Bacillus cereus 03BB102 uid59299

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|225862316|ref|YP_002747694.1| protein disulfide isomerase [Bacillus cereus 03BB102]
    MKIEVWSDFVCPFCYIGKRRLEVALEQFPHKKDVEVEFKSFELDQNAPIYSGTSINEVLASKYGISIEEAKRNNVQLGNH
    AASMGLSFNFDEMKPTNTFDAHRLAKFAKDQGKEKEITEKLLFAYFTESRNLSDVDTLATIAEASGLDKQEALKVINDKS
    AYANDVRVDEAIAQQYQISGVPYFIINQKYAISGAQPLETFVGALQQVWEEENPAPKLQELSSEGGSDMSCTDESCSVPS
    KEQ

    >gi|225862381|ref|YP_002747759.1| alkyl hydroperoxide reductase, F subunit [Bacillus cereus 03BB102]
    MILDADIKTQLSQYLQLMENDILLKVSAGNDDVSKDMLALVDELATMSSKITVEKVELERTPSFSVNRPGEDTGVVFAGI
    PLGHEFTSLVLALLQVSGRAPKVEQKLIDQIKNIQGEYHFESYISLS
    CHNCPDVVQALNVMSVLNSGITHTMIDGAAFKE
    EVESKDIMAVPTVFLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVMDTMGIENFISVKRTEGPKLVASLEEHVKEYDIDVMNLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRN
    VGVPGEAEFKNKGVAY
    CPHCDGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVTV
    LKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRGEIVTDKHGATNVPGVFAAGDCT
    NNPYKQIIISMGSGANAALGAFDYLIRN

    >gi|225862382|ref|YP_002747760.1| peroxiredoxin [Bacillus cereus 03BB102]
    MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTFVCPTELEDLQNQYATLKELGVEVYSVSTDTHFTHK
    AWHDSSETIGKIEYIMIGDPTRTITTNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRN
    NPGEVCPAKWQEGSATLKPSLDLVGKI

    >gi|225862427|ref|YP_002747805.1| hypothetical protein BCA_0467 [Bacillus cereus 03BB102]
    MKKFETIEELATYIEEQQLVLLFIKTENCGVCDVMLRKVNYVLENYDYVEKIEILLQDMQEVAGRYAVFTGPTILLFHNG
    KEILRESRFISLENLERTIQLFEE

    >gi|225862515|ref|YP_002747893.1| bacterioferritin comigratory protein [Bacillus cereus 03BB102]
    MVTVGEMAPEFTLEGSNGEQVCLADFRGENVVLYFYPKDMTPGCTTEACDFRDSYGLFQEKDTVILGVSPDPANRHLKFI
    EKHELPFTLLVDEDHKVAELYDVWKLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEDVLSYIK

    >gi|225862522|ref|YP_002747900.1| hypothetical protein BCA_0581 [Bacillus cereus 03BB102]
    MKSSNKLMALGIVFSIAVLIVIGTIVYSIINDKKDKGNEMFAYSTQQSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRL
    KEEYIDKGKVQLYFINFPFIGKDSDLGAAAGEAIYKQDKDSFWTFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVDVE
    QFKKDLHSKEIKEKVRKDSDRAQKLKVQGAPSVYINGNLANPDFDSMKKAIDKELKK

    >gi|225862568|ref|YP_002747946.1| heavy metal-transporting ATPase [Bacillus cereus 03BB102]
    MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKTMVLETAQNKESEVVTEAKQLVTKLEPHIKVQEEKS
    TKVAKEIFILEGLD
    CANCAMKIENKVKEMPTVSAATVDFVSKKLRVEVVNKRELEATVANITNVVQKLEPDVKVVREEKG
    GHDHGHSHDHGEANVKKMVGRLVVGGILTAIAALAGLPQMITIPLFVLAYLLIGGDIVWRAVRNITRGQVFDENFLMAIA
    TLGAFAIQQYPEAVAVMLFYQVGELFQSIAVNRSRKSITSLMDIRPDYANVKVGNETKQVSPEDVQIGDYIIVKPGEKVP
    LDGKVIEGTSMVDTSALTGESVPREVEVGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITKF
    ARYYTPVVVITAAIMAFIPPLILEGATFSEWIYRALVFLVISCPCALVVSIPLGFFGGIGGASKSGVLVKGSNYLEALND
    VKYIVFDKTGTLTKGVFKVTKMEPSEGTTSEELLEYAAFAEVYSNHPIAQSIRKAYRKSIDEKIIDDYNEISGHGTVVKV
    QGKEIFAGNAKLMRKENITFKQPETVGTLVHVAVDGRYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAKLVGEA
    VGKELGLDEVHAELLPHQKVEEIEKIDAAKYGKEKVAFVGDGINDTPVLARADVGIAMGGLGSDAAIEAADIVIMTDEPS
    KIATAVNIAKRTRRIVWQNIIFALGVKGLVLLLGAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL

    >gi|225862622|ref|YP_002748000.1| hypothetical protein BCA_0682 [Bacillus cereus 03BB102]
    MKLTIKHDDIEADLSYGSLAIGKENGYSPLQLLVSSIAGCSAIVFRTILEKKRITYDTFTIETEIGRSEALSKPVESVHL
    HYKIKAQNITEEQLDKALQLAVKN
    CTIVQSVKDSIQVTETIELIK

