Prosthecochloris aestuarii DSM 271 uid58151

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|194332864|ref|YP_002014724.1| Flavocytochrome c sulphide dehydrogenase flavin-binding [Prosthecochloris aestuarii DSM 271]
    MSSKITRRGFNKLILSGIAGSSLATFGGATPLFANQKKVVVVGGGFGGASAAKYIRKLDPSIAVTLIEPNSTFYTCPFSN
    WVMGGLKEMSDIAQTFDVLKNKYNVDVIHDTVTGIDPINHSVTLQGGKEVKYDRLIVSPGIDFNYEAVEGYSEEVANTKM
    PHAYKAGPQTELITRQLKEMKDGDNVLICPPGNPFRCPPGPYERASLIAHFLKKNKPNSKIIILDDKEKFSKQGLFMKGW
    ERLYSDIIEWRSGSMGGKVSAVDPEAMTVETEFGPEKGGVINIIPPQMAGKIARDAGLTDSSGWCPVNPITFESTIHSGV
    HVIGDACIAGAMPKSGFAASSQGKVAAAGIIRLMQGKVPAPPSLVNTCYSLVAPGYAISVAAVYKLTSDGIVSIKGAGGL
    TPMDADDDQLSEEATYARGWYKNISQDIWG

    >gi|194332878|ref|YP_002014738.1| Rhodanese domain protein [Prosthecochloris aestuarii DSM 271]
    MLRYSDMVSNCLERVREIMPWDLVDRMKENPSLMILDVREPGEFEAMHIPGSLNVARGILESACEWDFEETVPDLVRARE
    REIVVV
    CRSGRRSVLAVDTMQQMGYADVVSLKTGLRGWNDYDEPFEDGSGVGVSPSVADSFFLSGVRPDQTSSHERS

    >gi|194332886|ref|YP_002014746.1| sulfur relay protein TusD/DsrE [Prosthecochloris aestuarii DSM 271]
    MNIGILLKEGPYNHQASDTAYKFAEAALARGHKVDAVFLYNDGVTNVTRLMDPPQDDRNIAERWSRLSKEHGVEVLACIA
    ASKRRGISDEILIEGGEITGLGTLTDIAIRNDRLITFGD

    >gi|194332904|ref|YP_002014764.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Prosthecochloris aestuarii DSM 271]
    MSPLKAFAIACLSVSMIACQPQKAQTAKPAATKTISAPEFSAVALDGSSVSSDELKGKAYIINFFASWCPPCRAEIPDMV
    ELQAEYEKKGFTFIGIAVNEDEDRMRDFISSNGINYPVVMVDQQIIDAYTPYAQGGLRSIPTSFVISADGSLSSVVVGAQ
    SRTAFADLISGALESGGQ

    >gi|194332939|ref|YP_002014799.1| methionine-R-sulfoxide reductase [Prosthecochloris aestuarii DSM 271]
    MSKEPLPSNPYYSRTDTTKLDLPDSVWEKVLSPEVYEVARQAATERAFSGKYWDYEGIGTYYCAVCGNALFRSDSKFASS
    CGWPSFFETVRPGSVEYRADSSFGMRRTEVLCGRCGSHLGHLFDDGPPPTGKRF
    CMNSIVLEFDSDDGGQ

