Propionibacterium freudenreichii shermanii CIRM BIA1 uid49535

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|297625261|ref|YP_003687024.1| thioredoxin [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MAVVLAFGGYRKLTDGRAREAALDEPTLGPTELGTPLGSTATFVQFSSKVCAPCVATGRLLSGLTAQRDDVNHVEIDGEE
    RLDLVREFGINRTPTVFLLDPDGAIRYRFVGPSRKAEFVDALAELQAA

    >gi|297625349|ref|YP_003687112.1| thiol peroxidase [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MSTTAFQGTPVHTVGELPAVGSQAPDFELVGKDLSTITLKSLRGRRVVLNIFPSLDTGVCATSVRTFNKLAAGLDNTTVL
    AVSKDLPFAAERFCVAEGIENVVPASAFRKHSFSNYGVLMTDGPLAGLLARSVVVIDENGTVVYNQLVPEIGNEPDYDDA
    VAALK

    >gi|297625436|ref|YP_003687199.1| Pyridine nucleotide-disulphide oxidoreductase [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MDVDLLVIGWGKAGKTLAGRFAAAGKTVALVERSPEMYGGTCINIGCVPTKDLVVSAEERRDSDDPQEFFRTAVAGRDAL
    IGTLNAANHQMLEKPGVTLVDGTARFTGPRTVVVDTAEGQVELTGETVVIGTGATSRRVDLPGFDSPRVFDSTTIQHIDP
    LPERLVIVGGGFIGLEFASMFTHFGSKVTILDRGEEFLPRVDRDVAEAVRQTLLDMGVTIEQGVRPTSLDDDGTHAVVHT
    TKGDFAAEAVLVAAGRVPVTGELGLEAARIEVDERGFVVVDDQLQTSVPGVYAVGDVNGGPQFTYISLDDNRIVWGAVMG
    QGTRRRSDRVAVPNTTFITPPLSMVGMDETQARKSGRNVLMAKKEVAKIAAMPRPKIVGETHGLFKLFVDADSQEILGAT
    IFSIDSQELVNMVALAIRLGAKVSDLRDGIWTHPSSTEAFNEVLGTLEPLA

    >gi|297625752|ref|YP_003687515.1| Peroxiredoxin/Alkyl hydroperoxide reductase subunit C /Thioredoxin peroxidase/Alkyl hydroperoxide reductase protein
    MSLVGTQILPFKASAFHQGEFVDVTDEDLKGKWSVIFFYPADFSFVCPTELGDLADHYDQFQKMGVEIYSASTDTHFVHA
    AWHKESEEVKKVQYVMLGDPSGQLATNFQVLREGQGLADRGTFLIDPDGVIQLVEVSADGVGRDASELVRKVRAAQYVRQ
    HPDQVCPAHWDETGDTLTPSLDLVGQI

    >gi|297625753|ref|YP_003687516.1| Alkyl hydroperoxide reductase subunit F [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MRLPGPFIAFNPKDDMAVLDAALISQLNQLMDRVTHPVELVMSLDDRPESAQISDMLEQVAALSANITVRRDDSAHDRRP
    AFSITRPGSDISITFAALPTGHEFNSFVLALLQVGGNPVKLDEKVVAGARAITTPKNFVTYISLT
    CQNCPTVVQAINAMA
    VLNPLITNTVVDGSLFRGEVEAEKIKATPTMYLNGELFGQGRMEAAQILSGMDSDAGASMAAELSSRKPYQVLVVGQGPA
    GVASAIYLARKGTRTALIGDRFGGQVNDTLSIENVISVPHTEGPKLASDLRTHASQYEIDMIDGVRASELLPTTDGDDLV
    RVRLEGDAQLSADAVVLATGAHWRQMGVPGEQEYRNKGVTY
    CPHCDGPLFKGKDVAVIGGGNSGIEAALDLAGVARHVTV
    VEFMPA
    CKADEVLLDRVDQTTNITVLTNSAVTEVVGDGSQVTGLHYDDRATGEHRELALDGVFVQIGLMPNTDWLKGAVK
    LDAHGQIVIDDRGATNVPRVFAAGDCTDVPFKQIIVAEGAGAIAGLSAWESLIREQSTAAPKGSDAASTTGSQDARKGEP
    QAAMAR