    >gi|225862711|ref|YP_002748089.1| hesA/moeB/thiF family protein [Bacillus cereus 03BB102]
    MNNRYSRQELFSPIGEEGQRKIREKHVLIIGAGALGSANAEMFVRAGVGTVTIVDRDYVDWSNLQRQQLYAERDVENNLP
    KAVAAKKRLEEINSEVRVKALVQDVTAEELEELVTNVHVMIDATDNFETRFIVNDIAQKYSIPWIYGACVGSYGLSYTIL
    PSKTPCLSCLLQSIPLGGAT
    CDTAGIISPAVSLVVSHQVTEALKLLVEDYESLRDGLVSFDVWKNEYSCMNVQKLRQHNC
    PSCGENALYPYLNKENTSKTAVLCGRNTVQIRPPHKEKMDFERYKELLNDRVNDLNVNPYLLSFSVEEKRLVAFKDGRVL
    VHGTKDISEAKTIYHRYFG

    >gi|225862737|ref|YP_002748115.1| putative thioredoxin [Bacillus cereus 03BB102]
    MKKMLIFGGIIIVLFAAIFAVTQMEKKNASTDEKGYYSNKISLEDLNKNIEDKKEQTIYFYQTSCVHCQKVSPIVVPLAK
    DLNVDMKVIDIENLNEPWDKYNIQGTPTIIHFKDGKEVSRISGEQSKDKFKEWFEQTKK

    >gi|225862748|ref|YP_002748126.1| pyridine nucleotide-disulfide oxidoreductase, class I [Bacillus cereus 03BB102]
    MSRKIVVVGGVAGGASVAARLRRLSEEDEIIMVERGEYISFANCGLPYYIGDVITERQKLLVQTVERMSKRFNLDIRVLS
    EVVQINKEEKTITIKNVTTNETYNEAYDVLILSPGAKPIVPSIPGIEEAKALFTLRNIPDTDRMKAYIDEKKPRHATVIG
    GGFIGVEMVENLRERGIDVTLVEMANQVMPPIDYEMAAYVHEHMKNHDVELVFEDGVDALEESGAVVRLKSGSVIQTDML
    ILAIGVQPESSLAKDAGLALGVRGTIKVNEKFQTSDPHIYAIGDAIEVKDFVTETETMIPLAWPANRQGRMLADIIHGHT
    DSLYKGTLGTSVAKVFDLTVASTGVNEKILKRLNIPYEVVHVQANSHAGYYPNATPVLIKLIFNKDSGKIYGAQALGRDG
    VDKVWMLSQRQ

    >gi|225862749|ref|YP_002748127.1| NADH dehydrogenase [Bacillus cereus 03BB102]
    MDVIATAIKANLTVLDLPDLELSYAPPYSSAKDPVNMVGYAASNIVDGFVDTVQWHEIDHIVENGGYLIDVREPNELKQG
    MIKGSINIPLDELRDRLDEVPVDKDIYIT
    CQLGMRGYIAARMLMEKGYKVKNVDGGFKLYGTVLPERIAY

    >gi|225862751|ref|YP_002748129.1| rhodanese domain protein [Bacillus cereus 03BB102]
    MSIKVDMSLDCKGLACPMPIVKTKKAIEGLASGQVIEVKATDKGSTVDIKSWANKVGHQYIGTKHEGDILMHYVRKAHEH
    EVNEVVKYPHTITNTELEEILVSGEECTVLDVREAAEFAFGHIPSATSMPLGELESLVLDKTKQIYVV
    CRTGNRSDVACQ
    MLKEKGYTNVKNVIPGMIEWQGNIEN

    >gi|225862752|ref|YP_002748130.1| metallo-beta-lactamase family protein [Bacillus cereus 03BB102]
    MEVKLLQAKDVAEKVLFGELFILDVRNEMDYEDWKIEGKQISSINKPYFDLLDGVDHIVSELPKDKDVLVVCAKEGSSIF
    VAEQLTEAGLENIYYLAGGMKAWSEYVKPIKVGDLKNGGSMYQFNRLGKGCLSYMVVSNGEAAVIDAIRTVEAYEQFAKE
    NDVTITNVMDTHLHADHISGGRKLAEKVGGTYWLPPKDAEEVVFSYEPLVEGSVITMGGTKIEIDALYSPGHTIGSTSFI
    VDDSYLLSGDILFVDSIGRPDLAGKAEDWVSDLRNTLYSRYKELSQSLIVLPAHYSKISEMDESGIVSAKLKDLFEHNAG
    LNIEDEGEFRKVVTENLPPQPNAYEEIRQTNMGKIHPSVDEEREMEIGPNRCAVHE

    >gi|225862754|ref|YP_002748132.1| rhodanese-like domain protein [Bacillus cereus 03BB102]
    MNTILSTLFIVLAAWFVISRFLPVKGVQNISGKQLNNIVGKKGKQLIDVRTVSEYRGNHMKGFQNIPLNELASKASQLDK
    NKEVIVI
    CQSGMRSKQAAKVLKKLGFQHVTNVSGGMNGL

