEKQLSKVSGIKQVSVNVTANRALVSWYSDALSLSQIMASIERIGYHPSP
    FQQEQHEALFQQSHKAQLKRIGLAGLMTMQVMMLAIGVYFDLFGDLERETSSFFNWISLVLSTPVVFYSGAGFYQSAFKA
    LRAKSVNMDVPVSIALLATYFSGVWATVFEQGQVYFESVCMFIFLLLVSRFIEHQARHKAAQISANMLQYIPLTANLMVE
    NEIQPTLAKSLQLDDVILVKAGETVPIDGTVLSGHAQVDESLLTGEFYPVNKTVGDAAYGGTINKSGTLTLTVTSQFKYA
    LVNQIARLQEQAMANKPRIAAMADQFSQYFVVAVLFFASGSFIYWWLQGDPDAFWIAISVLIATCPCALGLATPSALSFA
    MANLNKQGVLLKRSDVLEQLTQVDHIVLDKTGTLTEGEVSLAAIHNISSFDDETLLMYAHSVEQYSEHPIAKAFEAYPVF
    SDVKAFSFTLGEGVSAIVNHQQVEISAAHSHERPNDPALKTSSVLMHIDGELVCGFELSDTLRPDVPDMLLRMSRKDITL
    LSGDNQKNVSQIASDIGISNWLAQQTPQDKLAYVQKLQANEHSVLMIGDGINDAPVLAQADVAVTLGAGADLAKSSADII
    LLKNALGKLPDVFIVAQRCKQKIRQNMAWALGYNVLVLPLAVSGALTPWMAVIGMSLSSIIVVVNSVRLLK

    >gi|109898403|ref|YP_661658.1| rhodanese-like protein [Pseudoalteromonas atlantica T6c]
    MNLRLDMAKTLLEIVEEIKQHIPHFDCDTAAVNRAKDNGLLIDVREPSEHETESVTGAINIPRGILEMKMLTLEPNRSRP
    IYLH
    CASAVRAALSAEQLHRVGYTHLYVVTGELKNIIQAHA

    >gi|109898408|ref|YP_661663.1| copper-translocating P-type ATPase [Pseudoalteromonas atlantica T6c]
    MSSKSKVKTQSFMIEGASCASCVSKIEKALASVEGVTGVEMNFAQRTVTIDGDVNSHSLIHSVTDIGYNATPMNSGSEQD
    ALAEKAQADEAHYNNLMRNMVIALGLGIPLMLYGLFIGDMSVNTSNQRIGWAIVGLVTLSVMIGTGKHFYIGAWQSFKHH
    SANMDTLIALGTGTAWAYSMLVILVPNLLPEMARHVYFEASAMIIGLINLGLAFEVKARGRTSEAIKRLIGLQPNTARVV
    RNGEEEDVDIAQVQLNDIVRVRPGEKIPVDGELTDGQSTVDESMLTGEPMPISKTVGDKVVAGSINKTGSMLFSATHVGK
    DTTLSHIINMVKKAQNSKPSIGRLADVISGYFVPIVMILAVITGLAWLNFGPQPAIAYAITAMTTVLIIACPCALGLATP
    MSVMVGIGKAAEAGVLIRNGEALQSASKITTMLLDKTGTITQGQPEVTDISTFEQRQESCVMALVASLESQSEHPLAQAI
    VGYAKQRDYPLNAVTKFDAITGKGVTGYLNGEHLLFGNEALMHQFGIDVSVAVEQAGTLANDAKTPMYFAVDQKLSALIA
    VSDPIKSDSLAAIKRLQNKGIHLVMLTGDNEATAKAVAKRVGIDDYIAQVMPQDKVEEVIKRQKHGEVVGMTGDGINDAP
    ALAQADVGFAIGTGTDVAIESADVTLMRGSLHGLADALAISQATITNIKQNLVGAFMYNVAGIPIAAGVLFPFFGILLNP
    VVAGAAMALSSLTVVSNANRLRFFKVNKSA