    >gi|297625986|ref|YP_003687749.1| Bcp Putative peroxiredoxin (Thioredoxin reductase) [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MSTLAPGDPAPEFALPDADGNIVRLSDHAARTVVVYFYPAALTPGCTVQAIDFTASLDEFTQSGVDVIGISPDTTDKLAK
    FRMRKNLRVTLLADPQHTAIDAYGVWGTKLIFGKPIDGIIRSTFVVDVDADGRGTVREALYDVRAAGHVDRLRKKLGIPA
    AV

    >gi|297626015|ref|YP_003687778.1| DSBA-like thioredoxin [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MSDSTQTVDFWFDPACPWAWMTSRWMLEVEKVRPVHTVFHVMSLAVLNEGRDLDAGYRKMIDTFWQGARACIGVEQEHGP
    EALRNFYTELGTRYHLHDEPRGDIEVIRAALRAQGLDESIADKSDTDVYDEALHASHHEGMDPVGDDVGTPVIHMNGMAL
    FGPVISPAPKGEQAGDLFDGFSKMVAYDGFFELKRTRTREPIFD

    >gi|297626132|ref|YP_003687895.1| Dihydrolipoyl dehydrogenase (E3 component of alpha keto acid dehydrogenase complexes) (Dihydrolipoamide dehydrogenas
    MDANSVQPETRDYDVVVIGAGPAGENVAQYATQHSGLTAVLVEAELVGGECSYYACMPSKALLVPLEIANQADHMHGLEP
    ERLSNEQLLKRRDHWVSHYRDAGQVSWAQGVGLDVVRGAGRLIGERLVQVDGAEPVVLRARQAVVIATGSEPVVPAVYQG
    IRAWGSRDATGVVEVPGHLAIIGGGVVACEAATWMRALGSQVTMLVRGGSLLPKQEPFARELIAEGLRRQGIEVITGANV
    SSCTRADPQDTGLGHIHGGPVTLHLADGSGPELVADELLVATGRRPQLGNLGLDAVGLSAQDITGGSTPEWLYAVGDASG
    GALLTHMGKYQARVIGERIAARAAGRTPDTVPESVPVPQVIFTEPQLAHTGLTEAQARASGIDVAVTAVDYNTVAGASLL
    RDDLVGRANLVIDRARKVMVGATFVGPEVGELIHGATIAIVAATPIPLLRHAVPSYPTASELWLRLIEALPEEVLH

    >gi|297626283|ref|YP_003688046.1| Dihydrolipoyl dehydrogenase (E3 component of alpha keto acid dehydrogenase complexes) (Dihydrolipoamide dehydrogenas
    MSAHYDVVVLGAGPGGYVAAIRAAQLGLKTAIIEKKWWGGVCLNVGCIPTKALLRNAELAHLVQKEADTFGISGQVSFDY
    GKAFTRSRQVSERMVKGVHYLMKKNKITEYNGWATFSDARTLQLAGNDGTTDTITFDNVILDTGATVKMLPGTSKSANVL
    SYEELIMSDSLPESIIIGGSGAIGTEFAYVLNSYGVDVTIVEFLDRMVPNEDADISKELTRQYKKLGIKVLTSTAVQSVV
    DTGSGVDVTIAPAAGGEAQVLHADKMLQAMGFAPRTEGYGLENTGVALTDRGAVAIDDFCRTNVPGVYAIGDVTAKMMLA
    HTAEAQGVVAAETIAGAETMAVDYRMIPRATYCQPQIASFGLTEQQARDEGYDVKVAKFPFSANGKAVGMGAPDGFVKIV
    ADGRYNEILGAHMIGEGVTELLPELTLAQKFDLTTEEISRNIHSHPTLGEAVKEAAEGIEGHMTNL

    >gi|297626435|ref|YP_003688198.1| L-methionine (S)-S-oxide reductase [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MDAHRDATSGPDPISDPGEWTDAQWREKLTPQEFHVLRRAGTEPPHVGEYTDTTTAGIYRCRACGAELFRSDTKFDAHCG
    WPAFFSPLAADRVRYITDDSLPGRPRTEVRCATCGSHLGHVFEGEGFDTPTDLRY
    CINSISLTLEPGESA