    >gi|225863143|ref|YP_002748521.1| hypothetical protein BCA_1232 [Bacillus cereus 03BB102]
    MVTLYSSPSCTSCRKAKLWLEENHIPYTERNIFSDPLTIEEIKEILRMTESGTDEIISTRSKVFQELNVNLESLPLQDLY
    KMIRDYPGILRRPIMIDEKRLQVGYNEDEIRRFLPRTVRTFQLREAQRLVN

    >gi|225863201|ref|YP_002748579.1| pyridine nucleotide-disulfide oxidoreductase, class I [Bacillus cereus 03BB102]
    MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEV
    TKVDTEKKIVYAEHTKTKDVFEFQYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILQTLETNKVEDVTIIGGGA
    IGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIHKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLV
    SVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRA
    FKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDK
    RIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE

    >gi|225863436|ref|YP_002748814.1| resA protein [Bacillus cereus 03BB102]
    MKKNRLLFRVIILLILSGAVGFTLYQGFFADKEKMQIGKEAPNFVVTDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEM
    PYMNELYPKYKEKGVEIIALDADETDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVVEQIIGEQT
    KEQLEGYLKKITP

    >gi|225863538|ref|YP_002748916.1| rhodanese-like domain protein [Bacillus cereus 03BB102]
    MIVTVEWLREHIEDENVRIIDCRFDLANPNWGREKYEEEHIPHALYFDLNVDLSSPVTEHGGRHPLPNVEEFADKLSQAG
    IDEHKTVIVYDSEAGANASRLWWLLNYVGHEKVYILDGGFPAWKENGLPVTPEIPIVIRKTFKANVQDHMLVTMETVREN
    IDAGKGKDVTLIDSREPKRYAGVEELVDQKAGHIPTAVNYFWKDGMLQSGQFKNEAQQQERFQNLSKDKETIVY
    CGSGVT
    ACPNIVALKLAGFQNVKLYAGSWSDWISYPENQIAKEED

    >gi|225863687|ref|YP_002749065.1| thioredoxin family protein [Bacillus cereus 03BB102]
    MKKLIAIILAGALIWAGVNFYNSKKEEKERKAKQAELQKTEVLPQVGFKAPDITLKGLDGKLYSLNDAKGKPYLINFWAS
    W
    CGPCEMEAPDLVRMYDKYKKDVEIFAVNATIGDPVQEASAFADRHGFKFPVLLDMDGVAGLDYKVFSLPTTFFVNKDGI
    IVEQVRGVLPPDQLEEKFKKLIES

    >gi|225863750|ref|YP_002749128.1| peptide methionine sulfoxide reductase [Bacillus cereus 03BB102]
    MSEKTYELATFAGGCFWCMVKPFDELPGIHKVLSGYAGGHVENPTYEQVKAGTSGHLEVVQITFDPSIFPYEKLLDLYWP
    QIDPTDDGGQFFDRGPSYRTAIFYHSETQKELAEKSKQALAESGMFKDPIVTEIRPAAPFYEAEEYHQHFYKKNPEKYAT
    EQKESGREDFIKENWQKK

    >gi|225863845|ref|YP_002749223.1| rhodanese-like domain protein [Bacillus cereus 03BB102]
    MATTKPYRVLLYYMYTTIENPEEFAAEHLAFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRFDGIVFKID
    EADGHAFKKMHVRPRPELVTLRLEDDINPHEITGKYLEPKDFYEAMKQEDTVIIDARNDYEFDLGHFKGAIKPDIESFRE
    LPDWIRENKEVLEGKKILTY
    CTGGIRCEKFSGWLVREGYEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQ
    KEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEENEAKYLRACSHECRVSPRNRYVIQHELTEEQVAAALEKIEAGK

    >gi|225863880|ref|YP_002749258.1| 2-hydroxychromene-2-carboxylate isomerase family protein [Bacillus cereus 03BB102]
    MTVKMKVYSDFICPFCFLAKGPLDEVAKEKDVEIEWMPFELRPSPYSKIDPWNEPEKLGSWDAFILPTAKKLGIDMRLPR
    VSPHPYTHLAFEGCQFAKERGLGNEYHHRVFTAFFQEEQNIEDIDVLTKLAVEVGLPEAEFKDALVTRKYKEKHQEAIQH
    AYDEANIMAVPTVMIGDEVIQGLASKETLERVIDKEIEKDKTNSFEGMQCNTDGYC

    >gi|225864007|ref|YP_002749385.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus 03BB102]
    MYQAYYESELGLLEITANDKGITSVIFVDERQEERTNEMIDQCINELDEYFKGKRKEFTVPLSAEGTSFQKNVWDALYTI
    PYGVSASYLDIAEKVGNTKAVRAIGGANSRNPISIIVP
    CHRVIGKSGKLVGYAGGLWRKEWLLKHEGILK

    >gi|225864103|ref|YP_002749481.1| glutathione peroxidase [Bacillus cereus 03BB102]
    MTVYDFSAKTITGEEKSLKDYEGKVLLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILGFPCNQFGGQEPGTEADITSF
    CELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGIKAVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE


