Propionibacterium acnes SK137 uid48071

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|295129888|ref|YP_003580551.1| thioredoxin [Propionibacterium acnes SK137]
    MKTRLIATLAAATLVVTGVSACSSTSASDDKGFAAGDGSWSKLPADKREPAAVLTGTDLNGKKISTADAKGKVIVVNVWG
    SW
    CAPCRHEAPALVKAADSTKNVAAFYGINTRDLDPGPPQAFSRTFHISYPSFYDPDGALLLKFTELPPKAIPSTLVIDR
    KGRSAARFVGEVSTATLVQAINDVAKESQ

    >gi|295129896|ref|YP_003580559.1| mycothione reductase [Propionibacterium acnes SK137]
    MEHYDIVVIGSGSGNTILDEDFADRRAAIIDSGAFGGTCLNVGCIPTKMFVLPADFASSPSEAVRVGVDLQFRGASFASI
    RDRIFGRIDSISKAGLSYRQGLDNIDVYTGEAAFIDAHTLEVGGRCITADQIVLAAGSRPRVPDVPGLDDPSMAGLIHTS
    DTIMRLAELPQRLVILGGGLIAAEFAHIFSGLGSQVTVINRSGRMLRHEDREISQRFTEQMGRRVRLRMAEGLVGVDRDP
    GGHLVVLTVDGDGVDYDYPADVVLNATGRVSNGDRLNLPAAGVDVDDDGFVVVDKHQRTNVEHIWALGDVCSPWELKHVA
    NHEARVVRHNLLHPDDLASSNHCFVPHAVFSNPQVASVGATEQGLLQSDTPYAAYLQEYADVAYGWAMEDEGHCVKLLGD
    PQTRTLLGAHIIGPQASTLIQTCIQGMSVGQTVDEMARGQYWIHPALSEVVESALLGLGKEMDTTR

    >gi|295130049|ref|YP_003580712.1| thioredoxin [Propionibacterium acnes SK137]
    MATVALTKDNFSSTIDSNDVVLIDFWASWCGPCQRFSPIYEDASGRHSDVTFAKVDTEDQQELSAGLEITSIPTIMAFRA
    GYLVFRQSGLLQGRQLDELIEKVKEIDVEDLKKQAAAQNQG

    >gi|295130124|ref|YP_003580787.1| peptide-methionine (S)-S-oxide reductase [Propionibacterium acnes SK137]
    MNKTEMVSSENALPGGHTPVLAMPFFHRVTGDRLDRPFPSSETIYLAMGCFWGAEKLFWNTNGVLQTAVGYMGGLTPNPT
    YREVYTGCTGHAETVRVTYDPTQVSTEAILTIFLENHDPTQGMRQGNDVGTQYRSAIWCTTTEQFMTATTVKGSYQANLL
    NAGYGAITTAISMANGVEFYLAEAEHQQYLEDNPFGYCPVHATGVCLAGS

    >gi|295130132|ref|YP_003580795.1| hypothetical protein HMPREF0675_3623 [Propionibacterium acnes SK137]
    MPNYLGESTSPYLIQHAANPVDWFPWGEEAFDEARSRDVPVMVSVGYSSCHWCHVMALESFSDPEVAEVVNANVVPVKVD
    REERPEVDAALMQVTLAMTGQGGWPNTVFLTPEGKPFFAGTYFPPVRRGRLPGFVELVEALGGAWRERRDEVVSSAEAIV
    EHLRPVEKDPEVARPIAGELIDAVGADYDIVHGGFGSPTKFPMPTLLDALLVKGDPTSLDMAQNTCEHLVRGGIFDQVGG
    GFHRYSTDSQWVVPHFEKMLYDNALLLATMARCWRRTADHDSDRRDLYSHAARRTVAWLNREMRLPNGLYAAGLDADSDD
    AAGHTHEGIYYLWNQDLITDALGTDEAEWLRPLVHLEPCNDNGLGTLQLRGRVEWERINADMDTLLEARGRRSAPARDEK
    AITAWNAMLIDGLVEAGMILREWSWVEQARELADSLWTAHWDHGMALRTSFHDRPGVPAVCEDYAWVALSFAGLAGATGE
    SVWLDHAVEVLGEAVARFSAVDGSFLDAEDSFLLTVTAHTLTDDACPSPTAAMVMALRRVGLMAERADFIERANKASVAL
    LPVVSATPRFAGWAVADFLITDEARRGLKPAGVVIADTTDEPSDLAAAAWRMAPAGSAIMRRLNEDSGFGTWFNERVPRD
    GQPTCWVCRGAVCFEPVTDYLDLKEPLWRRA

