Propionibacterium acnes KPA171202 uid58101

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|50841717|ref|YP_054944.1| hypothetical protein PPA0224 [Propionibacterium acnes KPA171202]
    MRGMKVFSAVMAALMFAGCGGDAGMAHQREDAGIPGCSHLPSGPIAKSSGPATEGRPMPDHGLQCLGEGPTVSMSRATSR
    GVTVVTIWASW
    CRPCRSEAPLIANAYRRYHDRVHFLGIDYAESDASEAISFAGDAGLTFPHLQDPDSTIQGAWQISGVPV
    TFIVRDGTIVTRHSGQWRSQRELDSAIDKVIKRTP

    >gi|50841811|ref|YP_055038.1| hypothetical protein PPA0325 [Propionibacterium acnes KPA171202]
    MKTRLIATLAAATLVVTGVSACSSTSASDDKGFAAGDGSWSKLPADKREPAAVLTGTDLNGKKISTADAKGKVIVVNVWG
    SW
    CAPCRHEAPALVKAADSTKNVAAFYGINTRDLDPGPPQAFSRTFHISYPSFYDPDGALLLKFTELPPKAIPSTLVIDR
    KGRSAARFVGEVSTATLVQAINDVAKESQ

    >gi|50841819|ref|YP_055046.1| mycothione/glutathione reductase [Propionibacterium acnes KPA171202]
    MEHYDIVVIGSGSGNTILDEDFADRRAAIIDSGAFGGTCLNVGCIPTKMFVLPADFASSPSEAVRVGVDLQFRGASFASI
    RDRIFGRIDSISKAGLSYRQGLDNIDVYTGEAAFIDAHTLEVGGRCITADQIVLAAGSRPRVPDVPGLDDPSMAGLIHTS
    DTIMRLAELPQRLVILGGGLIAAEFAHIFSGLGSQVTVINRSGRMLRHEDREISQRFTEQMGRRVRLRMAEGLVGVDRDP
    GGHLVVLTVDGDGVDYDYPADVVLNATGRVSNGDRLNLPAAGVDVDDDGFVVVDKHQRTNVEHIWALGDVCSPWELKHVA
    NHEARVVRHNLLHPDDLASSNHCFVPHAVFSNPQVASVGATEQGLLQSDTPYAAYLQEYADVAYGWAMEDEGHCVKLLGD
    PQTRTLLGAHIIGPQASTLIQTCIQGMSVGQTVDEMARGQYWIHPALSEVVESALLGLGKEMDTTR

    >gi|50841970|ref|YP_055197.1| thiol-disulfide isomerase [Propionibacterium acnes KPA171202]
    MATVALTKDNFSSTIDSNDVVLIDFWASWCGPCQRFSPIYEDASGRHSDVTFAKVDTEDQQELSAGLEITSIPTIMAFRA
    GYLVFRQSGLLQGRQLDELIEKVKEIDVEDLKKQAAAQNQG

    >gi|50842042|ref|YP_055269.1| peptide methionine sulfoxide reductase [Propionibacterium acnes KPA171202]
    MNKTEMVSSENALPGGHTPVLAMPFFHRVTGDRLDRPFPSSETIYLAMGCFWGAEKLFWNTDGVLQTAVGYMGGLTPNPT
    YREVYTGCTGHAETVRVTYDPTQVSTEAILTIFLENHDPTQGMRQGNDVGTQYRSAIWCTTTEQFMTATTVKGSYQANLL
    NAGYGAITTAISMANGVEFYLAEAEHQQYLEDNPFGYCPVHATGVCLAGS

    >gi|50842049|ref|YP_055276.1| hypothetical protein PPA0563 [Propionibacterium acnes KPA171202]
    MPNYLGESTSPYLIQHAANPVDWFPWGEEAFDEARSRDVPVMVSVGYSSCHWCHVMALESFSDPEVAEVVNANVVPVKVD
    REERPEVDAALMQVTLAMTGQGGWPNTVFLTPEGKPFFAGTYFPPVRRGRLPGFVELVEALGGAWRERRDEVVSSAEAIV
    EHLRPVEKDPEVARPIAGELIDAVGADYDIVHGGFGSPTKFPMPTLLDALLVKGDPTSLDMAQNTCEHLVRGGIFDQVGG
    GFHRYSTDSQWVVPHFEKMLYDNALLLATMARCWRRTADHDSDRRDLYSHAARRTVAWLNREMRLPNGLYAAGLDADSDD
    AAGHTHEGIYYLWNQDLITDALGTDEAEWLRPLVHLEPCNDNGLGTLQLRGRVEWERINADMDTLLEARGRRSAPARDEK
    AITAWNAMLIDGLVEAGMILREWSWVEQARELADSLWTAHWDHGMALRTSFHDRPGVPAVCEDYAWVALSFAGLAGATGE
    SVWLDHAVEVLGEAVARFSAVDGSFLDAEDSFLLTVTAHTLTDDACPSPTAAMVMALRRVGLMAERADFIERANKASVVL
    LPVVSATPRFAGWAVADFLITDEARRGLKPAGVVIADTTDEPSDLAAAAWRMAPAGSAIMRRLNEDSGFGTWFNERVPRD
    GQPTCWVCRGAVCFEPVTDYLDLKEPLWRRA