    >gi|225864115|ref|YP_002749493.1| putative molybdopterin biosynthesis protein MoeB [Bacillus cereus 03BB102]
    MQERYSRQVLFSGIGEMGQRKIREKHVLLIGAGALGAANAEALVRMGIGKLTIADRDYVEWSNLQRQQLYTEEDAKQCKP
    KAIAAAEHVRKINSEVEIVPVVTDVTMKEMEELTKEVDLILDATDNFDTRLLINDISQKENIPWIYGGCIGSYGVTYTIL
    PGKTPCFRCLMDHPMGGAT
    CDTAGIIQPAVQMVVAHQVTEAMKILVDDFETLRGTMLSFDIWNNQFLSLKVNKQKKSTCP
    SCGNTRTYPSLTFESQVKTEVLCGRNTVQIRPGIKRVLNLNEIKKRLQKIVHVQKTPYLLSFLIDEYRFVLFTDGRAFVH
    GTNDVKIGKRLYAKYIG

    >gi|225864288|ref|YP_002749666.1| thioredoxin family protein [Bacillus cereus 03BB102]
    MKEIKSEQEFKDIIASEEPVVVKFFTTWCPDCVRMDNFIGDVMKEFNKFEWYSINKDEFPSIAEEYQVMGIPSLLVYQNG
    EKLGHLHSANAKTEEQVTEFLEAY

    >gi|225864412|ref|YP_002749790.1| hypothetical protein BCA_2517 [Bacillus cereus 03BB102]
    MKKFDVAIVGGGLAGLTASIYLAKAGRKVIVLEKSSRFGGRGMTINKNGICMNLGAHALYRGGAAFLTFNELGMNLPGGI
    PSTKAHGIWKRNIFTIPTDFRSILSTQLLSWSAKVQFLRLMIRLGNLNIGEVPKMSLTTWTENEIKDPMVRNIFYALCRT
    TTYTFAPTIQLASSVLKQIQLSIKEGVFYVDGGWETIITKLRDIANHVGVQFLAKKHVLEIEHYEEKQRIYCFDDEVFEV
    GTVIVTTPPKEACNIIKGAEGTSLHRWSEQSVPVTVAALDIGLRRLPNPTHQFALGLDQPIFFTNQSRAAKLSDDGSIAV
    SLIKYQNPVLEMKHTHEDKGQLESTMDLLHPNWKREVVAQQYLPTIKVVYDFPHINRVETPGPNIPEMPGVYVAGDWAGH
    DEILADAAVASGKRAALHILKQLESEVVHHGNGAII

    >gi|225864520|ref|YP_002749898.1| metallo-beta-lactamase/rhodanese-like domain protein [Bacillus cereus 03BB102]
    MLLKYFYDEKLAHASYLVGCQKEGVAIVIDPGRYIEQYIDFAKKEGMEVIAAAETHIHADFLSGSRELSTLYHTNLYVSD
    EGDCDWKYQYLNEGRYNLVREGTEFKVGHIKFNVIHTPGHTPESISFLVTDTSQNNYTNDKPIGIFTGDFIFVGDIGRPD
    LLETAVGMKDTAKIGAKQLFDSIQKIKTLPDYLQIWPSHGAGSACGKALGAIPTSTLGYEKMFNWAFQCNEESDFISTLL
    TGQPEPPRYFSLMKNLNKYGPPIRKKREIFAIKTVEELQEVMRSVQQIVDIRDVESFASGHIEKSINIPYNNSFTTWCGW
    LLDYKTETLIILDEEKVRVEEVIRDFESIGLDNIIAFAPLQVIQRLDRFESYKEKTSIELYPHIKDGRVKVIDVRSKKEW
    DEGHLHDAIHIPLGNLLKQLDCIPKDCPIVLQ
    CRTGLRSAIAASILQRAGIKGVVNLKGGFLAWKKEELPYITCSFNV

    >gi|225864744|ref|YP_002750122.1| putative thioredoxin reductase [Bacillus cereus 03BB102]
    MKYIDCAVIGAGPAGLNASLVLGRARKQIALFDNKTNRNRVTQNSHGFITRDGIKPEEFKEIGLNEVMKYPSVHYYEKTV
    VMITKQSTGLFEIVTKDHTKYLAERVLLATGMQEEFPSIPNVREYYGKSLFS
    CPYCDGWELKDQPLIIISENEDHTLHMT
    KLVYNWSTDLVIATNGNELSQTIMDELSNKNIPVITESIRTLQGEGGYLKKVEFHSGLRIERAGGFIVPTFFRPNQFIEQ
    LGCELQSNGTFVIDDFGRTSEKNIYLAGETTTQGPSSLIIAASQGNKAAIAINSDIIDERF