    >gi|297626746|ref|YP_003688509.1| HesB protein [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MSDTIQEKVTGVTLTDAAAQKARTLLEGEGRDDLALRVEVQPGGCSGLRYRLAFDDSRLPDDLVDAYDGVDLVVDRLSAP
    YLGGATIDFVDTIEQQGFTIDNPNAQSTCACGDSFH

    >gi|297626816|ref|YP_003688579.1| UBA/THIF-type NAD/FAD binding protein [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MSSAVTLPVEPTERELTREELDRYSRQMILPGFGMTAQRRLANARVAVVGAGGLGSPLLIYLAAAGVGELTLIDNDTVDV
    SNLHRQVIHSTASVGRPKVESAAEAIARLNPHVRVEARAERLDIDNVLELLDGHDLVIDGVDNFETRYLIADACEILGLP
    EVWGSVLRYEGQVAVFWSGHGPALRDLFPEPPEAGSVPS
    CAEGGVLGVLPGQIGRAMANEAIKLITGVGEPLLGRLAILD
    AARGSWRELRIAPDPDRVPVSGLSLEAVSCLMPIAVAGAAHDDPALAVSAPQLQEILQARARGDLDFDLVDIRQPEEYSV
    GHIEGSRLVPMGTISVDPAPPDPAPTDPGVPDQVALPRDRDIVIT
    CRSGARSGRLLDRLVAAGYGRVKQLDGGVIAWQRE
    VDPSMGCDPSMGV

    >gi|297626845|ref|YP_003688608.1| Protein-disulfide isomerase (DSBA oxidoreductase) [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MTTQLFDHADDRIAVDVWSDVMCPFCYLGDGLLGKALEDFPQADQVDIRYHSFLLMPDLPEGVTRDLSDVLENERGYPRE
    QTEAMNARITEQGAGIGLDYHFDDALATNMRRAHELSHFAKDAGKQHAMVQRLFRAYFTEGLDLGDVDVLADLAGDVGLD
    RDAAVAALQAGTYADDVETDIAQAQQLGISGVPFFVFNGKYAVSGAQPAEAFSQVLNTVWKESTEAAPAGE

    >gi|297626872|ref|YP_003688635.1| Conserved protein containing thioredoxin domain [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MANRLVAESSPYLRGHADDLIDWWPWGPRALAEARRRQLPVLLSVGYASCHWCHVMAQESFRDPQVAQFVNDNFVAIAVD
    REERPDVDQVFMNATQALTGQGGWPMTVFCTPDGEPFFAGTYFPSQARVGQPSFLQVCQTLARAWAERRDEVVESGAHIA
    SQLADQASAADPAGDQTGEPPAADELLARALALVDPDNGGFGTAPKFPQPASLDALMVTGEPHQIGAVQLSLEHIVRGGI
    HDIVGGGFHRYAVDAAWAVPHFEKMLDDNALLLGTLTRAWRRTGPETGDLREHFELAIRGIVGWLSREMAITTDAGTAFA
    SGQDADSLDADGQRVEGAFYLWTPHQVEAVFNRRDALFAQAVFHLTPKGTMPDHSSTLRLHGDPDPDRLKRILGELREVR
    ARRPAPARDDKVVAGWNGLLADSLTSAAMVFGEPEWLTMARSVLDYLWSVHHFDTDHAARSSLAGVAGPAPAVLEDYAGF
    ALGAARLAGATGDTELLDRAVTVLGRGVELFGADDGGFFDAQHDEALFTRARQLADEGGPSATSIMVTALQVVAGLTGNR
    DWADRARRAEPGLWQVLEQTPLASGWGLTQLAIDAQATAGMGRAQVAIVDPESRPMGLLARAVWRLAPEGTVAALGTPDA
    PGFGELFAQRHDIDGAPTAYICRDETCFDPVTDFTRLRDPLWRRVVRASLPADGRRKGTRPAHDHGPGDRAHGAPGHDHG
    PATDGMRVMSHVATDKPRFEWRTLRTAEFGFPGDQRDALVAAVLDGTKTATSEPLDGYRRHDLDPGDELGNYEVVVDSLN
    QPVALIRINSVATVPLADVDQAHAARDGRGFTTAAQWRTAHEEFWNSDDFRAKLGEPTLELGDDTPIVLLGFRTYRPGDV
    VAGHVVDFSDVPGA