    >gi|109898424|ref|YP_661679.1| protein of unknown function DUF395, YeeE/YedE [Pseudoalteromonas atlantica T6c]
    MNTNLILQAFLGGGLIGLGAFALMLFNGRIAGISGITFGAIFSHNGGGKNNNSENNKWRWFFILGLVIAPLITSVFGFSL
    PDTFPSAFSASSNNVINISLMVIGGLLVGFGTNLGSG
    CTSGHGICGISRLSARSITATCVFMVSAILTVAMIKHLFGGA

    >gi|109898426|ref|YP_661681.1| redoxin [Pseudoalteromonas atlantica T6c]
    MSSITFGSFALPVSPIILLVSLMVGLLVVAILGRKQSISVGDSLVSIVIYSLVVGRIVFVIKFFDSYDSLWQVLDIRDRG
    FDMFSSFIAGLLILLLQIHRHPQQRKILIAGAATTVLLFTSIQGVINAGNEQSALPNLAFNTPQGASVNLQHVSNQNITV
    INLWASW
    CGPCRREMPVLYSAEQRFPSVKFIMLNQREPADVVTEFLAEIDLHFNYVLLDTKGDIATMMGAHGLPMTLFYD
    ASGEMISSHFGEVSAASLQAELQNLTQKSTQ

    >gi|109898493|ref|YP_661748.1| glutathione peroxidase [Pseudoalteromonas atlantica T6c]
    MDIYHGKVLLIVNTASKCGFTPQYDGLQSLQETYATQGFEVLGFPCDQFGHQEPGNDEEIEQFCTTHFSVSFPLFAKVEV
    NGINAHPLFMYLKKHAPGIFGSTRIKWNFTKFLVDSHGNVVKRYSPKTKPEQIKKDIEALLSA

    >gi|109898508|ref|YP_661763.1| hypothetical protein Patl_2191 [Pseudoalteromonas atlantica T6c]
    MRVTSNFMTKMYGIKNCDTIKKARKWLTANEIEYTFHDYRVDGIEPKWLEEIEAIVGWETLLNKRGTTFRQLTDEQKENL
    NRETALALMHEAPAMIKRPLLIHQDHHVVGFKDAQYLEIFK

    >gi|109898538|ref|YP_661793.1| 3-mercaptopyruvate sulfurtransferase [Pseudoalteromonas atlantica T6c]
    MENTVQNSSALVSPQWLHAHLDDANIMVFMSTMNVITTGEPEPMPAGYIPKAQVFDFEHQICEPSSSLPHTMPSSEVFQQ
    EVRKLGVNKDSIVIVYDNQGMFSAPRVWWMFTCMGHKQVYVLNGGFPEWQKAGFKCAETLSQAKQEGDFISQFHAERMID
    ASGVLAALDAPDCHVIDARSADRFYAKVAEPRPHLRSGHMPNGLNLPFSDCIESAQLLSPQRLRTKFDALGVRENDKLMF
    S
    CGSGVTACVLALAANEAGYQNIQVYDGSWSEWGADERLPVVR

    >gi|109898619|ref|YP_661874.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Pseudoalteromonas atlantica T6c]
    MTSTTISRQRCIIVGASHGGVNLAFALRKEGYEGRITLIDADCNLPYHRPPLSKTHLIANEPAGQLLKPEQGYQKADISL
    MLGVSVVDVKSKNKQVLLDDGTRHPYTQLVLATGASPITPPIPGIDSAKHLYTIRTADDAHAIATAFKQSEQKRVVVIGG
    GYVGLETAASLRKSGAVVTVLEREPRLLARVTAPMMSDYFYALHRQHGVEVHNDKNVSEIKTNANENSVVCSDGSEYPAD
    IIIVGVGVRVNTALADKANLEINNGIVVNEANQTSAQDIFAIGDCCAQFNPHYQRWLRLESVQNALDQGKVAAAAICHKA
    FKTQPVPWFWSDQYNIKLQMVGLSQGYDDVVMRKELDKPDSFSVWYFKGNELLAVDAVNNAKAYVLGTKFINAMEQVDKN
    KLTDNSAPLSASIIKEFA