    >gi|225864748|ref|YP_002750126.1| acetoin dehydrogenase complex, dihydrolipoamide dehydrogenase component [Bacillus cereus 03BB102]
    MSKLVVIGGGPAGYVAAITAAQNGKNVTLIDEADLGGTCLNVGCMPTKSLLESAEVHDIVRKANHYGVTLNKESISVDWK
    QMQVRKSQIVTQLVQGIQYLMKKNKIKVIQGKARFETDHRVRITYGDKEDIVDGEQFIIATGSEPTELPLAPFDGKWILN
    STHAMSLKTIPKSLLIVGGGVIGCEFASIYSRLGTKVTIVEMAPQLLLGEDEDIAHILRGELENDGVKIFTGATLKGLNS
    YKKQALFEYEGGIQEVNPEFVLVSVGRKPRVQQLNLEKAGIQYSNKGISVNEHMQTNVSHIYAAGDVIGGIQLAHVAFHE
    GTTAALHASGEDVKVNYHAVPRCIYTAPEIASVGLTEKDAKEQYGDIQIGEFPFTANGKALIIGEQTGKVKVIVEPKYQE
    IVGISIIGPRATELIGQGTVMIHTEITADIMRDYIAAHPTLSESIHEALLQAVGHAVHA

    >gi|225864803|ref|YP_002750181.1| carboxymuconolactone decarboxylase [Bacillus cereus 03BB102]
    MEHEQHSSVNDVLHHYKEGIGSFTNQIPEIAETYNAFTQACFQEGALTKREKQLIALGISLATQDEYCTVYHTKGCLDQG
    CSDKEILEACGVSAAFAGGAAMSQAVTLVQECLTELKNQKH

    >gi|225865199|ref|YP_002750577.1| metallo-beta-lactamase/rhodanese-like domain protein [Bacillus cereus 03BB102]
    MLLKYFYDEKLAHASYLVGCQKEGVAIVIDPGRYIEQYIDFAKKEGMEVIAAAETHIHADFLSGSRELSTLYHTNLYVSD
    EGDCDWKYQYLNEGRYNLVREGTEFKVGHIKFNVIHTPGHTPESISFLVTDTSQNNYTNDKPIGIFTGDFIFVGDIGRPD
    LLETAVGMKDTAKIGAKQLFDSIQKIKTLPDYLQIWPSHGAGSACGKALGAIPTSTLGYEKMFNWAFQCNEESDFVSTLL
    TGQPEPPRYFSLMKNLNKYGPPIRKKREVTTINTIEKLQEAMRNVQQIVDIRDVESFASGHIEKSINIPYNNSFTTWCGW
    LLDYKTETLIILDEEKVRVEEVIRDFESIGLDNSIAFAPLQVIQRLDRFESYKEKTSIELYPHIKDGSVKVIDVRSKKEW
    EEGHLYDAIHIPLGNLFKQLDCIPKDYPIILQ
    CRTGLRSAIAASILQRAGIKEVVNLKGGFLAWKKEELPYTTCSLNV

    >gi|225865370|ref|YP_002750748.1| hypothetical protein BCA_3481 [Bacillus cereus 03BB102]
    MVVLYTTASCSSCRKAKAWLEENKIDYTEKNIVSNSMTVDELKSILRLTEEGATEIISTRSKTFQDLNINIDELSLNEFY
    KLIIEHPLMLRRPIMLDEKRLQIGFNDEEIRKFLPRSVRTFLNIELQKLAN

    >gi|225865476|ref|YP_002750854.1| hypothetical protein BCA_3587 [Bacillus cereus 03BB102]
    MTKNNEVGWNLDNSYATLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEIAIFAGNALPEGAHPLAQAYA
    GHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTT
    GEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKW
    QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEAL
    KIAQDEISKFSVQYEKQWFIGMKKKLGLFSNEEQDQSLIEQLLKMMEKYKADYTNTFRSLTLDTLENTPLFDSPEFKEWY
    KLWQSRLEKQEESKENAYEMMKNNNPSIIPRNHRVEEALEAAVTNGDYSVMEKLLEALANPYAYSTDQEEYCVPPAPTNR
    PYRTF
    CGT

    >gi|225865549|ref|YP_002750927.1| putative molybdopterin biosynthesis protein MoeB [Bacillus cereus 03BB102]
    MAERYSRQQLFKPIGDRGQEKIRNKHVLIVGAGALGSANAESFVRAGVGKLTIIDRDYVEWSNLQRQQLYSEEDAREKLP
    KAIAAKNRLEKLNSEVQIDAFVMDACAENLEGLLENVDVIIDATDNFDIRFIINDLSQKHNIPWVYGSCVGSYGMSYTII
    PQETPCLHCVLKNVPVTGVT
    CDTAGIISPTVQIVAAYQVAEALKILVEDFAAIRKTFFMFDIWSNQNHFIKLGKIKTDDC
    PSCGLNRTYPYLSYENQTKVAVLCGRNTVQIRTVESRQYNFDDIEKVLKKLGEVDRNPYLLSCQLDEYHVVIFRDGRVFI
    HGTNDISKAKQLYYRVFG

    >gi|225865594|ref|YP_002750972.1| ahpC/TSA family protein [Bacillus cereus 03BB102]
    MWRKLTIIVVLLCLAGYAAYEQFGKNDQAVQGEQEKSEAAMKEMIASNGIEIGKSAPDFELTKLDGTNIKLSDLKGKKVI
    LNFWATW
    CGPCQQEMPDMEAFYKKHKDNVEILAINYTPSEKGGGVEKVSNFAKEKGITFPILLDKNIDVTTAYKVITIPT
    SYFIDTKGVIQDKFIGPMTQKEMEKRVAKLK