    >gi|194333072|ref|YP_002014932.1| Methyltransferase type 11 [Prosthecochloris aestuarii DSM 271]
    MLYQFENWKRFTSDGIAIYASTSTANWFVPNPAGDQLLDHLARPGALNGSAEHLAFLARLPSAVDNAYEGRSRLLKLEHI
    RELWLHITNRCNMACSHCLFASSPEEQEELCAERILELAEEAWGAGCRLFALTGGEPLVHREINTIIRGLLDLQDAHVVI
    LTNGLLADRVTTAFTDDLDRIHLQISLDGIGEKHDELRGKGAFSRLTSTLQQLHAQAVPVTLSMCVTRDNMQDMEDVIVF
    SKEHGVTNVHFMWYFVRGRGEEQQFVDPLKIFGNLRRAAAKAEQLGIHIDNIESLKTQVFAPPGTIHDGSTAGWESLAIG
    PDDKLYPTAALVGVAELATPLDKGIVAAWKESPVLERIRKTSIVDDSSPLRHILGAGDLDHCYLSNGTFSGADPYMPLHE
    AIALWLITAKLPDTPESRKPAIRLQMGEILESCGAHGSISLIHSNCLLATATNESLSSIQEFYSSATGDSNKEILNPVGY
    DTSLISHIPQAYRFRGYGCGSPVMDAAIEEGEQVVDLGCGSGVECFIAARMTGRNGSVTGIDMLDPMLELAAKAAPGVTD
    ALGYSNVTFRKGMLEELPLETGSADVVLSNCVMNLSLNKRQSYSEILRILKPGGRMVISDVVCETEPDAAIRNDETLRGE
    CIAGALSESHLLALLAESGFDAIRLIKRFPYRVVNGHQFFSLTYTASRPQQKEPVKVMYRGPLPWILSNGGTLLARGKSV
    TIDRAEAEGLGDSLFLFDENGYVTNVEGENCCSCAIAPEEQPATAESLKPSQDESHRSGCMVCAKPLIYEEEEHSRTCSY
    CGQTFKTQTVCSEGHFVCDNCHADDAVDVIRHLCLTTEETDMLKLFEHIRSHPATNIHGPEYHAMVPGIILATWRNLGGD
    IIDMNIESGISRGKTIVGGSCGFMGICGAAAGAGIAFSIMLKANPLKAKERKSAQQVTAAILAHIARLKAARCCQRDCWI
    ALTKSAELSRELLAIPLKADHSVSCTQKELNNECLGKGCPIY

    >gi|194333157|ref|YP_002015017.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Prosthecochloris aestuarii DSM 271]
    MQKNVDILVIGGSAAGIVAATTARAFYPDKAVMIVRKEQKAVVPCGIPYIYGTLKSIEQNIIPAGHITDAGVEMMIDEVV
    SIDSEKKTATTVSGTVISWDKLVIATGSVPKVPGWLKGTDLDNVFTIPKDCQYLDHVQHAMEGSRKVVIIGGGFIGVEIA
    DELSKKGLDITLVELLPHVLQMAFDEEMSVRAEEILTTSGVKLKLGCKVEEIEGDGKVTGVRLDGGEVLEADLVILSTGY
    LPNTTLAADAGIKLNELGAIRVDEYMRTENKDIFAVGDCAEKFSFFTRIVKGLMLASTACSEARIAGMNLYKLSRLRTFG
    GTLSIFSTAIGGTTFAAAGVTEQMAIERGFDIVSASAEGIDKHPKTLPGVHAQRVKLIVNRESGLVLGGSVIGGVSAGEL
    INVIGVIIESMMTIHQVLTLQLGTHPLLTGPPTGYPLLKAAENVAKKMRQ

    >gi|194333594|ref|YP_002015454.1| FAD dependent oxidoreductase [Prosthecochloris aestuarii DSM 271]
    MHYSADVIIVGSGIGGLTAAALLQERGFTTLTIEKNMYPGGSCASFRRKGYTFDVGASVFYGFSDNDDHGTLNLHSRIFR
    RLGLSVATIADPVQIHYHLPNGLDVPVYYRQQAFLTELKRHFPHESGGIDRFYRELESVYEILSALPAGSLEDIVHIAKV
    GGTHFGKTIALALKTLKSMGRTARKYIRDPELLRFIDIESYSWAVQDAVSTPLVNAGICLADRHHGGINYPLGGSGAIPA
    ALCEGIEKFGGKILYNSEVQEIIVRNGKAEGVRLSGGEELLSKAVISNATIWDTCNRLLKDPRYRIAEERFLRAPSWFQM
    YLGVDAGVVPEGFHVHHVMVDDWQRYDQPGGTIYFSAPSILDPSLAPEGRHVIHAFVTDESSRWSHLDRGDVSYRKAKED
    FAGSLLRRTEKILPGLSDAVELSVLATPLTHERYLNRFRGSYGPLLHPGQNVLLKPQNRTAVKNLYAAGDSTFPGQGVIA
    VTYSGVSCASYIARSLGNPLEYL