    >gi|109898685|ref|YP_661940.1| thioredoxin reductase [Pseudoalteromonas atlantica T6c]
    MSESRHVKLLILGSGPAGYSAAVYAARANLNPVLLTGIQQGGQLTTTTEVENWPGDAEGLTGPDLMVRMQQHAEKFDTEI
    IFDHINKTDLTKRPFTLVGDAGTYTCDSLIICTGASAKYLGMESETAFMGKGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIASEVHVIHRRDTFRSEKILSQRLLDKAENGNVTLHLNSTLDEVLGDQMGVTGVRIKSTTSDESKELDVMGLF
    VAIGHQPNTGIFEGQLEMKDGYIKVNSGTAGNATQTSVEGVFAAGDVSDHVYRQAITSAGTGCMAALDAEKFLDAL

    >gi|109898760|ref|YP_662015.1| hypothetical protein Patl_2445 [Pseudoalteromonas atlantica T6c]
    MANQPIADVPKSVYTLKDLASLSDYSLLNTLNCDPDATVTGDDCAPRQVFSGHYVPVKPTPIANPIYVAHSETFFAELGF
    DDNLVHTEDFASLFTGDISNVPSPMRRVGWATGYALSIYGTEYVQQCPFGTGNGYGDGRAVSVLEAVINKKRWEMQLKGG
    GPTPYCRGGDGRAVLRSSVREFLVQEHMHGLGVPTSRSLCLFVSQSEQVRRPWYSEGSYATNPDMNVSNPVAISTRVAPS
    FLRVGQLELFARRARVNQYPNALKELEMIVLHLIAREYQNEIDHELAISEKVVQLALAFRDRLTTLISHWLRVGYCQGNF
    NSDNCACGGYTLDYGPFGFIELFDPYYQPWTGGGQHFSFFNQAAAAQTNFDMFCKALQPLLSEAPEALEELNQINLGFAS
    VMQAKMETMWASKLGLASFDAQLFNQLITLMVQTSVDYTIFFRELSKIPGDIAGLSKSFYNAPTGELSEQWALWLQTWLS
    VVKVDQDIQKAAQMMQQVNPKYTWREWLVVPAYQQAGKGDFELVRELQQVLTQPFNEQSSEIENNYYSLKPQAFFDAGGV
    SHYS
    CSS

    >gi|109898795|ref|YP_662050.1| thioredoxin-dependent thiol peroxidase [Pseudoalteromonas atlantica T6c]
    MNRLTAGAPAPKFSLPNEHGETVNLSDFSGKKVLVYFYPKAMTPGCTVQAQNLRDSKSELDKLNVVVLGVSPDAVKRLPK
    FIEKEQLNFSLLSDEDHAVAEAFGVWGLKKFMGKEYDGIHRISFLINEQGVIEHVFDKFKTKDHHQVVLDYLNQ

    >gi|109898798|ref|YP_662053.1| redoxin [Pseudoalteromonas atlantica T6c]
    MLRKFLFSLLVIAGLLAGMYGYSLVRTDFTTDDGLSHQWRDYEGKWVVVNYFALWCAPCLREMPELNKFHQQNEGDTPLF
    AISFDDVTPQELAELKQKFAIEFPVIAGIEQPLPMTKPNSLPATFIIGPDGEVKKQLLGEQSAASLHSAIEILKTL

    >gi|109898799|ref|YP_662054.1| arsenate reductase [Pseudoalteromonas atlantica T6c]
    MSKLTILHNPRCSKSRQTLQLLIDSGQQPKVIEYLKNPPSVEELQAILLMLGMSDPRSLMRKKEPEYKALNIDSDNISPD
    ELLTVMHVTPKLIERPIVIKGALDDRESLAAIGRPPENVLKLL

    >gi|109898841|ref|YP_662096.1| glutathione peroxidase [Pseudoalteromonas atlantica T6c]
    MKKLLAITCLMFFCNMAYSAQCPDLLKFVKRKLNSQDTVNLCETYAGKTVLFVNTASYCGFTPQFKGLEALYSKYKDQGL
    VVLGFPSHDFNQEDKDESKTAELCELTYGVEFPMFEAMPVRGRDADQLYRMLAKKSGTTVKWNFYKYLMDKNGNLVNAYA
    SSTKPTDPAFIETVENTLKR