    >gi|50842066|ref|YP_055293.1| stress-induced protein [Propionibacterium acnes KPA171202]
    MIEIEPVYTTEAIATGAGRNGHVQSPDGRVSEDLAVPVEMGGSGKGTNPEQLFAAGYAACFHSALQMVARQAKKDLGDSS
    VGARVSIGQAGEGFGLAVALEVVIPALPHDEAQRLADKAHQV
    CPYSNATRGNIRVDVTVVDD

    >gi|50842076|ref|YP_055303.1| thiol peroxidase [Propionibacterium acnes KPA171202]
    MATTAFMGKPLNTVGDLPQVGSLLPSFTLVKSDLSELRSDELKGKKLVLNIFPSVDTGVCATSVRTFNEKAAGLDDTTVL
    CVSRDLPFAQARFCGAEGIKNVVVASAFRSHFGKDLGVTLADGPMQHLLARAIVVVDAEGKVTYTQLVDEITTEPDYDAA
    LEAASKA

    >gi|50842178|ref|YP_055405.1| cation-transporting P-type ATPase A [Propionibacterium acnes KPA171202]
    MSTATMSPPDEEQTVLHPPVQLQISGMTCAACATTIEKRLSRIDGVHASVNFASERATVTGMGVKDAIAAVKDAGYTAAL
    LSDIDLAAEAERRITMLRRRLIVAVLLTLPLMDIGLVLALEPQLRFPTWDWLLVSLSLPVVFWSAWPFHKATWTNLRHGI
    TSMDTLVSLGVLTSFGWSFISILIGAQDQEGYWLGYGITPAGADTLYLDVAAGVTCFLLAGRYFEARAKRSARSVLTALR
    QLAAKNARVLRNGIETVVPVEQLHQSDLFVTLAGETLAADGEVVEGSSSIDTSMMTGEPMPADVTVGSAVLGGTMNLTGR
    IVARATRVGDHSQLAHMAVLAEEAQARKANVQRLVDKVVEIFVPAVLAIVVLTFFGWWIAGAGTRHALSAGLSVLVIACP
    CALGLATPTALMVGVGRGGQLGILIKGPEALEASGRIDTVVLDKTGTVTSGEMTLVATLPAKGQDVDRAHRYAAALDQHS
    THPVAKAVVAAVKGTIPACPSPCTLAGRGVSGEVEGHRVMVGNPAFLTEAEIKIPAELSHTVEKAAETGRSAVLVAIDGQ
    AAAALVVADTVKPEAPEVIAQLKNMGLRTVLLTGDSKAAAKVVGTQLGTDEVLAEVLPTDKAEVVERLRSEGRVVAMVGD
    GVNDAAALASSDLGMALVTGTDIAMRSADIICVRHHLGVVPDAIGLSRRTLRTIRGNLAWAFIYNIAAIPIAAAGFLNPL
    ISGLAMSLSSLFVVTHSLRLRNFGTRS

    >gi|50842188|ref|YP_055415.1| HesB protein, putative for nitrogen fixation [Propionibacterium acnes KPA171202]
    MTDALTPPATDGIILTDAAAAKVKSLLDQEGRDDLALRLAVQPGGCSGLRYQLFFDERHLEGDVVKTYGGVDVVTDRMSA
    PYLAGATIDFMDTIEKQGFTIDNPNATSTCACGDSFH

    >gi|50842547|ref|YP_055774.1| peptide methionine sulfoxide reductase MsrB [Propionibacterium acnes KPA171202]
    MDHEHTATYDLQPHLVLTPEQWHERLSDEEYYVLREAGTEAPFVGEYTDTTTEGVYRCRACGAELFRSTQKFHSSCGWPS
    FYAPLAEDRVRYLNDESLPGRPRTEVRCAQCDSHLGHVFAGEGFDTPTDLRY
    CINSICLDLVPTDETT