    >gi|225865707|ref|YP_002751085.1| heavy metal-transporting ATPase [Bacillus cereus 03BB102]
    MNEQKEANLQISGMTCAACANRIEKGLKKVEGVHDANVNFALEKTKIMYDPQKTNPQQFKEKVESLGYGIVSDKAEFTVS
    GMT
    CAACANRVEKRLNKLEGVNGATVNFALESATVDFNPDEINVNEMKSAITKLGYKLEVKSDEQDGSTDHRLQEIERQK
    KKFIISFILSFPLLWAMVSHFSFTSFIYLPDMLMNPWVQLALATPVQFIIGGQFYVGAYKALRNKSANMDVLVALGTSAA
    YFYSVYLSIQSIGSSEHMTDLYFETSAVLITLIILGKLFEAKAKGRSSEAIKKLMGLQAKTATVMRDGTEMKILIEEVVA
    GDIVYVKPGEKIPVDGEIVEGKSAIDESMLTGESIPVDKTIGDVVIGSTMNKNGFLKVKATKVGRDTALAQIIKVVEEAQ
    GSKAPIQRVADQISGIFVPVVVVIAIITFAVWMIFVTPGDFGGALEKMIAVLVIACPCALGLATPTSIMAGSGRSAEYGI
    LFKGGEHLEATHRLDTVILDKTGTVTNGKPVLTDVIVADGFNEEEILRLVGAAEKNSEHPLAEAIVEGIKEKKIDIPSSE
    TFEAIPGFGIESVVEGKQLLIGTRRLMKKFDINIEEVSKSMEELEREGKTAMLIAINKEYAGIVAVADTVKDTSKAAITR
    LKKMGLDVVMITGDNTQTAQAIAGQVGIEHVIAEVLPEGKAEEVKKLQEQGKKVAMVGDGINDAPALATADIGMAIGTGT
    DVAMEAADITLIRGDLNSIADAIFMSKMTIRNIKQNLFWALAYNGLGIPIAAFGFLAPWVAGAAMAFSSVSVVLNALRLQ
    RVKLK

    >gi|225865708|ref|YP_002751086.1| copper-ion-binding protein [Bacillus cereus 03BB102]
    MEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSVVTLKDIVAVIEDQGYDVQ

    >gi|225865719|ref|YP_002751097.1| methylated-DNA--protein-cysteine S-methyltransferase [Bacillus cereus 03BB102]
    MNSYKNKFIYWTLLTHANWKFHIAATESGLCFIGSQDEQFEELNIWARKKLPQYILIHSPDYLQVYTKEIIEYLKNKRET
    FTFPIDAYGTAFQLSVWNTVREIPYGKTYSYTEIADRIQKPTAVRAVASAIAANPILITIP
    CHRVIGKNGKLTGFRGGLE
    MKKELLVLEKLQVEFI

    >gi|225865951|ref|YP_002751329.1| pyruvate dehydrogenase complex E3 component, dihydrolipoamide dehydrogenase [Bacillus cereus 03BB102]
    MVVGDFPIELDTVVVGAGPGGYVAAIRAAQLGQKVAIIEKANLGGVCLNVGCIPSKALINAGHRYENAMHSDDMGITAEN
    VKVDFTKVQEWKNGVVKKLTGGVEGLLKGNKVEIIRGEAYFVDANTLRVMTEDAAQTYTFKNAVLATGSTPIEIPGFKYS
    KRVINSTGALSLPEIPKKLVVIGGGYIGMELGTAYANFGTEVTVVEAGDEILAGFEKAMSSVVKRALQKKGNVNIHTKAM
    AKGVEETETGVKVSFEVKGEIQTVEADYVLVTVGRRPNTQEIGLEQVGVKMTDRGIIEIDEQCRTNVPNIYAIGDIVPGP
    PLAHKASYEGKVAVEAISGHASAIDYIGIPAVCFTDPELASVGYTKKQAEEAGMTVTVSKFPFAANGRALSLNSTDGFLQ
    LVTRKEDGLLVGAQVAGAGASDIISEIGLAIEAGMTAEDIAQTIHAHPTLGEITMEAAEVALGMPIHIVK

    >gi|225865970|ref|YP_002751348.1| glutaredoxin family protein [Bacillus cereus 03BB102]
    MKKIEVYTQPDCPPCVIVKEFLKHNNVVYEEFDVKKDAAARNRLLYDYDSYSTPTVVIDGEVVAGFQIEKLQQLLNIE

    >gi|225866108|ref|YP_002751486.1| Na+/H+ antiporter NhaC [Bacillus cereus 03BB102]
    MVSKIESVLLTIFIFFCIGFSVIKLEVSPHIPILFGIVLLLAFGFMKKIDWSTMEKGMISSISAGIPSIFIFLLVGVLIS
    VWIAAGTIPTLMVYGFQLVSPKIFIPTVFVV
    CAIVGTSIGSAFTTAATVGLAFMGMGSALGYDPALIAGAIISGAFFGDK
    MSPLSDTTNLAPAVTGVDLFEHIRNMLWTTVPAFIIAFIAFFILGSGTSGDVDFTNFISTLEKNATISIFTLIPILLLFL
    FAFKKVPAVPTLLAGIIVGIIILFIFKPSTSLTDLMKIMQDGYVSKTGIKDIDSLLSRGGLQSMMMSIALIFLALCMGGL
    LQGMGIITQLMNIISSFVKTSTRLIISTASTAIGVNFLLGEQYLSIVLTGQAFANKYDEVGLERRNLSRVLEDAGTVINP
    LVPWGVSGVFLSNVLGVPTFDYVPFAIFCLACPIVTIIVGFTGFGLSWKKEKAVTIS