    >gi|109898851|ref|YP_662106.1| UBA/THIF-type NAD/FAD binding fold [Pseudoalteromonas atlantica T6c]
    MPSITPPTLTKALALRYARQILLPAIDLDGQEALMGSKVLIIGVGGLGCAAAQYLVSSGIGEITLVDDDKVELSNLHRQV
    LHHEQDVGVKKVDSAKTSLLANNSLCVINTIDERLDDNALSQHVSQHNVVLDCTDNLATRQQINKLCFTHKVPLISGAAI
    RFEGQVSTYLMDNHSPCYQCLSQVFPEQQLS
    CMEAGVIPPLVGVIGSMQALEAIKYLTGAGELLNGILQLFDAKSSQFQR
    FSIPKNPQCSICSKTG

    >gi|109898988|ref|YP_662243.1| alkylhydroperoxidase [Pseudoalteromonas atlantica T6c]
    MQPTDHINTYQKLQDLSAKLISEIPETMAGFGELHVNAVAKGALDNKTKELIALSIAISVRCNGCIAFHVHDALKAGANR
    QEIVETIGVAILMGGGPSMVYGCEALEALDQFELNQDLPL

    >gi|109899071|ref|YP_662326.1| carboxymuconolactone decarboxylase [Pseudoalteromonas atlantica T6c]
    MSRLSALSISELPNDLSAIMSAGEDIMGFTPNDGLIMARSPEMLKAFLGLVQSIYQPSALDNDLKKLLGLMTSSASGCQY
    CQAHTQYGALKHGITEQKVAAIWEYQTSDLFSLAEREALDIARNAALVPNAVTDEQFERLKLYFSEVQIVEIIGVISLFG
    FLNRWNATFKTDIEAAPAMASAKFTSVG

    >gi|109899106|ref|YP_662361.1| disulphide bond formation protein DsbB [Pseudoalteromonas atlantica T6c]
    MTFISNLADTRLAWGLLFLSALVLVAYALFSQHAMGLQPCIMCIYQRTAIFGIMFACVPVLAANNMLTRLFAFTVWGISA
    IWGGLIAWEHYDIQNAANPFFAT
    CEIVPNFPSWLPLHEWLPNLFAATGDCGNIDWVFMDMSMPQWMMVVFAIYSSIWFVV
    LASRLIGNRAI

    >gi|109899272|ref|YP_662527.1| electron transport complex, RnfABCDGE type, A subunit [Pseudoalteromonas atlantica T6c]
    MTEFLLLLIGTVLVNNFVLVQFLGLCPFMGVSGKLETAIGMSMATTFVLTLASLSSYLVEHYILLPLGIEYLRTLSFILV
    IAVVVQFTEMVVHKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNINHDHNFIESVIYGFGAAVGFSLVLILFAAMRERLAV
    ADVPAPFKGASISMITAGLMSLAFLGFTGLVKF

    >gi|109899277|ref|YP_662532.1| SoxR-reducing system protein RsxE [Pseudoalteromonas atlantica T6c]
    MNEFKQLSWQGLWKNNPALVQLLGLCPLLAVTATVTNGLGLGLATTLVLIGSNATVSIIRNLVPNEIRIPIFVMIIAAFV
    TVVQLLMNAYTYELYQALGIFIPLIVTN
    CAIIGRAEAYASKNPIGYAAFDGLMMGLGFTVVLVLLGAMRELLGYGTLFAG
    ANLLLGDWATSLKVTIFTTDSPFLLAILPPGAFLGMGLLIAAKNILDKRFERMFAAKQEAKVVQRARVTAET

    >gi|109899555|ref|YP_662810.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Pseudoalteromonas atlantica T6c]
    MRKISLFVLPLILFVGLAIFLFQGLFSNPREHESTLLNKPVPSFVLPDLMDTDLTYTTEVFVGKVTLLNVWGVWCVTCAV
    EIPFLEQLKNEGKHIVGLYYDQDIDPDFGIKTVERVQQEVEQKLGQLGDPYAYNIFDVKRDLSLDLGVTGAPETFLIDKQ
    GKVRLHHIGDINPRVWQNKFESVYQELIAE