    >gi|50842707|ref|YP_055934.1| dihydrolipoamide dehydrogenase [Propionibacterium acnes KPA171202]
    MSSHFDVVVLGAGPGGYVAAIRAAQLGKKTAIIEKEYWGGVCLNVGCIPTKSLLRNAELAHIVTKEAKTFGIGGDITVDF
    GKAFSRSREVSARMVKGIHFLMKKNKITEFNGWGEFTGPKAISVKDSDGKVTDEITFDNAIIAVGSVVKTLPGTQLSGRV
    VTYKEQILSDTVPGSIVIAGSGAIGTEFAYVLANYGCDVTIVEFLDRMVPNEDKEVSAELAKAYKKLGIKVLTSTKVDSI
    DDSGDKVKVTISPSKGGESKVIEADRVLQAVGFAPRVEGYGLEKTGVKLTERGAIEIDDFMRTNVDGIYAIGDCTAKLML
    AHTAEAQGVVAAETIAGAQTMPINYDMIPRATYCQPQVGSFGYSEDQAREKGYDVKVSKFPFAANGKAWGLGDGTGFVKI
    VADARHGELLGASLVGHDVSELLPELTLAQLWDITAEEIGRNIHAHPSLSEALKDAAEGVEGHMINF

    >gi|50842908|ref|YP_056135.1| methylated-DNA--protein-cysteine methyltransferase [Propionibacterium acnes KPA171202]
    MPGPLPAMTAQSQHRFDTAIGELEVTATAHGLSRLVFVKTDPSPPPLSTSHARRSGDIISCAIAQITEYLSGSRTSFDVA
    LDLSATTDFQRTVLTGLQTVPYGQTVSYRQLASIIGRPNASRAVGHACATNPLPILIP
    CHRVLRSNGQLGGYLGGPRLKR
    FLLNLESVTSAPLPA

    >gi|50843124|ref|YP_056351.1| putative peroxiredoxin (AhpC/TSA family protein) [Propionibacterium acnes KPA171202]
    MRRRGRGAGLATAYIVEVMSTRLQPGNAAPDFTLPAASGDHITLSDFTGKRVIVYFYPAAMTPGCTTQAIDFTAHLDEFE
    EAGYKVLGISPDPVAKLQKFVAKESLTLTLLSDEGKEVMKAYGAYGSKNVYGKEIVGVIRSTFIVDVAEDGSCKVTEAQY
    NVRAKGHVDKLCKELKIDC

    >gi|50843428|ref|YP_056655.1| pyridine nucleotide-disulphide oxidoreductase [Propionibacterium acnes KPA171202]
    MGHRPPIAYTRKGEPLLNKEFTVDVLVIGWGKAGKTIAGRLAAEGRKVALVERSAQMYGGSCINIACVPTKDLIDSASKR
    DGRDPASYFTSAVADRDTLIATLNRTNHAMLEGKVLLLDGVASFTGPHTVKVVAGDDEITVRAETIIVNTGSHPANLPVP
    GADGPRVHDSTTIQHVDPLPSQLVIVGGGFIGLEFAQMFARFGSQVTLLEAGETFVPALDTDIAERVRNMLEGEGVTVVT
    GAQVTSCDETGDHVDVVTDDQTFAADAVLVAAGRRPATEDLDLTAAGVATDERGYITVDDQLRTNIDGVYAVGDVNGGPQ
    FTYISLDDNRVLWDTLHDGPRRRDDRVAVPATTFLDPPLSQVGMTMRQARESGRSVLVATKDVATIAAMPRPKIVGQTEG
    VIRVLVDADDHTVLGATLWCIDSQELVNFVSLAMRLGVRYETLRDGIWTHPSSTEAFNEVLGVLEPLT

    >gi|50843436|ref|YP_056663.1| alkyl hydroperoxide reductase C22 protein [Propionibacterium acnes KPA171202]
    MSLINTKILPFKANAFRNGDFIEVSDSDINGKWAVFFFYPGDFTFVCPTELGDLADHYEELQAMGVEVFSVSTDSHFVHK
    AWHADSDTVGKVNYTMIGDPNLQLTRNFDVEREGAGQADRATFLVDPDGVIQFYELTAEGIGRNATELVRKVKAAQYIYT
    HPGEVCPAKWEEGDETLAPSIDLVGKI

    >gi|50843437|ref|YP_056664.1| alkyl hydroperoxide reductase subunit F [Propionibacterium acnes KPA171202]
    MRPSPRRSTSSARSEFRPEHLLQGRSSLRRIPGPVPFPPPFRRTMLDNALTTQLKTYLEMVREPIVLVPSPYRGDDAAKS
    SKSAHMDELLSEIAALSDKVSVGKPVDNERTPSFAITRPGSPIDIRFAGLPMGHEFTSLVLALLQVGGHPVKEEQSLIDA
    VRAVKGEHHFVTYMSLT
    CQNCPTVVQALNAMAVLNPNIHHTAVDGGTHTDEVEAKGIASVPAIYLDGEDWGSGRMDMAEI
    LERLDADAAQGAKEDLSQRDPYDVLVVGAGPAGAAAAVYAARKGIRTAMVGSRIGGQVLDTEAIDNLISVPHTTGPRLAD
    ALRSHVNDYNIDVIERQTASAIETTGGMTTVHLTDGDLRARSVIVATGARWRNLGVPGEKEYRTKGVTY
    CPHCDGPLFTG
    KKVAVVGGGNSGIEAAIDIAGVVDHVTVVEFLDALKADDVLLRTLNSLPNVDVITSARTTQILGDGSKVTGLEYEDRTSG
    DVKTIELAGVFVQIGLLPNTEWLEGALERNQRGEIVIDERGTTSAPGIFAAGDCTTQPYKQIIISMGAGATAALGAFDHL
    IRQNPTQN