    >gi|295130149|ref|YP_003580812.1| Organic hydroperoxide resistance protein [Propionibacterium acnes SK137]
    MIEIEPVYTTEAIATGAGRNGHVQSPDGRVSEDLAVPVEMGGSGKGTNPEQLFAAGYAACFHSALQMVARQAKKDLGDSS
    VGARVSIGQAGEGFGLAVALEVVIPALPHDEAQRLADKAHQV
    CPYSNATRGNIRVDVTVVDD

    >gi|295130160|ref|YP_003580823.1| Thiol peroxidase, Tpx-type [Propionibacterium acnes SK137]
    MATTAFMGKPLNTVGDLPQVGSLLPSFALVKSDLSELRSDELKGKKLVLNIFPSVDTGVCATSVRTFNEKAAGLDDTIVL
    CVSRDLPFAQARFCGAEGIKNVVVASAFRSHFGKDLGVTLADGPMQHLLARAIIVVNAEGKVTYTQLVDEITTEPDYDAA
    LEAASKA

    >gi|295130266|ref|YP_003580929.1| copper-exporting ATPase [Propionibacterium acnes SK137]
    MSPPDEEQTVLHPPVQLQISGMTCAACATTIEKRLSRIDGVHASVNFASERATVTGMGVKDAIAAVKDAGYTAALLSDID
    LAAEAERRITMLRRRLIVAVLLTLPLMDIGLVLALEPQLRFPTWDWLLVSLSLPVVFWSAWPFHKATWTNLRHGMTSMDT
    LVSLGVLTSFGWSFISILIGAQDQEGYWLGYGITPAGADTLYLDVAAGVTCFLLAGRYFEARAKRSARSVLTALRQLAAK
    NARVLRNGIETVVPVEQLHQSDLFVTLAGETLAADGEVVEGSSSIDTSMMTGEPMPADVTVGSAVLGGTMNLTGRIVARA
    TGVGDHSQLAHMAVLAEEAQARKANVQRLVDKVVEIFVPAVLAIVVLTFFGWWIAGAGTRHALSAGLSVLVIACPCALGL
    ATPTALMVGVGRGGQLGILIKGPEALEASGRIDTVVLDKTGTVTSGEMTLVATLPAKGQDVDRAHRYAAALDQHSTHPVA
    KAVVAAVKGTIPACPSPRTLAGRGVSGEVEGHRVMVGNPAFLTEAEIKIPAELSHTVEKAAETGRSAVLVAIDGQAAAAL
    VVADTVKPEAPEVIAQLKNMGLRTVLLTGDSKAAAKVVGTQLGTDEVLAEVLPTDKAEVVERFRSKGRVVAMVGDGVNDA
    AALASSDLGMALVTGTDIAMRSADIICVRHHLGVVPDAIGLSRRTLRTIRGNLAWAFIYNIAAIPIAAAGFLNPLISGLA
    MSLSSLFVVTHSLRLRNFGTRS

    >gi|295130276|ref|YP_003580939.1| iron binding protein from the HesB_IscA_SufA family protein [Propionibacterium acnes SK137]
    MTDALTPPATDGIILTDAAAAKVKSLLDQEGRDDLALRLAVQPGGCSGLRYQLFFDERHLEGDVVKTYGGVDVVTDRMSA
    PYLAGATIDFMDTIEKQGFTIDNPNATSTCACGDSFH

    >gi|295130626|ref|YP_003581289.1| methionine-R-sulfoxide reductase [Propionibacterium acnes SK137]
    MDHEHTATYDLQPHLVLTPEQWHERLSDEEYYVLREAGTEAPFVGEYTDTTTEGVYRCRACGAELFRSTQKFHSSCGWPS
    FYAPLAEDRVRYLNDESLPGRPRTEVRCAQCDSHLGHVFAGEGFDTPTDLRY
    CINSICLDLVPTDETT