    >gi|109899643|ref|YP_662898.1| glutaredoxin family protein [Pseudoalteromonas atlantica T6c]
    MSNPNFADKTGQRVPNVTFPVRVNDEWEKRTTDEIFSGKTVVVFSLPGAFTPTCSSTHLPRYNELAKVFKANGVDEIVCV
    SVNDTFVMNAWAQDQEAQNISLLPDGNCEFTDGMGLLVDKADLGFGKRSWRYSMLVKDGVVDKMFIEPDLPGDPFEVSDA
    DTMLEYIAPNAAKPAPAAIFTKPG
    CPFCTKAKALLTEKGYEFEELVMGKEITFTGMKAISGNDTWPQVFINGQHIGGSDE
    LAEFFNK

    >gi|109899657|ref|YP_662912.1| dihydrolipoamide dehydrogenase [Pseudoalteromonas atlantica T6c]
    MSEIKTQLVVLGAGPGGYSAAFRAADLGIETVIVDVNSKLGGVCLNVGCIPSKALLHVAKVIEEAKALSAHGVDFGAPKF
    DLDKIRDWKDSVVDKLTGGLAGMSKMRKVKHVQGYGKFTGSNTLEVKGDDGTTTISFDNAIIAAGSEPVSLPFIPQDDPR
    VIDSTGALEMKDIPGKMLVLGGGIIGLEMGTVYSALGSQIDVVEFLDQLVPAADKDIVKIYQKTVKDKFNIMLETKVTAV
    EAKDDGLYVTFEGKQAPAEPVKYDKVLVAVGRRPNGKLVDADKAGVTVDERGFINVDKQMRTNVSSIFAIGDLVGQPMLA
    HKAVHEGHVAAEVISGMKHYFDPKCIPSVAYTEPEMAWVGLTEKEAKEQGISFETANFPWAASGRAIASAATNGMTKLIF
    DKDTHRIIGGAIVGTNAGEMLGEIGLAIEMGADAEDIALTIHAHPTLNESIGLAAEMYEGSITDLPNPKAKKKK

    >gi|109899759|ref|YP_663014.1| GrxB family glutaredoxin [Pseudoalteromonas atlantica T6c]
    MSAHLDLRNHFIMSIMHLYIYDHCPYCVMARMPFAMKNVSVELTVLPSDDEATPIAMIGVKACPILKKPDGSFMPESMDI
    VSYIDQLDGSPIFSPSANRADVSAWLKDVNLLMKQLLYPRWVTSPVKEFQTQSAIDYFTHKKTKELGSFAEALANSKSLI
    KAFEDKLGELAHMLHSETGVNEQLSIDDITLFGRLRGITLIKGLTIPPKVGAYLDYFSTTCKIPLFYDVAQ

    >gi|109899876|ref|YP_663131.1| DSBA oxidoreductase [Pseudoalteromonas atlantica T6c]
    MKKIILAFFIAVLVPLQACAQETWKEGEHYTIINETATDKPVINEFFSYWCPHCFQFEPIAKKIQEKMGDDVKFEKVHVN
    FMGFTSGETQDDASRALMVARALKKEDSLSTAIFRYIHVQKSPITNIKDLKNIFMVNGVEEADFDKLVSSFGVNSMLKKN
    NKLVQEYRSHLRGVPNFIVNGKYQAKFTRDMNNDDIVNLIVWLSKQK

    >gi|109899913|ref|YP_663168.1| rhodanese-like protein [Pseudoalteromonas atlantica T6c]
    MEQVIEFATNHYILAGLFVALLVALLYSTVASSFSKLKELSTHEATLLMNKDDAMVLDIRPVAEFKKGHILGAKQIKPEQ
    VTKGDFTGLEKQKDKPIIVV
    CAMGMTCKRTANQMLKEGFEQVSVLKGGMNAWQGASLPISK