    >gi|50843666|ref|YP_056893.1| hypothetical protein PPA2231 [Propionibacterium acnes KPA171202]
    MNHGMAEGGLDLPDVLNALAKGAVLVDVRTAREYEAGHAPGARLVSPKELLADPFTAVYGDDPLAEPNPHFILVCDTGFR
    SGHLVAPVREKGYNCDFLASGLHAWRAGGEILIPGPPRGR

    >gi|50843675|ref|YP_056902.1| cation-transporting ATPase [Propionibacterium acnes KPA171202]
    MSTPTHPDAQSELKDATEPTSINLDITGMSCASCAARIAKKLNKVDGAQATVNYATSKAHVLTTKPIGVDDLIGVVEAAG
    YGASVPTPAAPPEDHAAKIRARLIVAIILAVPVMLLSMIPALQFDGWQWLALALSLPVVFWCGEGFHRAAWTNLRHGATS
    MDTLISLGSLVSLGWSVWALMWGSAGHVGMRHRMTWALERTDPSSALYLEASVGVITFILIGRWIEARNRAEAGSALQAL
    LRMGAKSVRMIRDGQEVTVPIEALTVGDHFVVRPGEKVATDGRVAEGSSAIDASLVTGESLPVEVAVGDEVIGATVNTSG
    RLVVEATAVGSDTELSRIATLVEAAQTSRSKTQDLADKVSSIFVPTVLIISALTMIVWAVLGQGVTAAFTAGVAVLIIAC
    PCALGLATPMALLAGTGRGARLGIVIKGAGSLERARGIDVMAMDKTGTLTTGRMAVVAVWDESGRVVNISDNPPALAVTA
    ALEVGSEHPISRAIVEACPGVAPAEDFRALPGLGVSGTVNGLPAKAGRVSLFDAIPDTLSKNVERAQAEGRTVLVVGRGD
    DILGAIAVSDEIKPEAVVAVKRMVQAGVRPVLVTGDNSGAAAHVASELGIDEVMSEVMPADKVDVVTRLCSDGSRVAMMG
    DGVNDAAALQTADLSIAMGTGTDVAIAASDIICTRGDPRLAVDALSLAHATDRTIRQNLFWAFAYNVIAIPVAAVGLLSP
    VIAAAAMAFSSIFVVTNSMRLVRWHPGMSDSN

    >gi|50843676|ref|YP_056903.1| putative metal-associated protein (copper chaperone) [Propionibacterium acnes KPA171202]
    MHKTYTINGMTCEHCVKAITEEVSALDGVDNVTVSLESGSMTIDSAEEIPFGKVADAVDEAGEYTVAEASSLDTAGHPGG
    QCGCGGHGHAGKKAEGSGCGCGGHQHSEEAAAKHAEHASKGGCGCGGHQA

    >gi|50843746|ref|YP_056973.1| thioredoxin reductase [Propionibacterium acnes KPA171202]
    MTTQALTPNTILGNISLSDPSEIDTTQPFPETVGADVHGNDEPRDVIIVGSGPAGYTAAVYTARAGLKPLVFEGSMDAGG
    ALMQTTEVENYPGFSEGIMGPDLMAQMRAQAERFGAELIADDVTDIDLTGEIKKLVDTDGNTYKAHVVILAMGSAYRKLG
    LEDEPRLSGRGVSW
    CATCDGFFFTGKDIAVVGGGDSAVEEATFLTRFANSVTLVHRRDQLRASQIMADRAAADPKITFAW
    NSEVVAMQGESKLESITLRDTKTGEERQLEVAGVFEAIGHDPRSELVRGQVDLDDAGYVVCAEPSTRTNVPGVFACGDLV
    DSHYQQAVTAAGSGCRAALDAERFLTELGR

    >gi|50843751|ref|YP_056978.1| thioredoxin [Propionibacterium acnes KPA171202]
    MVRDASFDRDFSHRVMAASCSTPRVRLAFVNERCRSNRHDLDSSGRLRKAVMNNVIEVTDATFASEVLGASKPVLVDYWA
    DW
    CAPCKQLSPIIEELAGTYGDRMVFAKVDTNANTRVAAEQGIMSLPTIQVWQGGQLVKSLQGGKTKKALVKIIEEFVA