    >gi|194333609|ref|YP_002015469.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Prosthecochloris aestuarii DSM 271]
    MKLLAHGDPAPLFESVDQDGQPVKLVDYKGKKVILYFYPKDDTPGCTKEACAFRDNFPKFKEIGVEVLGVSVDSEKRHKK
    FTEKYDLPFRLVVDEEKTIVEHYGVWGLKKFMGREYMGTARVTYLINEEGVIDMVWPKVKPEKHASEIVAYLEQNN

    >gi|194333663|ref|YP_002015523.1| Redoxin domain protein [Prosthecochloris aestuarii DSM 271]
    MAEITLKGNPVNTVGSLPQTGAAAPVFTLVKADLSEASLADFAGKRVVLNIFPSLDTPVCAASVRRFNLEVANVPNTVVL
    CISADLPFAHKRFCEVEGIDNVVSLSVFRSPEFGLDYGVTIADGPLKGILSRAVIIVDESGKVTYSQQVPEITIEPDYEA
    ALQSMV

    >gi|194333694|ref|YP_002015554.1| Thioredoxin domain [Prosthecochloris aestuarii DSM 271]
    MAKKTLDELIGESTMPVFIDFYADWCGPCHSIAPSIIKLAQEFSGRLTVVKINVDEQPEAAARYQVQGIPALMLFDKGSV
    IWRTSGALAYPRLKAEVSKALGWG

    >gi|194333752|ref|YP_002015612.1| thioredoxin [Prosthecochloris aestuarii DSM 271]
    MGKYLTATDQNFKAEVLDSGKVALVDFWAAWCGPCQMLGPVIEDLAGDYEGKAVIAKVNVDENPNIAAEYGIRSIPTMLI
    FKNGEIVDQMVGAMPKNMIAEKIDAQLA

    >gi|194333753|ref|YP_002015613.1| thioredoxin reductase [Prosthecochloris aestuarii DSM 271]
    MANQVRDVVIMGTGPAGLTAAIYTGRTNLKPLVIDGVQPGGQLMITSEIENFPGFPSGIRGPELMDKFREQAARFDVEFA
    LGNVREVDLSRKPFCLYLDDEREVLTRSLIIATGANARWLGLPSEEQYRGRGVSA
    CATCDGFFFRDSEVFVIGGGDTAME
    EALFLTRFARHVTVVHRRNEFRASKIMSLRAEKNEKISVELNQVVEEILGDGRKVTGIRLKNVVSGESNTHSCDGVFIAI
    GHSPNSGLFEGQLDIDEYGYIETAGSSSVTSVQGVFACGDVQDYTYRQAITAAGSGCKSALDAERYLESIR

    >gi|194333936|ref|YP_002015796.1| redox-active disulfide protein 2 [Prosthecochloris aestuarii DSM 271]
    MKNIKVLGTGCANCKQLESMVRKAVEASGTEAVVEKVEDIEEIMSYNILSTPALVIDEEVKCSGRIPSQEEIQSLIA

    >gi|194334015|ref|YP_002015875.1| thioredoxin [Prosthecochloris aestuarii DSM 271]
    MDNEQFDFSCDVLEQSHDIAVLVDFWAEWCGPCRMLAPVLESVVARFNGKVVLVKINTEEHPAVAQKFNIRSIPNVKLFI
    DGKVADEFTGALPEAQIEQWLRKALPSPYTGEIRLARGLGQQGKQQQAISILEEVLLNEPDNIEATALLVRLTLFTKPTE
    AGKLIGRLEGESEYAEFAGSVRELVSMLVKKIDELPEDHVRDRYAAALLQLQAQDFNAALDGFIKVIKENRYYDDDGSRK
    ACIAIFKYLGEDHTVTLKHRRVFDRALY

    >gi|194334052|ref|YP_002015912.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Prosthecochloris aestuarii DSM 271]
    MNYDYDVTVIGGGAAGLTAAGVAASLGAKTALVEEKKLGGDCTWYGCIPSKTLLKAAKAAHTIRHAARFGIETHGEISIN
    FETVMRRVHEVQQQIYQEADAPEIYEKMGVTVLYGKAAFVDEHTITIETGQSGISTLQSKNVIIATGSRPITPPIPGLEK
    VSYVTNEQLFSLKKQPRQLLILGAGPIGIEMGQAFCRLGSKVHVFDAEEHILPKDHPELTAILQKVLEQEGMTFHLQYRV
    TQVDEMDGIITVTAEEETTGRTIQLTGDALLVAAGRAANTENLNLEAAGVTTHKRGITVNQYCQTSRSHIYACGDVAGGM
    QFTHIAEHMAKIAAGTMLTHLPLQTDDRHIPWCSYTEPEIAHVGETEAELHARHAGHEVYRFPFNRIDRAITEDATEGWI
    RIYAAEFDGKIFGADILGAHAGELISEIGLAMRNGITLRQLSDTIHPYPSYALGNRRAADQWYVRKQSGTIVGLLQFFFG
    YQGQKPDTSDPDRIV