    >gi|109899914|ref|YP_663169.1| glutaredoxin 3 [Pseudoalteromonas atlantica T6c]
    MSKVEIYTKGHCPYCHRAKALLEQKGVTYTEFKVDVQPELRPEMITRANGGSTVPQIFIGEHHVGGCDEMFALESQNKLD
    TLLSA

    >gi|109900014|ref|YP_663269.1| thiol:disulfide interchange protein DsbC [Pseudoalteromonas atlantica T6c]
    MKLFFPIRVLSLSVQVGIYMKYRALFVAAFAFLSVSLSVSAASGSSQNLDSVKQKIQMSLGMQVTSIGDAPVPGLLQVQT
    DKGLFYTSDDGKYFLQARIFNLDEGMRNETETTLTKMRVDGVEHFKNSVIEYKAEKEKYVVNVFTDIT
    CGYCRKLHNQMD
    EYNDLGITVRYLAFPRAGLNSKPYQDMVSVWCSANPQKALNEAKGGENVAKASCSNQVAEQYNFGQSVGVNGTPNIILPD
    GSVVPGYQPPMQLLQAIQDAS

    >gi|109900035|ref|YP_663290.1| redoxin [Pseudoalteromonas atlantica T6c]
    MSTVTLKGNPFNTVGALPSVGESAADFRLVKTDLSETTLADYKGSRLVLNIFPSVDTPTCAMSVRKFNEQVGKLENTKVL
    CVSADLPFAAARFCGAEGIENVATGSSFRGTFGTDYGVEFVDGPLTGLLSRSVVVLDENGKVIYTEQVTETADEPDYDAA
    IAAL

    >gi|109900052|ref|YP_663307.1| DSBA oxidoreductase [Pseudoalteromonas atlantica T6c]
    MATPLKIDIVSDVSCPWCIIGYKALDEALGKLDGKVAADITWQPFELNPNMPPEGQEIVEHITEKYGISVEQSEQNREMI
    KQRGLDVGYEFGNRGGGRIYNTFDAHRLLHWAEEAGKQTELKLALFDLYFKESGDPSNHEQLLAVVERVGLDKAAAQEVL
    TSGKYTQEVREAQHLYQSNGISSVPAVIVNNKHLISGGQPASVFEQALTQIAQEVEAENVSA

    >gi|109900175|ref|YP_663430.1| methylated-DNA--protein-cysteine methyltransferase [Pseudoalteromonas atlantica T6c]
    MESRTSFTPLCTYLPTPCGLLKISASNDAIIAITFVEHPDTAATSNALLKQARQQLKEYFDRDREAFDLPLAPIGTNFQK
    NVWQQLRAIPYGVTCSYGDIAKQLNNPNAVRAVGSANGKNPISIIVP
    CHRVIGANGTLTGYAGGLTRKATLLSLENPQFN
    ASPAKIS

    >gi|109900225|ref|YP_663480.1| carboxymuconolactone decarboxylase [Pseudoalteromonas atlantica T6c]
    MAHMQPLPKETTPELAEDFAIFEQILGFVPNSLLTMQRRPDIVRGFGVLTKAVMAKDGTVDLGFKRLLAHFSSRAAGCQY
    CEAHSLIAAKIHGISDEKVAAVWEYQTSPLYSDAERVALDYALAAGSVPNAVDEPLMARMRAYWEEDEIVEILGAICLYG
    FLNRWNDSMATDLEATPKALGEDVLAQGGWTGGKHV