    >gi|225866145|ref|YP_002751523.1| 3-methyl-2-oxobutanoate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Bacillus cereus 03BB102]
    MAKEYDLVIVGGGTGGYVAAIRASQLGLKTALVEKENLGGTCLHKGCIPSKALLRSAEVYATAKKSEEFGVIASNVELNF
    AKVQERKEKIVTQLHKGVQHLMKQGKIDVFEGIGRILGPSIFSPMPGTISVELASGEENEMLIPKNVLIATGSRPNSLPG
    LELDGEYVMSSDHALKMETLPSSIIIVGGGVIGIEWASMLADFGVEVTVLEYAKTILPLEDQDVSKEMQRLFKKKGIKVV
    TGAKVLPETLVKDNGVTIQAEHNGENREFKAEKMLVSVGRQANTQNIGLENTDIVVEKGYIQTNEFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIVAVEHIAGKEVTPIDYSMVSKCVYSSPEVASVGLTEQEAKEKGYKLKVGKFSFRAIGKALVYGES
    DGFVKLVVDEETNDILGVHMIGPHVTDMISEAGLARVLDATPWEVAHTIHPHPSLSEAIGEAALAVDGKALHA

    >gi|225866192|ref|YP_002751570.1| rhodanese-like domain protein [Bacillus cereus 03BB102]
    MSTTWIILLAVIVAFIGYTVWMYFYQKKLITTLSEEEFRAGYRKAQLIDIREADEYTAGHILGARNIPLSQIRLRHKELR
    KDQPVYLY
    CQSGFRTGRAAQYLKKQGYKDFYQLQGGFKTWTGKIKKK

    >gi|225866449|ref|YP_002751827.1| organic hydroperoxide resistance protein [Bacillus cereus 03BB102]
    MDKLYTASVTATGGRNGKVVSDDGILNLDVKMPKALGGAGGEATNPEQLFAAGYAACFDSALQLVIRTKRVKVESTEVTA
    HVSIGKDTDGGFGLSAVLDVHVAGVSHSEAQELVEAAHGV
    CPYSKATRGNIEVTLNVR

    >gi|225866495|ref|YP_002751873.1| thioredoxin [Bacillus cereus 03BB102]
    MAIVNANDQSFAAETSEGVVLLDFWAPWCGPCKMIAPVLEEIDAELGEKVKVVKVDVDENQETARQFEVMSIPALFVLKD
    GKVVDQALGYKPKEALVELVSKHF

    >gi|225866620|ref|YP_002751998.1| thiol peroxidase [Bacillus cereus 03BB102]
    MANVTFKGNPMTLVGTEVKVGDQAPNFQVLANDLSPVSLETYKGEVKLISVVPSIDTGVCDAQTRRFNQDAAGIENAKVL
    TISADLPFAQKRWCAANGLENVVTLSDHRDLSFGEAYGLVMKELRLLARAVFVVDSNDKVVYVEYVSEGTSHPNYEAALE
    AAKAAK

    >gi|225866682|ref|YP_002752060.1| thioredoxin family protein [Bacillus cereus 03BB102]
    MKSLESMEQFQQLKNEENVVFMFSAEWCPDCRFVDPFMPEVEEKYSDFSFYYVDRDEFIDLCVKLDVFGIPSFVAYNKGE
    ETGRYVNKDRKTQEQIEEFIEGLK

    >gi|225866696|ref|YP_002752074.1| conserved hypothetical protein TIGR00275 [Bacillus cereus 03BB102]
    MHYDVIVIGGGPSGLMAAIGAAEEGASVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNN
    EDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVVLKTGEVLETNHVV
    IAVGGKSVPQTGSTGDGYAWAKKAGHTITELFPTEVPILSNEPFIQDRSLQGLALRDVNLSVLNPKGKAIISHKMDMLFT
    HFGLSGPAALRCSQFVVKAMKKFKTNTVQMSIDALPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLEKNE
    IDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYN
    ITSALVTGRIAGTTAGENAKMQY

    >gi|225866713|ref|YP_002752091.1| putative molybdopterin biosynthesis protein MoeB [Bacillus cereus 03BB102]
    MQERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKITIADRDYVEWSNLQRQQLYTEEDAKQYKP
    KAVAAAEHLKAINSEVEINPVVTDVTVQEMEELVKDVDLILDATDNFETRLLINDISQKYNIPWIYGGCVGSYGVTYTIV
    PGKTPCFRCLMEHPASGAT
    CDTAGIIQPAVQLVVAHQITEALKILVEDFEALRETMLSFDLWNNQQMAFKVNRQKKDTCL
    SCGRLRTYPSLTFEAQTKTEVLCGRNTVQIRPGVRNEFNLEEIKKRLQRSVDVKATPYLVSFLVEEFRFVLFTDGRAFIH
    GTNDINVAKRLYTRYIG