    >gi|194334064|ref|YP_002015924.1| OsmC family protein [Prosthecochloris aestuarii DSM 271]
    MSSMVITSGGGKKVNAEYRGFTIETDQSVKNGGEASAPEPFTLFLASIGTCAGIYVYSFCEQRGIPSENIRLVQHHFKKE
    DGRGIGKITIDIEVPPDFPEKYYDALVKSANLCAVKKHIQDAPEFEVMTRVRQS

    >gi|194334125|ref|YP_002015985.1| electron transport complex, RnfABCDGE type, E subunit [Prosthecochloris aestuarii DSM 271]
    MNEAVNILTRGFVRENPVTKMLLGLCPVLAVTTSAYNGLGMGLATTFVLLGSNVVISLAAKAIPNTVRIPSFILVIATFV
    TIVDLLIKAYSPELNQALGIFIPLIVVN
    CMILGRAEAFASRSGVWYSVIDAIGMGLGFTFALLLLSVFREVLGSGTIFNI
    PLVGEDASTMLVFALPPGAFAGLGLIIAGLNALEKKKGNK

    >gi|194334126|ref|YP_002015986.1| electron transport complex, RnfABCDGE type, A subunit [Prosthecochloris aestuarii DSM 271]
    MAEILLVIVSAIFVNNVVFARFLGICPYLGVSRNIETALGMGFAVTFVMTIATALGYVLQKAVLIPFHIEFMQTVMFILV
    IASLVQLVEIILKKVSKSLYRSLGIFLPLITTN
    CAILGVALISIQEDYDLLTSVVFAFFSAMGFILAILMFAGIRVKLEE
    ADVPAVFKNVPIGFISAAILSLAFMGFSGLVK

    >gi|194334202|ref|YP_002016062.1| peptide methionine sulfoxide reductase [Prosthecochloris aestuarii DSM 271]
    MKGFKTVLVMVMCSMFSFIIISCATAGDDNDSSMKQANNGLKESEMGYRVLTSEEERVIVGKGTEMPFSGKYVDFHEEGT
    YVCRRCDAPLFRSSDKFESGTGWPSFDDEIPGAVTRKTDADGRRTEILCANCGAHLGHVFLNEGLTGKNVRH
    CVNSISLD
    FKGADDRAIKPAQVSEKAIFAGG
    CFWGMEYHFGKVNGVLGTTVGYTGGSKEDPTYREVCSGKTGHAEAMEVEFDPAVVTY
    EELARLFFEIHDPTQVNRQGPDIGTQYRSAVYYVDDTQKAIAEKLIGQLKENGYAVVTELEKANAFYPAEEYHQDYYEKT
    GHQPYCHIYQKRFK

    >gi|194334203|ref|YP_002016063.1| protein of unknown function DUF255 [Prosthecochloris aestuarii DSM 271]
    MTMKEKNKVPNALSKEKSPYLLQHAYNPVQWLAWGPDAFNTSLREDKPIFLSVGYSTCHWCHVMERESFENDEIAQVLNH
    SFVPVKIDREERPDIDRLYMAYVQASTGSGGWPMSVWLTPELKPFYGGTYYPPEDRFGRPGFLSLLHSIADAWKEDRKKL
    EHVADGIQSQLKSFSTAAPHPESLGEKVLDDAFMQISSHFDPVAGGFSSAPKFPRPSILTFLFNYAYFTGREEASAMALL
    TLERMARGGIHDHLGVKGKGGGGFARYATDALWHVPHFEKMLYDNALLALSFLEAFQLTKETLYAQTAEDIFNYVLCDMT
    SPEGAFYSAEDADSFPDRESKTKIEGGFYVWTKTEIAELLDPLEEQIFSFRYGVKQNGNVLEDPHGTFERKNILSLKADE
    ETTAKHFDLPTDQVANLSRSAIEKLFQARMRRPRPDRDDKIITSWNALMISALAKGSRVLQNTDYLTAAEKAAGFIGDNL
    FENGTGNLLRRYCKGESGITGQAEDYAFLIQGLLDLYEASFDDSLLHKAQELAERQCEHFYDDEHGGFFNASSQEASVPI
    RLKEDYDGAEPSANSVSVMNFSRLWLMTGKQHYLDIAEKTLYYFSAILAANGMQLPEMLAGYARLLHPSNTVILTGSQSD
    PAFKALKKSVEQLYLPGTTVMHATKEKPVSSIPGAETASEENNSAAAYICKGGSCRLPVTTPEEVTNLLRPSGRSAGKKS