    >gi|109900258|ref|YP_663513.1| hypothetical protein Patl_3959 [Pseudoalteromonas atlantica T6c]
    MNLDHSYATHLGDLGALTKPLRVANPQLVEVNHTLRDALQLPASWFTQSSIMSMLFGNTSSFTTHSFAQKYGGHQFGGWN
    PDLGDGRGVLLGEAKDKFGKSWDLHLKGAGPTPYSRFADGRAVLRSTLREYLASEALHHMGIPTSRALCLITSDEPVYRE
    KQEKAAMMIRVSQSHIRFGHFEYFYHNGELDKLKRLFDYCFEHHFSACLHSESPHLAMLEKIVTDTATLIAKWQAYGFNH
    GVMNTDNMSIHGITFDFGPYAFLDDFNPKFVCNHSDHRGRYAFEQQPSVGLWNLNALAHAFTPYLSVEQIKGALSQYEAS
    LMAEFSQLMRQKLGLYENTQNTAELVNRWLDLIYQDKRDYHISFRLLCEVDEHGENQPLVDHFIQRDTAKTWLEHYQNAL
    ITQGVKRQERQANMRNINPEYVLRNYQAQLAIDAAQNGDFSRFRKLLHVLQHPFESKPEYAEFAKPPPNWGKHMEIS
    CSS


    >gi|109900350|ref|YP_663605.1| hypothetical protein Patl_4052 [Pseudoalteromonas atlantica T6c]
    MTDFTFHTVETAPEKSKSILEKSLKTNGMIPNLHAVMAEAPGLLEGYQVLHKLFMDSSFDAEELTVVWQTINVEHNCTYC
    VPAHTAIANSMKVSAELTEALRNREAMPTEKLQVLHDTTLAMVRERGAVSDDVIQNFFAAGYGQRQLLEIILGLSQKVMS
    NYTNHVANTPVDEPFKTFAWK

    >gi|109900361|ref|YP_663616.1| peptide methionine sulfoxide reductase [Pseudoalteromonas atlantica T6c]
    MANIQQATLGGGCFWCLESAFNTVEGVELAVSAYAGGQSQNPTYESVCSGETGHAEVVRVNFDADKLSYREVLEIFFALH
    NPTQLNRQGNDVGTQYRSAIFYHDEQQKQAAEQILQEISDEKIWPDPVVTEVIELNNYHQAEDYHQDYFSNNPQNQYCNM
    VVAPKLAKFKKTFASRLKSV

    >gi|109900385|ref|YP_663640.1| redoxin [Pseudoalteromonas atlantica T6c]
    MHSCSSHLINQSLRRTTMNSEKLTPGVTFPEIQVLDTKGNIQSLVSPTDAEHWTMVVVYRGVHCPICSKYLTQLQEMRSQ
    FQDIKVDIVAVSADSVEQLNTKLDDVSVEFPVYAGLTKEHMSALGLYLSQPTSEAETDHDFPEPGLFVVNSDNKVQVLEI
    ANSPFVRPDLNMLVSGLGYTRKNDYPIRGTKSF

    >gi|109900504|ref|YP_663759.1| glutathione-disulfide reductase [Pseudoalteromonas atlantica T6c]
    MADFDYICIGGGSGGIASANRASKHGKKVALIEARHIGGTCVNVGCVPKKAMWFGAQVAEAINHYAADYGFDVTVNKFDW
    KKLVDSREAYIKRIHASYDRVLGNNDITVINGFARFVDKNTVEVDGKHYTADHILIATGGRPVTPSIPGAELGIDSDGFF
    ELTEQPKRVVVVGAGYIAVELAGVLHSLGSETHLVVRKHAPLRSFDTMLSETLVEIMAQDGPTLHTHRIPEKLEKNEDGS
    LTLTFECGEKIEADSVIWAIGRAPANDNMGLDKAGVTVNQRGYIAVDKYQNTSVDGIYAVGDNIGKVELTPVAVKAGRLL
    SERLFNGQKDAHMDYTLIPTVVFSHPAIGTMGLTELEAEAEFGKDNVKVYNSSFAAMYTAVTSHRQMTRMKLICVGEEQK
    VVGLHGIGYGMDEILQGFGVAMKMGATKADFDACVAIHPTSAEEFVTLN

    >gi|109900520|ref|YP_663775.1| thioredoxin [Pseudoalteromonas atlantica T6c]
    MSDKIIQLSDDSFEADVINATGPVLVDFWAEWCGPCKMIAPILHEIADEFDGKLTVGKLNVDENNETPPKYGIRGIPTLL
    LFKGGNVAATKVGALSKSQLEEFLNENI