    >gi|225866718|ref|YP_002752096.1| rhodanese-like domain protein [Bacillus cereus 03BB102]
    MTEVKTITTEEVQERLENGETLFLVDVREDEEVAAGKIPEAVHIKMGDIPNKVDFFDKENEYIFICRSGMRSENVCHYLN
    EQGFKTVNMVGGMLQYEGETK

    >gi|225866763|ref|YP_002752141.1| hypothetical protein BCA_4898 [Bacillus cereus 03BB102]
    MYVTVTEAAYKKIMDTIPNEAKYIKLFYDNEGCGCVMSGIIDLVAVAEKDERDVDIESSAMNFIADRTKLVFMDDKLTVD
    WHEGGGTFQLKSPSQFYNPNMKLHVRV

    >gi|225866909|ref|YP_002752287.1| hesB/yadR/yfhF family protein [Bacillus cereus 03BB102]
    MIEVTEQAAFQIKDMLKDAEDGEKYVRLAVHGGGCSGLSYGLGFEVEPKEDDTVLEFFGVEFVIDKESAPIVKGVKIDYK
    QSMLGGGFTIDNPNAIASCGCGSSFRTASNAGKPEEC

    >gi|225866912|ref|YP_002752290.1| pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus 03BB102]
    MKHLVILGGGYGGMRILQRLLPSNQLPDDVQVTLIDKVPYHCFKTEYYALVAGTISETHIRIPFPEHPRLNIQYGTVTNI
    DLEEKAVHLDGGEAIQYDDLIIGLGCEDKYHNVPGAKEYTHSLQSIEQTRKTYEQLNSLEPNATVAVVGAGLSGVEVASE
    LRESRSDLKIYLFDRKDRILFPYPEKLSRYVEEWFVKHKVTIIRNSNITKVEPNIVYNHDEPLECDAIVWTAGIQANEVV
    RNLPVEQDGSGRVVLTKYHNIPNNEHVYVVGDCAALPHAPSAQLAEGQGEQIVQILLKRWHNEPLPDELPVIKLKGVLGS
    LGKKHGFGLLANQPLMGRVPRLLKSGILWMYKYHNG

    >gi|225866961|ref|YP_002752339.1| putative thioredoxin [Bacillus cereus 03BB102]
    MIEVIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVEMTIEDLKIGMLDLNYAPHFAKEYGIESVPCLLVFE
    NGTLMKKIYAFHSVEYLYTELK

    >gi|225866964|ref|YP_002752342.1| hypothetical protein BCA_5127 [Bacillus cereus 03BB102]
    MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASED
    EMYELLASDGMLIKRPIVTDGTKVTLGFNEEQFESVWKKYQ

    >gi|225867087|ref|YP_002752465.1| glutaredoxin family protein [Bacillus cereus 03BB102]
    MKVVLYTKKDCGLCVKAKQVLQEVQCEYSFQIEEIDIYEDNDLLEKYHLMIPVVEIDEKQVEYGNIHKGVIINYIKNAVK
    S

    >gi|225867120|ref|YP_002752498.1| thioredoxin-disulfide reductase [Bacillus cereus 03BB102]
    MSEEKIYDVIIIGAGPAGMTAAVYTSRANLSTLMLERGIPGGQMANTEDVENYPGYESILGPDLSNKMFEHAKKFGAEYA
    YGDVKEVIDGKEYKTIIAGKKEYKARAIIVASGAEYKKIGVPGETELGGRGVSY
    CAVCDGAFFKGKELVVIGGGDSAVEE
    GVFLTRFASKVTIVHRRDTLRAQKILQDRAFQNEKVDFIWNHTIKEINEANGKVGSVTLVDVNSGEEKEVKTDGVFVYIG
    MLPLSKPFVELGITNENGYLETNERMETKVPGIFAAGDVREKMLRQIVTATGDGSIAAQSAQHYVEELLEELKTVSEK

    >gi|225867419|ref|YP_002752797.1| peptide methionine sulfoxide reductase [Bacillus cereus 03BB102]
    MAVNEKVELATFAGGCFWCMVSPFEEMEGIIKVVSGYTGGHKENPTYKEVCSETTGHYEAVQITFDANKMPYEELLNIYW
    RQIDPTDVGGQFHDRGQSYETVIFYHNEEQHKKAEDSKEELAKSGRFSKPIATKILPAATFYPAEEYHQGYHKKNTFRYE
    LYRKGSGRDAFIKQHWPKDNAHLKEKLNEMQFYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSLDKFDSGCGWP
    SFTKPVMSASVKEKMDVSHNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRY
    CINSAALRFIPKEELEKEGYGDFLMLFGNK
    K

    >gi|225871588|ref|YP_002752946.1| hypothetical protein BCA_A0099 [Bacillus cereus 03BB102]
    MKKIYKIGAVITTLCVIGITIFTLTKNESVKTEIVTPEKTIVSAADVKEAPENIKDISKEELKQKIQSHEEFIAYYYQPT
    CHFCKKAAPDIHSMSKKRDRTIYRIDISTPENQSAFQEFDIPGTPVVVAYNRGEEVERLEGAVSAATYDGFFARRNSSAS