    >gi|194334246|ref|YP_002016106.1| dihydrolipoamide dehydrogenase [Prosthecochloris aestuarii DSM 271]
    MEEHDMHTQSDFDLAVIGSGPGGFEAAVRAARKGLTVCVIERGALGGVCVNWGCIPTKALLRSAEIFRLAGESSAFGLDI
    EASSIDLARAVKRSRKVVLLASKGVESALKKNKVTVFQGEATFVDERTLRVSRDGQEDERLTAKHIIIASGARPREIPVL
    PVDGRHIMTSREALALKSAPERMIVVGGGAIGLEMAWYYHSAGTKVTVLEMLPRLLPLEDKEVSEGLERLLKKAGISIHC
    EAAVVSASAGDDGIVDAVVRMKDGSEQKMQGECLLVAAGVVPNSGGLQLDAAGVILERGFIATDAQCRTNVDHIYAIGDV
    RGGMQLAHKASAEAVIAVESITGGNPMPIDDAMVPRCVYVEPAVAAIGASQEDAAAEGREVMVGRAMFAASGKASAYGFR
    DGFVKLIFDAGSGVMIGGHVLGHGAVELIGELSLAMRLGATADQIASTIHAHPTLSETVREAAENAVVA

    >gi|194334338|ref|YP_002016198.1| Thioredoxin-disulfide reductase [Prosthecochloris aestuarii DSM 271]
    METLHCDVAIIGGGPAGCSAAIYTARADLDTVIIDKDPHAGALGMAHIIANYPGMGNDITGMELLESMRRHAGSFGARFM
    KQKVNGIDVRNPEKTVFTTSGTMFKAKALILATGSMGKSRELPGEKELLGAGVSY
    CATCDAAFYRQKVVAVAGRTREAVE
    EALVLSRFASKVYLFCPTASLTAPPEDIHMLQEQKNIEVFYSRRLDAINGGKFVESVTLGAPEEVVAVDGVFLYLTGSAP
    VLDFTGGQLDVCQSGCLQVDKDFMTSVPGVFAAGDILCKEVKQAVIVASEGCRAALQVDKFLRGRDRARSDYQ

    >gi|194334393|ref|YP_002016253.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Prosthecochloris aestuarii DSM 271]
    MGVLVGREAPDFSLDAVVDGGKMVDSCKLSDYRGKYVVLFFYPLDFTFVCPTELHAFQDRIDEFRHKNVEVMACSVDSKF
    SHHAWLNTPRSQGGIQGVTYTLLSDINKEAAKAYDVLAEAEGVSYRGLFLIDREGIVRYQVVNDLGLGRNVDEVLRMVEA
    LQFTEEFGEVCPANWHKGARTMKPTDEGLKEYFKSE