    >gi|297626879|ref|YP_003688642.1| peptide-methionine (S)-S-oxide reductase [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MFRFDEPVTLTAENALPGRDQPVLGMPFFHRVFGDPLDRAFPGAQTAYLAAGCFWGVEKLFWQQPGVLSTAAGYMGGFTR
    NPTYEETCSGLTGHAETVRVVFDPTQTSYEQLVRVFFENHDPTQLDRQGNDVGTQYRSALFTTDDEQQAIAERVRDSYQR
    DMSAAGYGQLTTEIGNGGPWYFAEDYHQQYLDANPHGYCPVHATGIPCTAA

    >gi|297626961|ref|YP_003688724.1| Thioredoxin [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MNSRISACPGCGARNRVPAVAAGLPRCAKCRASLPWIVEAEDTDFGRISDSSRLPVLVDLWAPWCGPCKQLSPILEKLAV
    QYAGRLKLVKVNVDQSPATQAAFGVQSIPTLVLLRDGQVVAQQAGAMPWGALQRWIEPYLA

    >gi|297626978|ref|YP_003688741.1| thiredoxine [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MATVELTTDNFEQTALQKGIVLVDFWADWCGPCQRFSPIFDAASDANDDITFGKVDTEAQQQLAASLEIQAIPTLMAFKD
    GKLIYRNAGLLNRQALDALISQVRDFEPANA

    >gi|297627103|ref|YP_003688866.1| Thioredoxin [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MATLTVTEQNFTETIEGNQIVLLDFWASWCGPCMQFGPIYDQVSEDHPDIVFGKIDTEDQQSLAGAANITSIPTLMALKD
    QTIVFSQAGALPRAALEELIEQIEKLDVKAALEAERAQREASGDSTGDDNPQPDIEANSTRE

    >gi|297627151|ref|YP_003688914.1| Pyridine nucleotide-disulphide oxidoreductase [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MATESSGGTGLSGAGRHSGGGASDHFDLCIIGSGSGNTIVNHEFNDWSVAIVDQGVGEGEWFGGTCLNVGCIPTKMMVVP
    ADFAASPDRAARLGVELSRGAVDFAGIQQRVFGRTNAISTDGLAYRESNENVTVFREAAAFIDAKHLQVGDRVITADQFV
    LAAGSRPRTLDVPGLNDPDLAGLIHTNDTLLRIKTLPKHLMIVGGGVEALEFGHIFSAFGSKVTLVHHGARLLRKLDRDL
    GEAATKLAAERFSVRLNQSLSNVEASETGGLIVSTSDSDGIDYDYAVDALMVAVGREPNGDLLEVGRAGVTLDDQGFVVV
    DDQQRTSQPGIWALGDVTSHHLLKHVANAEARTVQHNLVHPDAMIATRRDAVPQAIFSDPPMYSVGPTTDELDAAGTHYV
    SIIQPYSTVAYGWAMVDDDSFVKLVGDPATGKLLAAHVVGPEAPELGQLCTTAISFGISAIEMARGQYWAHPELAEVVEN
    ALISLDRAMRHDGDDDSEHRRRTGEG