    >gi|295130786|ref|YP_003581449.1| dihydrolipoyl dehydrogenase [Propionibacterium acnes SK137]
    MSSHFDVVVLGAGPGGYVAAIRAAQLGKKTAIIETEYWGGVCLNVGCIPTKSLLRNAELAHIVTKEAKTFGIGGDITVDF
    GKAFSRSREVSARMVKGIHFLMKKNKITEFNGWGEFTGPKAISVKDSDGKVTDEITFDNAIIAVGSVVKTLPGTQLSGRV
    VTYKEQILSDTVPGSIVIAGSGAIGTEFAYVLANYGCDVTIVEFLDRMVPNEDKEVSAELAKAYKKLGIKVLTSTKVDSI
    DDSGDKVKVTISPSKGGESKVIEADRVLQAVGFAPRVEGYGLEKTGVKLTERGAIEIDDFMRTNVDGIYAIGDCTAKLML
    AHTAETQGVVAAETIAGAQTMPINYDMIPRATYCQPQVGSFGYSEDQAREKGYDVKVSKFPFAANGKAWGLGDGTGFVKI
    VADARHGELLGASLVGHDVSELLPELTLAQLWDITAEEIGRNIHAHPSLSEALKDAAEGVEGHMINF

    >gi|295131180|ref|YP_003581843.1| Thiol peroxidase, Bcp-type [Propionibacterium acnes SK137]
    MSTRLQPGNAAPDFTLPAASGDHITLSDFTGKRVIVYFYPAAMTPGCTTQAVDFTAHLDEFEEAGYKVLGISPDPVAKLQ
    KFVAKESLTLTLLSDEGKEVMKAYGAYGSKNVYGKEIVGVIRSTFVVDVAEDGSCKITEAQYNVRAKGHVDKLCKELKID
    C

    >gi|295131509|ref|YP_003582172.1| pyridine nucleotide-disulfide oxidoreductase [Propionibacterium acnes SK137]
    MFWSSDGVRPAKRSPDAWRRRDARSPSSRDQHRCTGGSCINIACVPTKDLIDSASKRDGRDPASYFTSAVADRDTLIATL
    NRTNHAMLEGKVLLLDGVASFTGPHTVKVVAGDDEITVRAETIIVNTGSHPANLPVPGADGPRVHDSTTIQHVDPLPSQL
    VIVGGGFIGLEFAQMFARFGSQVTLLEAGETFVPALDTDIAERVRNMLEGEGVTVVTGAQVTSCDETGDHVDVVTDDQTF
    AADAVLVAAGRRPATEDLDLTAAGVATDERGYITVDDQLRTNIDGVYAVGDVNGGPQFTYISLDDNRVLWDTLHDGPRRR
    DDRVAVPATTFLDPPLSQVGMTMRQARESGRSVLVATKDVATIAAMPRPKIVGQTEGVIRVLVDADDHTVLGATLWCIDS
    QELVNFVSLAMRLGVRYETLRDGIWTHPSSTEAFNEVLGVLEPLT

    >gi|295131517|ref|YP_003582180.1| peroxiredoxin [Propionibacterium acnes SK137]
    MSLINTKILPFKANAFRNGDFIEVSDSDINGKWAVFFFYPGDFTFVCPTELGDLADHYEELQAMGVEVFSVSTDSHFVHK
    AWHADSDTVGKVNYTMIGDPNLQLTRNFDVEREGAGQADRATFLVDPDGIIQFYELTAEGIGRNATELVRKVKAAQYIYT
    HPGEVCPAKWEEGDETLAPSIDLVGKI

    >gi|295131518|ref|YP_003582181.1| alkyl hydroperoxide reductase, F subunit [Propionibacterium acnes SK137]
    MLDNALTTQLKTYLEMVREPIVLVPSPYRGDDAAKSSKSAHMDELLSEIAALSDKVSVGKPVDNERTPSFAITRPGSPID
    IRFAGLPMGHEFTSLVLALLQVGGHPVKEEQSLIDAVRAVKGEHHFVTYMSLT
    CQNCPTVVQDLNAMAVLNPNIHHTAVD
    GGTHTDEVEAKGIASVPAIYLDGEDWGSGRMDMAEILERLDADAAQGAKEDLSQRDPYDVLVVGAGPAGAAAAVYAARKG
    IRTAMVGSRIGGQVLDTEAIDNLISVPHTTGPRLADALRSHVNDYNIDVIERQTASAIETTGRMTTVHLTDGDLRARSVI
    VATGARWRNLGVPGEKEYRTKGVTY
    CPHCDGPLFTGKKVAVVGGGNSGIEAAIDLAGVVDHVTVVEFLDALKADDVLLRT
    LNSLPNVDVITSARTTQILGDGSKVTGLEYEDRTSGDVKTIELAGVFVQIGLLPNTEWLEGALERNQRGEIVIDERGTTS
    APGIFAAGDCTTQPYKQIIISMGAGATAALGAFDHLIRQNPTQN