    >gi|194334642|ref|YP_002016502.1| thiol-disulfide interchange protein DsbD precursor-like protein [Prosthecochloris aestuarii DSM 271]
    MRLRRIFSLIILLNLAVHASLTAAMAFVFMEDTAEPVKAELFAAGELDDGGLLVAVHLTIQPGWHLYWEHPGEAGMPVSI
    TWRLPEGYRALPLEFPLPGRFEAAGLIGYGYDEEVVLFSAIVPQVPGNSQRLRSDLFPLQAEVSWLSCRESCIPGSASLR
    LETGEPDSSRSGLVDLWRSKVPVASSSATVAVERFVLEEVNGDFRLRADLAGPDADAINGFFPLSPLEGLDLKGIEAAPG
    RLFLPLKGADFPETVSGVLVTGNGAYRTEKIPVEISSGSSAPDDAGSLGAMLFLAFFGGMLLNIMPCVLPVLGLKVFSLI
    GPGGDRAAGRFLSLVFAGGVLFSFWVLAAFIWGLQAMGAQVGWGFQFQSPAFVMFMAAVVFAFALNLFGVFEFSAPVVSG
    RLGRLASHHDSAGAFVSGVLATTLATPCTAPFLGTALGFAFAQPPGIIFLIFTVIAAGMAMPYVVLAWHPSWLKFLPRPG
    QWMYRFKQIMGFILVAVVVWLASILGSQGGSPAMLNLFVLLFAVSFVLWLTGLFTAPGTSTLRQALVWLITIGFLAGAYM
    LLSGRIGTISSDSRNSLEPGSHTDGNGVVWLDYSPDVLDTLLKEEKSVLIDFTAEW
    CLTCKVLEASVLGNEEIGRALKRE
    GLVAVRADWTSRNDEITALLQRFGRSGIPLLVIIPQGRIDNAVVLPEVVTVDMLLDALSGVSGDSLSKLQGNM

    >gi|194334700|ref|YP_002016560.1| Rhodanese domain protein [Prosthecochloris aestuarii DSM 271]
    MLENFFKPPDPLAFTERMVEHSFSVPNISTAELETLIAQKAPIVLFDVRQQEEYDTSHIQGAIHLDPRISKDDFIAAHKK
    KCQEKHLVFY
    CSVGHRSSEMIAKLDECRKQTEASACSNLKGGIFRWYNEGRPVVTGNGVTDAIHEYNALWAMMIKKRKP

    >gi|194334925|ref|YP_002016785.1| NADH:ubiquinone oxidoreductase, subunit E [Prosthecochloris aestuarii DSM 271]
    MSGLTHYLSLAVETIFIKNILLAYFLGMCSFLAISRKVETSIGLGLAVVFVNGITVPVNWMIRQYLLGPGALEWTGIAGM
    AAVDLSFLNYIVFIATIAAMVQLVEMVLDKVSPTLYQSLGIFLPLIAVN
    CAILGSSLFMVEREYDFMESSVFGVSAGIGF
    FLAIITLATIRYKLKYSNVPPGLRGLGIAMLITGLISMAYMSFSGINL

    >gi|194334926|ref|YP_002016786.1| NADH:ubiquinone oxidoreductase, subunit D [Prosthecochloris aestuarii DSM 271]
    MVDKKTLKTLTEPVGMSNPITKQVLGICSALAVTVKMDTALVMSAALIFVLVGSNAIVSAFRNLIPSRVRIIVMLTIIAT
    LVIFIDQLLKAYLFDISKQLSVFVGLIITN
    CIVLGRAEAFALKNGVWPSMLDGLGNGLGYGMILLFVSAMRELFGSGTML
    GFQIVPDILYVENGGWYMNNGLMLLAPGAFFVLGLLIWLQRTLTGYTEE

    >gi|194334984|ref|YP_002016844.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Prosthecochloris aestuarii DSM 271]
    MSQAFDDEMYFEMSMPLLGDDFPELKVQTTHGPMNIPGDLKGSWFVLFSHPADFTPVCTTEFVAFQERVDAFNEIGCKLI
    GMSVDQVFSHIKWVEWIKENLDVEITFPIVAANDRIASQLGMLHPGKGTNTVRAVFVGDPDGKVRLVLYYPQEIGRNMDE
    ILRAVKALQISDKNKVAIPADWPNNTILKDRVIIPPANNIEDAKKRPEQYDCYDWWFCHKPLDK

    >gi|194335031|ref|YP_002016891.1| hypothetical protein Paes_2242 [Prosthecochloris aestuarii DSM 271]
    MIRSMKYAATLFALLMMVVMPQQSHASDDEKEGLFVVVTTDDAQTQMMAMVLSTQTVKQGRSVQMLLCGPAGELAVKGSE
    QTMLKPIEKSPQMLLQGLMKSGVTVEV
    CPLFLPNKGADASVLIDGVTIAKPPVVAQKLSEEGVKLFTF