    >gi|297627223|ref|YP_003688986.1| Cation-transporting ATPase [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MTNRAHEQAGGTSTPPDPVPGGRPGAPGLVADDSAGNTVVLDDTITIPDDARDLVSIDLDVTGMTCASCASRIQKRLNKV
    DGVEAAVNYATNKAHVTAPAATRPEALIEVVRDAGYDASLPTPDTDSDELASADADSIRRRLIVAAIISVPVMVVAMVTP
    LQFPGWQWASLVAATPVLFWCGWGFHKATWTNLKHGSASMDTLISVGTISAYLWSVYCLVFGSAGMIGMRHEFSFALSHH
    DALGSVYFEAACGTITFILLGRLIEARSRREAGSALRELLKLGAKRVRLLDDDGTEHTEPIEALTVGQQFVVRPGEKIAS
    DGVVTAGEAAIDTRVITGESVPVEVGPGDRVVGATLNTNSRLVVRATAVGSDTQLSQIATLVEQAQTSKSNAQRLADRIA
    GVFVPVVIVLALVALVAWLIAGAGISFAITAAVSVLIISCPCALGLATPTALLAGTGRGAQLGIVIRGPEALERAKTIDT
    VVMDKTGTLTKGEMAVQHVVVAPATDGRKDVGTDAVLRRVATLEAGSEHPIAEAIVAFAEQAGVEPEAADDFQIIPGLGV
    RATVAGQASLAGNAALMEREELVVPAELVAAAHSAADEGATVVFVAWQAAVRGLVTVSDEIADTSQRAIELFHRMGLRTV
    MLTGDNERAARHIAAQVGIDEVHAQVLPQQKLEVVTRLQSGDAGQGVPGLEGGSDGSGRQASGQQGRQEHRVAMIGDGVN
    DAAALAGADLGISMGSGTDAAIAASDLTLMRHDLVLAVDAIRLARATLGTIRGNLFWAFFYNVCAIPIAAFGLLNPMIAG
    AAMAFSSVFVVTNSLRLRRFRPTPEVARS

    >gi|297627283|ref|YP_003689046.1| Pyridine nucleotide-disulphide oxidoreductase [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MDVDLLVIGWGKAGKTLAGRFAAAGKTVALVERSPEMYGGTCINIGCVPTKDLVVSAEERRDSDDPQEFFRTAVAGRDAL
    IGTLNAANHQMLEKPGVTLVDGTARFTGPRTVVVDTAEGQVELTGETVVIGTGATSRRVDLPGFDSPRVFDSTTIQHIDP
    LPERLVIVGGGFIGLEFASMFTHFGSKVTILDRGEEFLPRVDRDVAEAVRQTLLDMGVTIEQGVRPTSLDDDGTHAVVHT
    TKGDFAAEAVLVAAGRVPVTGELGLEAARIEVDERGFVVVDDQLQTSVPGVYAVGDVNGGPQFTYISLDDNRIVWGAVMG
    QGTRRRSDRVAVPNTTFITPPLSMVGMDETQARKSGRNVLMAKKEVAKIAAMPRPKIVGETHGLFKLFVDADSQEILGAT
    IFSIDSQELVNMVALAIRLGAKVSDLRDGIWTHPSSTEAFNEVLGTLEPLA

    >gi|297627475|ref|YP_003689238.1| Thiosulfate sulfurtransferase [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MTLIDPATLRAKLASDNPPVVLDARWSGPAATVDEGHKDFETGHIPGSLWVSMNKEMSNPDVPGGRHPLPDPGAFEADMR
    RKGLNEDSSVVVLDGGNSLAAGRLWWLLTDGGLTDVQVLNGGFAAWKAAGYPVETGPTWSSKVGDIMLRAGHLERVDAQH
    VLANGGTLWDVRSPERYRGDEEPIDPKAGHIPGARNLPATEAQESDGTFKSPDELKKVFPAVKPGDAVY
    CGSGITASQAL
    LAMHVAGINGVKLYPGSWSDWISDDSRPVERG

    >gi|297627562|ref|YP_003689325.1| Thioredoxin reductase [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MNDEIRDVIIVGSGPAGYTAAIYTGRAGMRPIVLEGSVTAGGALMTTTEVENYPGFPDGVLGPVLMSDMRAQAEKFDAEL
    IADDATKIELGGDIKKVTDSEGNVYRARAVILAMGSAYRHLNLPEEEEFSGRGVSW
    CATCDGFFFRGKEIAVVGGGDSAI
    EEATFLTRFADKVTLIHRRDAFRASNIMAKRALDNPKIEIAWNSEVVGMSGDGTLNALRLRDTQTGEERELAVAGLFEAI
    GNVPRSELVKGQVELNPDGYVKVAGDSTLTDAPGVFACGDLVDHVYQQAITAAGTGCRAALDAEHYLSALMDENSDQATE
    ALANA

    >gi|297627563|ref|YP_003689326.1| Thioredoxin [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
    MAQPKDVTDATFSDEVLKADKPTVVDYWADWCGPCKQLSPILDQLAEEYGDKINFVKVDADANTKVATDQGILGLPTVQI
    YQNGEVVKQFQGGKPKSVIVKMLQEFV