    >gi|295131755|ref|YP_003582418.1| hypothetical protein HMPREF0675_5306 [Propionibacterium acnes SK137]
    MGLRDLLMNHGMAEGGLDLPDVLNALAKGAVLVDVRTAREYEAGHAPGARLVSPKELLADPFTAVYGDDPLAEPNPHFIL
    V
    CDTGFRSGHLVAPVREKGYNCDFLASGLHAWRAGGEILIPGPPRGR

    >gi|295131765|ref|YP_003582428.1| copper-exporting ATPase [Propionibacterium acnes SK137]
    MSTPTHPDAQSELKDATEPTSINLDITGMSCASCAARIAKKLNKVDGAQATVNYATSKAHVLTTKPIEVDDLIGVVEAAG
    YGASVPTPAAPPEDHAAKIRARLIVAIILAVPVMLLSMIPALQFDGWQWLALALSLPVVFWCGEGFHRAAWTNLRHGATS
    MDTLISLGSLVSLGWSVWALMWGSAGHVGMRHRMTWALERTDPSSALYLEASVGVITFILIGRWIEARNRAEAGSALQAL
    LRMGAKSVRMIRDGQEVTVPIEALTVGDHFVVRPGEKVATDGRVAEGSSAIDASLVTGESLPVEVAVGDEVIGATVNTSG
    RLVVEATAVGSDTELSRIATLVEAAQTSRSKTQDLADKVSSIFVPTVLIISALTMIVWAVLGQGVTAAFTAGVAVLIIAC
    PCALGLATPMALLAGTGRGARLGIVIKGAGSLERARGIDVMAMDKTGTLTTGRMAVVAVWDESGRVVNISDNPPALAVTA
    ALEVGSEHPISRAIVEACPGVAPAEDFRALPGLGVSGTVNGLPAKAGRVSLFDAIPDTLSKNVERAQAEGRTVLVVGRGD
    DILGAIAVSDEIKPEAVVAVKRMVQAGVRPVLVTGDNSGAAAHVASELGIDEVMSEVMPADKVDVVTRLRSDGSRVAMMG
    DGVNDAAALQTADLSIAMGTGTDVAIAASDIICTRGDPRLAVDALSLAHATDRTIRQNLFWAFAYNVIAIPVAAVGLLSP
    VIAAAAMAFSSIFVVTNSMRLVRWHPGMSDSN

    >gi|295131766|ref|YP_003582429.1| heavy metal-associated domain protein [Propionibacterium acnes SK137]
    MHKTYTINGMTCEHCVKAITEEVSALDGVDNVTVSLESGSMTIDSAEEIPFGKVADAVDEAGEYTVAEASSLDTAGHPGG
    QCGCGGHGHAGKKAEGSGCGCGGHQHSEEAAAKHAEHASKGGCGCGGHQA

    >gi|295131836|ref|YP_003582499.1| thioredoxin-disulfide reductase [Propionibacterium acnes SK137]
    MTTQALTPNTILGNISLSDPSEIDTTQPFPETVGADVHGNDEPRDVIIVGSGPAGYTAAVYTARAGLKPLVFEGSMDAGG
    ALMQTTEVENYPGFSEGIMGPDLMAQMRAQAERFGAELIADDVTDIDLTGEIKKLVDTDGNTYKAHVVILAMGSAYRKLG
    LEDEPRLSGRGVSW
    CATCDGFFFTGKDIAVVGGGDSAVEEATFLTRFANSVTLVHRRDQLRASQIMADRAAADPKITFAW
    NSEVVAMQGESKLESITLRDTKTGEERQLEVAGVFEAIGHDPRSELVRGQVDLDDAGYVVCAEPSTRTNVPGVFACGDLV
    DSHYQQAVTAAGSGCRAALDAERFLTELGR

    >gi|295131841|ref|YP_003582504.1| thioredoxin [Propionibacterium acnes SK137]
    MNNVIEVTDATFASEVLGASKPVLVDYWADWCAPCKQLSPIIEELAGTYGDRMVFAKVDTNANTRVAAEQGIMSLPTIQV
    WQGGQLVKSLQGGKTKKALVKIIEEFVA